


| Basic Information | |
|---|---|
| Family ID | F056002 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 40 residues |
| Representative Sequence | TPSSNSSLDYRRSDARIVENGFATSGGLSKSAKVVLG |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.609 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.261 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.797 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.623 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF13586 | DDE_Tnp_1_2 | 2.90 |
| PF13467 | RHH_4 | 2.90 |
| PF04392 | ABC_sub_bind | 2.17 |
| PF00042 | Globin | 2.17 |
| PF00589 | Phage_integrase | 2.17 |
| PF13340 | DUF4096 | 2.17 |
| PF01527 | HTH_Tnp_1 | 2.17 |
| PF00873 | ACR_tran | 1.45 |
| PF01522 | Polysacc_deac_1 | 1.45 |
| PF03069 | FmdA_AmdA | 1.45 |
| PF04011 | LemA | 0.72 |
| PF05239 | PRC | 0.72 |
| PF13489 | Methyltransf_23 | 0.72 |
| PF00816 | Histone_HNS | 0.72 |
| PF13439 | Glyco_transf_4 | 0.72 |
| PF01636 | APH | 0.72 |
| PF02397 | Bac_transf | 0.72 |
| PF00596 | Aldolase_II | 0.72 |
| PF07978 | NIPSNAP | 0.72 |
| PF02371 | Transposase_20 | 0.72 |
| PF12686 | DUF3800 | 0.72 |
| PF12728 | HTH_17 | 0.72 |
| PF03992 | ABM | 0.72 |
| PF17201 | Cache_3-Cache_2 | 0.72 |
| PF07929 | PRiA4_ORF3 | 0.72 |
| PF13517 | FG-GAP_3 | 0.72 |
| PF03169 | OPT | 0.72 |
| PF04964 | Flp_Fap | 0.72 |
| PF02776 | TPP_enzyme_N | 0.72 |
| PF13358 | DDE_3 | 0.72 |
| PF02518 | HATPase_c | 0.72 |
| PF04519 | Bactofilin | 0.72 |
| PF01548 | DEDD_Tnp_IS110 | 0.72 |
| PF01977 | UbiD | 0.72 |
| PF07690 | MFS_1 | 0.72 |
| PF13676 | TIR_2 | 0.72 |
| PF01068 | DNA_ligase_A_M | 0.72 |
| PF00083 | Sugar_tr | 0.72 |
| PF03080 | Neprosin | 0.72 |
| PF13193 | AMP-binding_C | 0.72 |
| PF00476 | DNA_pol_A | 0.72 |
| PF00126 | HTH_1 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG1017 | Hemoglobin-like flavoprotein | Energy production and conversion [C] | 2.17 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.17 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 1.45 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 1.45 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.45 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.72 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.72 |
| COG1297 | Predicted oligopeptide transporter, OPT family | General function prediction only [R] | 0.72 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.72 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.72 |
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.72 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 0.72 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.06 % |
| Unclassified | root | N/A | 15.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_14397818 | Not Available | 540 | Open in IMG/M |
| 3300001593|JGI12635J15846_10188992 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300005332|Ga0066388_101138136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1326 | Open in IMG/M |
| 3300005332|Ga0066388_103613513 | Not Available | 789 | Open in IMG/M |
| 3300005332|Ga0066388_104047641 | Not Available | 747 | Open in IMG/M |
| 3300005332|Ga0066388_105406346 | Not Available | 647 | Open in IMG/M |
| 3300005439|Ga0070711_100201116 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300005518|Ga0070699_100756921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 888 | Open in IMG/M |
| 3300005713|Ga0066905_100418409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1092 | Open in IMG/M |
| 3300005713|Ga0066905_101032737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 726 | Open in IMG/M |
| 3300005713|Ga0066905_101432710 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005713|Ga0066905_101788463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 566 | Open in IMG/M |
| 3300005713|Ga0066905_102017936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 535 | Open in IMG/M |
| 3300005764|Ga0066903_101649520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1218 | Open in IMG/M |
| 3300005764|Ga0066903_102072489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1094 | Open in IMG/M |
| 3300005764|Ga0066903_103783493 | Not Available | 813 | Open in IMG/M |
| 3300005764|Ga0066903_105038266 | Not Available | 700 | Open in IMG/M |
| 3300005764|Ga0066903_106612845 | Not Available | 603 | Open in IMG/M |
| 3300005764|Ga0066903_108720705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 515 | Open in IMG/M |
| 3300006046|Ga0066652_100209040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1683 | Open in IMG/M |
| 3300006173|Ga0070716_100209119 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300006175|Ga0070712_100773679 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300006844|Ga0075428_100459468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1363 | Open in IMG/M |
| 3300006846|Ga0075430_101558936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 542 | Open in IMG/M |
| 3300006853|Ga0075420_100603435 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300006871|Ga0075434_100472899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1275 | Open in IMG/M |
| 3300006880|Ga0075429_100754394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 852 | Open in IMG/M |
| 3300007258|Ga0099793_10194989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 970 | Open in IMG/M |
| 3300010043|Ga0126380_10884883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium macuxiense | 740 | Open in IMG/M |
| 3300010046|Ga0126384_10377876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1189 | Open in IMG/M |
| 3300010047|Ga0126382_10163158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1542 | Open in IMG/M |
| 3300010047|Ga0126382_10771098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300010047|Ga0126382_12231190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 527 | Open in IMG/M |
| 3300010048|Ga0126373_11505362 | Not Available | 738 | Open in IMG/M |
| 3300010361|Ga0126378_13228169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 518 | Open in IMG/M |
| 3300010366|Ga0126379_10086150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2742 | Open in IMG/M |
| 3300010366|Ga0126379_10749303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 1073 | Open in IMG/M |
| 3300010366|Ga0126379_11612846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
| 3300010397|Ga0134124_10503849 | Not Available | 1171 | Open in IMG/M |
| 3300010398|Ga0126383_10177160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2021 | Open in IMG/M |
| 3300010398|Ga0126383_13265584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 530 | Open in IMG/M |
| 3300012202|Ga0137363_11294655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300012204|Ga0137374_10259760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1450 | Open in IMG/M |
| 3300012360|Ga0137375_10059888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 4091 | Open in IMG/M |
| 3300012360|Ga0137375_10133337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2458 | Open in IMG/M |
| 3300012361|Ga0137360_10656210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 900 | Open in IMG/M |
| 3300012948|Ga0126375_10026216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2812 | Open in IMG/M |
| 3300012971|Ga0126369_12294428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 626 | Open in IMG/M |
| 3300014501|Ga0182024_10430462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. Root604 | 1698 | Open in IMG/M |
| 3300014501|Ga0182024_10600773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1378 | Open in IMG/M |
| 3300016270|Ga0182036_11025691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 681 | Open in IMG/M |
| 3300016319|Ga0182033_10056312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2694 | Open in IMG/M |
| 3300016319|Ga0182033_10172333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1694 | Open in IMG/M |
| 3300016319|Ga0182033_10935235 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Altiarchaeota → unclassified Candidatus Altiarchaeota → Candidatus Altiarchaeota archaeon | 769 | Open in IMG/M |
| 3300016341|Ga0182035_11912676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300016357|Ga0182032_11355811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300016357|Ga0182032_12043492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Luteibacter | 503 | Open in IMG/M |
| 3300016371|Ga0182034_11107063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 687 | Open in IMG/M |
| 3300016371|Ga0182034_11340075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 625 | Open in IMG/M |
| 3300016387|Ga0182040_11647877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 547 | Open in IMG/M |
| 3300016387|Ga0182040_11795596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 525 | Open in IMG/M |
| 3300016404|Ga0182037_10043212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2959 | Open in IMG/M |
| 3300016404|Ga0182037_11209827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 664 | Open in IMG/M |
| 3300016404|Ga0182037_11447909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300016422|Ga0182039_10385774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1185 | Open in IMG/M |
| 3300018056|Ga0184623_10153859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium liaoningense | 1063 | Open in IMG/M |
| 3300018078|Ga0184612_10544868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
| 3300018083|Ga0184628_10164233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1157 | Open in IMG/M |
| 3300025898|Ga0207692_10118988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1476 | Open in IMG/M |
| 3300026997|Ga0207784_1009660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1061 | Open in IMG/M |
| 3300027041|Ga0209876_1014934 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300027909|Ga0209382_11025339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
| 3300031090|Ga0265760_10368635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 516 | Open in IMG/M |
| 3300031543|Ga0318516_10120237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1497 | Open in IMG/M |
| 3300031543|Ga0318516_10153172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 1325 | Open in IMG/M |
| 3300031543|Ga0318516_10732049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300031544|Ga0318534_10002911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7533 | Open in IMG/M |
| 3300031545|Ga0318541_10296037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 901 | Open in IMG/M |
| 3300031546|Ga0318538_10240921 | Not Available | 970 | Open in IMG/M |
| 3300031546|Ga0318538_10437666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 708 | Open in IMG/M |
| 3300031546|Ga0318538_10781087 | Not Available | 518 | Open in IMG/M |
| 3300031573|Ga0310915_10336765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1068 | Open in IMG/M |
| 3300031668|Ga0318542_10358109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 751 | Open in IMG/M |
| 3300031680|Ga0318574_10805083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300031681|Ga0318572_10039287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2504 | Open in IMG/M |
| 3300031682|Ga0318560_10011927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3768 | Open in IMG/M |
| 3300031719|Ga0306917_10327386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1187 | Open in IMG/M |
| 3300031724|Ga0318500_10183581 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300031744|Ga0306918_10127126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1855 | Open in IMG/M |
| 3300031744|Ga0306918_10171418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1618 | Open in IMG/M |
| 3300031744|Ga0306918_10264355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1316 | Open in IMG/M |
| 3300031747|Ga0318502_10365548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 855 | Open in IMG/M |
| 3300031768|Ga0318509_10167202 | Not Available | 1217 | Open in IMG/M |
| 3300031770|Ga0318521_10786617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 579 | Open in IMG/M |
| 3300031797|Ga0318550_10617533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300031805|Ga0318497_10621766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 606 | Open in IMG/M |
| 3300031805|Ga0318497_10744527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300031833|Ga0310917_10699901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 686 | Open in IMG/M |
| 3300031835|Ga0318517_10529211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300031860|Ga0318495_10137934 | Not Available | 1099 | Open in IMG/M |
| 3300031880|Ga0318544_10078986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1222 | Open in IMG/M |
| 3300031890|Ga0306925_10082880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3393 | Open in IMG/M |
| 3300031890|Ga0306925_10121787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 2791 | Open in IMG/M |
| 3300031890|Ga0306925_10139965 | All Organisms → cellular organisms → Bacteria | 2601 | Open in IMG/M |
| 3300031890|Ga0306925_11075941 | Not Available | 814 | Open in IMG/M |
| 3300031890|Ga0306925_11373987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300031890|Ga0306925_11689668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 611 | Open in IMG/M |
| 3300031893|Ga0318536_10209212 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300031893|Ga0318536_10295201 | Not Available | 822 | Open in IMG/M |
| 3300031897|Ga0318520_10523189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 733 | Open in IMG/M |
| 3300031910|Ga0306923_11042510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 885 | Open in IMG/M |
| 3300031910|Ga0306923_11771782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 635 | Open in IMG/M |
| 3300031910|Ga0306923_12388705 | Not Available | 524 | Open in IMG/M |
| 3300031912|Ga0306921_10202367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2327 | Open in IMG/M |
| 3300031912|Ga0306921_10948834 | Not Available | 973 | Open in IMG/M |
| 3300031941|Ga0310912_11189205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 580 | Open in IMG/M |
| 3300031942|Ga0310916_10542940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 989 | Open in IMG/M |
| 3300031946|Ga0310910_10454833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1016 | Open in IMG/M |
| 3300031947|Ga0310909_10056646 | Not Available | 3031 | Open in IMG/M |
| 3300031947|Ga0310909_10076323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2646 | Open in IMG/M |
| 3300031947|Ga0310909_10260089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 1451 | Open in IMG/M |
| 3300031947|Ga0310909_10284797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1383 | Open in IMG/M |
| 3300031954|Ga0306926_10126741 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Altiarchaeota → unclassified Candidatus Altiarchaeota → Candidatus Altiarchaeota archaeon | 3152 | Open in IMG/M |
| 3300031954|Ga0306926_10219802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum | 2357 | Open in IMG/M |
| 3300031954|Ga0306926_11091377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 944 | Open in IMG/M |
| 3300031954|Ga0306926_11838853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300032001|Ga0306922_10100906 | Not Available | 3052 | Open in IMG/M |
| 3300032001|Ga0306922_10808845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 979 | Open in IMG/M |
| 3300032051|Ga0318532_10317828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 552 | Open in IMG/M |
| 3300032059|Ga0318533_10665240 | Not Available | 764 | Open in IMG/M |
| 3300032061|Ga0315540_10065063 | Not Available | 1719 | Open in IMG/M |
| 3300032061|Ga0315540_10456762 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300032075|Ga0310890_10103526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1790 | Open in IMG/M |
| 3300032076|Ga0306924_10017398 | All Organisms → cellular organisms → Bacteria | 7551 | Open in IMG/M |
| 3300032076|Ga0306924_10060145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4216 | Open in IMG/M |
| 3300032091|Ga0318577_10012076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3427 | Open in IMG/M |
| 3300032094|Ga0318540_10209842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 939 | Open in IMG/M |
| 3300033289|Ga0310914_10063577 | Not Available | 3083 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.35% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.62% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.17% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 1.45% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026997 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 66 (SPAdes) | Environmental | Open in IMG/M |
| 3300027041 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_143978181 | 3300000550 | Soil | LSQLCPPYDTPSSNCSLHYRHSDARIVENGSATSGGVSKSAKGVLV* |
| JGI12635J15846_101889922 | 3300001593 | Forest Soil | PPYATPSSNSSLDYRRSGARIVENGFATSGGVSKSAKVVLGRGLINAQP* |
| Ga0066388_1011381363 | 3300005332 | Tropical Forest Soil | PYATPSSNSSLDYRRSVARIVENGFATSGGLSKSAKVVLVMA* |
| Ga0066388_1036135131 | 3300005332 | Tropical Forest Soil | YVTPSSSSSLEYHRSDARIVENGFAAGSGMINSAKVGLGRALINPRFSALAG* |
| Ga0066388_1040476412 | 3300005332 | Tropical Forest Soil | PYVTPSSSSSLEYHRSDARIVENGFAAGSGMINSAKVGLI* |
| Ga0066388_1054063461 | 3300005332 | Tropical Forest Soil | PYAEPSSNSSLGYHRNDAHTAENGFAASSGMSESAKVVLD* |
| Ga0070711_1002011161 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PPYATPSSNSSLDYRRSDARIVENGFATSGGVSKSAKVVLR* |
| Ga0070699_1007569212 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PCATPFSNSSLDYRRSDARIVKNGFAANSSVSKSAKVVLD* |
| Ga0066905_1004184093 | 3300005713 | Tropical Forest Soil | TPFSNFSLDYRRSDARIVENGFAASSGMSKSAKVVLS* |
| Ga0066905_1010327373 | 3300005713 | Tropical Forest Soil | PYATPSSNSSLDYRRSDARIVENGFATSGGLSRSAKVVLDHPPRAPV* |
| Ga0066905_1014327101 | 3300005713 | Tropical Forest Soil | SSSSSLEYHRSDARIVENGFAAGSGMSNSAKVGLGGISAT* |
| Ga0066905_1017884632 | 3300005713 | Tropical Forest Soil | ATPSSNSSLDYRRSVARIVENGFATSGGLSKSAKVVLEHPDE* |
| Ga0066905_1020179362 | 3300005713 | Tropical Forest Soil | NSSLDYRRSDARIVENGFATSGGLSKSAKVVLGLVGPKKSR* |
| Ga0066903_1016495201 | 3300005764 | Tropical Forest Soil | YATPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLA* |
| Ga0066903_1020724891 | 3300005764 | Tropical Forest Soil | CATPSSNSSLGYRRSDARIVENGFATSSGMNKSAKVVLV* |
| Ga0066903_1037834932 | 3300005764 | Tropical Forest Soil | ATPFSNSSLDYHHSDAHIVENGFATGGGVSKSAKVVLI* |
| Ga0066903_1050382661 | 3300005764 | Tropical Forest Soil | PYATPFSNSSLDYHHSDAHIVENGFATGGGVSKSAKVVLTLLDK* |
| Ga0066903_1066128453 | 3300005764 | Tropical Forest Soil | PYVTPSSSSSLEYHRSDARIVENGFAAGSGMSNSAKVGLVHREVQ* |
| Ga0066903_1087207052 | 3300005764 | Tropical Forest Soil | PCATRSSNSSLDYRHSDARIVESGFATKSGVSKSAKVVLGYVR* |
| Ga0066652_1002090401 | 3300006046 | Soil | SLDCRRNVARTAEGGFATHSGVSKSAKVVLTNTP* |
| Ga0070716_1002091191 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | NSSLDYRRSDARIVENGFATSGGVSKSAKVVLGL* |
| Ga0070712_1007736793 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PYATPSSNSSLDYRRSDARIVENGFATSGGVSKSAKVVLV* |
| Ga0075428_1004594682 | 3300006844 | Populus Rhizosphere | PYDTPSSNCSLHYRHSDARIVENGFATSGGVSKSAKVVLD* |
| Ga0075430_1015589363 | 3300006846 | Populus Rhizosphere | TPSSNSSLDYRRSDARIAENGFATSNGVSKSAKVVLT* |
| Ga0075420_1006034351 | 3300006853 | Populus Rhizosphere | SNSSLDYRRGDARIAENGFATSSGMNKSAKVVLIWIVSRWP* |
| Ga0075434_1004728991 | 3300006871 | Populus Rhizosphere | PYATPSSNSSLDYRRSDARIVENGFAASGAVSKSAKVVLGIINLLVSF* |
| Ga0075429_1007543941 | 3300006880 | Populus Rhizosphere | TPSSNSSLDYRRSDARIAENGFATSNGVSKSAKVVLAN* |
| Ga0099793_101949892 | 3300007258 | Vadose Zone Soil | VRHAINSSLDYRRGDARIAENGFATSGGVNKSAKVVLV* |
| Ga0126380_108848831 | 3300010043 | Tropical Forest Soil | SSSSSLEYHRSDARIVENGFAAGSGMSNSAKVGLGRVLIK* |
| Ga0126384_103778763 | 3300010046 | Tropical Forest Soil | CPPCATPFSNFSLDYRRSDARIVENGFAASSGMSKSAKVVLS* |
| Ga0126382_101631582 | 3300010047 | Tropical Forest Soil | PPYVTPSSSSSLEYHRSDARIVENGFAAGSGMSNSAKVGLV* |
| Ga0126382_107710983 | 3300010047 | Tropical Forest Soil | ATPSSNSSLDYRRSVARIVENGFATSGGLSKSAKVVLGLHAD* |
| Ga0126382_122311901 | 3300010047 | Tropical Forest Soil | SSLDYRRSDARIVENGFATSGGLSKSAKVVLDKDCVSKYTL* |
| Ga0126373_115053624 | 3300010048 | Tropical Forest Soil | PYATPFSNSSLDYHHSDAHIVENGFATGGGVSKSAKVVLI* |
| Ga0126378_132281691 | 3300010361 | Tropical Forest Soil | SSNSSLDYRRSDARIVENGFATSSGPSESAKVVLVRRI* |
| Ga0126379_100861503 | 3300010366 | Tropical Forest Soil | ATPSSNSSLDYRRSDARIVENGFATSGGLSKSAKVVLD* |
| Ga0126379_107493031 | 3300010366 | Tropical Forest Soil | QPCATPSSNSSLGYRRSDARIVENGFATSSGMNKSAKVVLV* |
| Ga0126379_116128463 | 3300010366 | Tropical Forest Soil | PSSNSSLDYRRSDARIVENGFATTGGVSKSDKVVLA* |
| Ga0134124_105038494 | 3300010397 | Terrestrial Soil | PSSNSSLDYRHSDARIVENGFAASSRVSKSAKVVLGSVFS* |
| Ga0126383_101771601 | 3300010398 | Tropical Forest Soil | SSNSSLDYRLSDARIVENGFATSGGLSKSAKVVLVYS* |
| Ga0126383_132655841 | 3300010398 | Tropical Forest Soil | PPYATPSSNSSLDYRRSDARIVENGFATSGGLSKSAKVVLD* |
| Ga0137363_112946551 | 3300012202 | Vadose Zone Soil | SNSSLDYRRSDARIVKNGFAANSSVSKSAKVVLGSILIEE* |
| Ga0137374_102597601 | 3300012204 | Vadose Zone Soil | SNSSLDYRRSDARIVENGFAASSGVSKSAKVVLGSD* |
| Ga0137375_100598881 | 3300012360 | Vadose Zone Soil | SNSSLDYRRSDARIAENGFAAGSGVSKSAKVVLAS* |
| Ga0137375_101333376 | 3300012360 | Vadose Zone Soil | SSLDYRRSDARIVENGFAASSGVSKSAKVVLGSD* |
| Ga0137360_106562103 | 3300012361 | Vadose Zone Soil | ATPSSNSSLDYRRSDARIAENGFAAGSGVSKSAKVVLVRGN* |
| Ga0126375_100262161 | 3300012948 | Tropical Forest Soil | LCPPYATPSSNSSLDYRRSDARIVENGFATSGGLSKSAKVVLD* |
| Ga0126369_122944282 | 3300012971 | Tropical Forest Soil | SNSSLDYRRSDARIVENGFATAGGVSKSAKVVLVSLSTSK* |
| Ga0182024_104304623 | 3300014501 | Permafrost | ATPSSNSSLDYRRSDARIAENGFATSGEVSKSAKVVLDPFRRRK* |
| Ga0182024_106007731 | 3300014501 | Permafrost | SNSSLDYRRSDARIAENGFATSGEVSKSAKVVLDRRRRPFS* |
| Ga0182036_110256912 | 3300016270 | Soil | PSSNSSLDYRRSDARIVENGFATSGGLSKSAKVVPG |
| Ga0182033_100563121 | 3300016319 | Soil | FSNSSLDPRRSDARTAENGFATSGGLSKSAKVVLV |
| Ga0182033_101723335 | 3300016319 | Soil | PPYATPSSNSSLDYRRSDARIVENGFATSGGLSESAKVVLV |
| Ga0182033_109352351 | 3300016319 | Soil | SSSSSLEHHRSDARIVENGFAASSGVSKSAKVVLI |
| Ga0182035_119126761 | 3300016341 | Soil | TPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLA |
| Ga0182032_113558112 | 3300016357 | Soil | PYATPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLMPW |
| Ga0182032_120434922 | 3300016357 | Soil | SNSSLDYRRSDARIVKHGFATSGGLSKSAKVVLGDVD |
| Ga0182034_111070633 | 3300016371 | Soil | SSNSSLDYRRSDARIVENGFATSGGLSESAKVVLV |
| Ga0182034_113400751 | 3300016371 | Soil | YATPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLV |
| Ga0182040_116478772 | 3300016387 | Soil | PPYATPSSNSSLDYRRSDARIVENGFATSDGLSKSAKVVLD |
| Ga0182040_117955962 | 3300016387 | Soil | CPPCATPSSSSSLDYRRDDARIAENGFATNGGMSKSAKVVL |
| Ga0182037_100432125 | 3300016404 | Soil | PPYATPFSNSSLDYRRSDARIVKHGFATSGGLSKSAKVVLV |
| Ga0182037_112098271 | 3300016404 | Soil | TPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLV |
| Ga0182037_114479091 | 3300016404 | Soil | SSNFSLDYRRSDARIVENGFAASSGVNKSAKVVLNSGTL |
| Ga0182039_103857741 | 3300016422 | Soil | PPYATPSSNCSLDYRRSDARIVENGFATSGGLSKSAKVVLGCVLNFH |
| Ga0184623_101538591 | 3300018056 | Groundwater Sediment | CSLHYRHSDARIVENGFATSGGVSKSAKVVLGSGLN |
| Ga0184612_105448681 | 3300018078 | Groundwater Sediment | SNCSLHYRHSDARIVENGFATSGGVSKSAKVVLGRVDKIY |
| Ga0184628_101642332 | 3300018083 | Groundwater Sediment | SSLDYRRSDARIVGNGFAASSGVSKSAKVVLVNMSRLADRA |
| Ga0207692_101189881 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TPSSNSSLDYRRSDARIVENGFATSGGVSKSAKVVLR |
| Ga0207784_10096603 | 3300026997 | Tropical Forest Soil | RSSNSSLDYRHSDARIVENGFATNSGVSKSAKVVLGPVFS |
| Ga0209876_10149341 | 3300027041 | Groundwater Sand | LSQLCPPYDTPSSNCSLHYRHSDARIVENGFATSGGVSKSAKVVLVT |
| Ga0209382_110253391 | 3300027909 | Populus Rhizosphere | NSSLDYRRGDARIAENGFATSSGMNKSAKVVLVIP |
| Ga0265760_103686351 | 3300031090 | Soil | SNSSLDYRRSDARIAENGFATSGEVSKSAKVVLGFRF |
| Ga0318516_101202372 | 3300031543 | Soil | ATPSSSSSLDYRRDDARIAENGFATNGGMSKSAKVVLVSFINTPLH |
| Ga0318516_101531723 | 3300031543 | Soil | TPFSNSSLDYRRSDARIVKHGFATSGGLSKSAKVVLV |
| Ga0318516_107320491 | 3300031543 | Soil | LCPPYATPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLA |
| Ga0318534_100029111 | 3300031544 | Soil | PSSNSSLDYRRSDARIVENGFATSGGLSESAKVVLD |
| Ga0318541_102960373 | 3300031545 | Soil | FSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLA |
| Ga0318538_102409211 | 3300031546 | Soil | TPSSNSSLDYRRGDAHIAENGFATSSGMNKSAKVVLV |
| Ga0318538_104376661 | 3300031546 | Soil | CPPCATPSSSSSLDYRRDDARIAENGFATNGGMSKSAKVVLD |
| Ga0318538_107810872 | 3300031546 | Soil | SSNSSLDYRRGDAHIAENGFATSSGMNKSAKVVLGNAQ |
| Ga0310915_103367653 | 3300031573 | Soil | SSSSSLDYRRDDARIAENGFATNGGMSKSAKVVLGPVFS |
| Ga0318542_103581092 | 3300031668 | Soil | CPPYATPFSNSSLDYRRSDARIVKHGFATSGGLSKSAKVVLV |
| Ga0318574_108050832 | 3300031680 | Soil | PYATPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLA |
| Ga0318572_100392871 | 3300031681 | Soil | CPPYATPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLA |
| Ga0318560_100119275 | 3300031682 | Soil | PPYATPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLA |
| Ga0306917_103273861 | 3300031719 | Soil | CATPSSSSSLDYRRDDARIAENGFATNGGMSKSAKVVL |
| Ga0318500_101835811 | 3300031724 | Soil | SSSSSLDYRRDDARIAENGFATNGGMSKSAKVVLRPPELRQ |
| Ga0306918_101271261 | 3300031744 | Soil | CATPSSSSSLDYRRDDARIAENGFATNGGMSKSAKVVLA |
| Ga0306918_101714181 | 3300031744 | Soil | PYATPSSNSSLDYRRSDARIVENGFATSGGLSESAKVVLV |
| Ga0306918_102643553 | 3300031744 | Soil | PCPPCATPSSSSSLDYRRDDARIAENGFATNGGMSKSAKVVL |
| Ga0318502_103655482 | 3300031747 | Soil | FSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLV |
| Ga0318509_101672023 | 3300031768 | Soil | TPSSNSSLDYRRGDAHIAENGFATSSGMNKSAKVVLGNAQ |
| Ga0318521_107866172 | 3300031770 | Soil | SNSSLDYRRSDARIVENGFATSGGLSKSAKVVLASRGAAT |
| Ga0318550_106175332 | 3300031797 | Soil | ATPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLA |
| Ga0318497_106217661 | 3300031805 | Soil | CPPCATPSSSSSLDYRRDDARIAENGFATNGGMSKSAKVVLVSFINTPLH |
| Ga0318497_107445272 | 3300031805 | Soil | YATPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLA |
| Ga0310917_106999012 | 3300031833 | Soil | ATPSSSSSLDYRRDDARIAENGFATNGGMSKSAKVVLGLGLN |
| Ga0318517_105292112 | 3300031835 | Soil | PFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLA |
| Ga0318495_101379343 | 3300031860 | Soil | PSSNSSLDYRRGDAHIAENGFATSSGMNKSAKVVLGNAQ |
| Ga0318544_100789863 | 3300031880 | Soil | FSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLDRVILRF |
| Ga0306925_100828801 | 3300031890 | Soil | LCPPYATPSSNSSLDYRRSDARIVENGFATSGGLSKSAKVVLD |
| Ga0306925_101217871 | 3300031890 | Soil | LCPPYATPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLKRPAPPR |
| Ga0306925_101399654 | 3300031890 | Soil | FSNFSLDYRRSDARIVENGFAASSGMSKSAKVVLD |
| Ga0306925_110759413 | 3300031890 | Soil | TPSSNSSLDYRRSDARTVENGSATSGGLNKSAKVVLV |
| Ga0306925_113739871 | 3300031890 | Soil | ATPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLRACTHK |
| Ga0306925_116896681 | 3300031890 | Soil | PPCATPSSSSSLDYRRDDARIAENGFATNGGMSKSAKVVL |
| Ga0318536_102092122 | 3300031893 | Soil | RHAISNSSLDYRRSDARIVENGFATSGGLSESAKVVLD |
| Ga0318536_102952011 | 3300031893 | Soil | ATPFSNSSLDYRRSDARIVKHGFATSGGLSKSAKVVLATAT |
| Ga0318520_105231892 | 3300031897 | Soil | PFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLRRVLINPL |
| Ga0306923_110425101 | 3300031910 | Soil | PYATPSSNSSLDYRRSDARIVENGFATSGGLSKSAKVVPG |
| Ga0306923_117717821 | 3300031910 | Soil | NSSLDYRRSDARIVEHGFATSGGLSKSAKVVLAGTR |
| Ga0306923_123887051 | 3300031910 | Soil | SSNSSLDYRRSDARTVENGSATSGGLNKSAKVVLV |
| Ga0306921_102023671 | 3300031912 | Soil | NSSLDYRRSDARIVENGFATSGGLSKSAKVVLAASIN |
| Ga0306921_109488341 | 3300031912 | Soil | SSSSLDYRRDDARIAENGFATNGGMSKSAKVVLVSVAKCRN |
| Ga0310912_111892052 | 3300031941 | Soil | TPSSSSSLDYRRDDARIAENGFATNGGMSKSAKVVLV |
| Ga0310916_105429401 | 3300031942 | Soil | ATPSSSSSLDYRRDDARIAENGFATNGGMSKSAKVVLDYV |
| Ga0310910_104548332 | 3300031946 | Soil | SSSLDYRRDDARIAENGFATNGGMSKSAKVVLVTQCLGEF |
| Ga0310909_100566461 | 3300031947 | Soil | PSSNSSLDYRRSDARIVENGFATSGGLSESAKVVLV |
| Ga0310909_100763231 | 3300031947 | Soil | SNSSLDYRRSDARIVKHGFATSGGLSKSAKVVLGRVLIN |
| Ga0310909_102600893 | 3300031947 | Soil | PYATPSSNSSLDYRRSDARIVENGFATSGGLSKSAKVVLV |
| Ga0310909_102847971 | 3300031947 | Soil | TTPFSNFSLDYRRSDARIVENGFAASSGMSKSAKVVLD |
| Ga0306926_101267411 | 3300031954 | Soil | PYVTPSSSSSLEHHRSDARIVENGFAASSGVSKSAKVVLI |
| Ga0306926_102198021 | 3300031954 | Soil | TPSSNSSLDYRRSDARTVENGSATSGGLNKSAKVVLD |
| Ga0306926_110913771 | 3300031954 | Soil | CPPYATPSSNSSLDYRRSDARIVENGFATSGGLSKSAKVVLV |
| Ga0306926_118388531 | 3300031954 | Soil | CPPYATPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLRACTHK |
| Ga0306922_101009068 | 3300032001 | Soil | LCPPYATPSSNSSLDYRRSDARIVENGFATSGGLSESAKVVLV |
| Ga0306922_108088451 | 3300032001 | Soil | TPSSNSSLDYRRSDARIVENGFATSGGLSKSAKVVLG |
| Ga0318532_103178281 | 3300032051 | Soil | PPYATPFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLARVAPM |
| Ga0318533_106652401 | 3300032059 | Soil | SSNSSLDYRRGDAHIAENGFATSSGMNKSAKVVLV |
| Ga0315540_100650631 | 3300032061 | Salt Marsh Sediment | PCATPSSRYSLDYHRSDARTVENGFATNGGLSKSAKVVLG |
| Ga0315540_104567621 | 3300032061 | Salt Marsh Sediment | PCATPSSRYSLDYHRSDARTVENGFATNGGLSKSAKVVLVQSQLLIR |
| Ga0310890_101035261 | 3300032075 | Soil | PASNSSLDYRHSDARIVENGFAASSRVSKSAKVVLDVMFPG |
| Ga0306924_1001739811 | 3300032076 | Soil | PYATPSSNSSLDYRRSDARIVENGFATSGGLSKSAKVVLD |
| Ga0306924_100601456 | 3300032076 | Soil | PSSNSSLDYRRSDARIVENGFATSGGLSKSAKVVLV |
| Ga0318577_100120766 | 3300032091 | Soil | PYATPSSNSSLDYRRSDARIVENGFATSGGLSKSAKVVLGRELINAQP |
| Ga0318540_102098421 | 3300032094 | Soil | PFSNSSLDYRRSDARIVEHGFATSGGLSKSAKVVLV |
| Ga0310914_100635777 | 3300033289 | Soil | YATPSSNSSLDYRRSDARIVENGFATSGGLSESAKVVLV |
| ⦗Top⦘ |