


| Basic Information | |
|---|---|
| Family ID | F056001 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 39 residues |
| Representative Sequence | GKPFPFRSPEGRVALVIEVEKARYTKLPFEHTPPK |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.11 % |
| % of genes near scaffold ends (potentially truncated) | 92.03 % |
| % of genes from short scaffolds (< 2000 bps) | 86.23 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.928 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.043 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.116 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.174 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.76% β-sheet: 0.00% Coil/Unstructured: 95.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF04972 | BON | 21.74 |
| PF00574 | CLP_protease | 7.97 |
| PF00583 | Acetyltransf_1 | 2.17 |
| PF01904 | DUF72 | 2.17 |
| PF00072 | Response_reg | 1.45 |
| PF00501 | AMP-binding | 1.45 |
| PF05685 | Uma2 | 1.45 |
| PF01964 | ThiC_Rad_SAM | 0.72 |
| PF00106 | adh_short | 0.72 |
| PF01925 | TauE | 0.72 |
| PF01063 | Aminotran_4 | 0.72 |
| PF13458 | Peripla_BP_6 | 0.72 |
| PF13426 | PAS_9 | 0.72 |
| PF00581 | Rhodanese | 0.72 |
| PF01734 | Patatin | 0.72 |
| PF12695 | Abhydrolase_5 | 0.72 |
| PF06649 | DUF1161 | 0.72 |
| PF14581 | SseB_C | 0.72 |
| PF00892 | EamA | 0.72 |
| PF01243 | Putative_PNPOx | 0.72 |
| PF02900 | LigB | 0.72 |
| PF13620 | CarboxypepD_reg | 0.72 |
| PF00117 | GATase | 0.72 |
| PF04349 | MdoG | 0.72 |
| PF02826 | 2-Hacid_dh_C | 0.72 |
| PF00211 | Guanylate_cyc | 0.72 |
| PF04389 | Peptidase_M28 | 0.72 |
| PF02668 | TauD | 0.72 |
| PF07110 | EthD | 0.72 |
| PF00248 | Aldo_ket_red | 0.72 |
| PF13145 | Rotamase_2 | 0.72 |
| PF02096 | 60KD_IMP | 0.72 |
| PF08338 | DUF1731 | 0.72 |
| PF13650 | Asp_protease_2 | 0.72 |
| PF10523 | BEN | 0.72 |
| PF13511 | DUF4124 | 0.72 |
| PF00753 | Lactamase_B | 0.72 |
| PF05569 | Peptidase_M56 | 0.72 |
| PF12172 | DUF35_N | 0.72 |
| PF01810 | LysE | 0.72 |
| PF08240 | ADH_N | 0.72 |
| PF07311 | Dodecin | 0.72 |
| PF04366 | Ysc84 | 0.72 |
| PF14667 | Polysacc_synt_C | 0.72 |
| PF01527 | HTH_Tnp_1 | 0.72 |
| PF00326 | Peptidase_S9 | 0.72 |
| PF01425 | Amidase | 0.72 |
| PF02515 | CoA_transf_3 | 0.72 |
| PF06026 | Rib_5-P_isom_A | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 15.94 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 15.94 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 7.97 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 2.17 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.45 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 1.45 |
| COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.72 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 0.72 |
| COG0706 | Membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.72 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.72 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.72 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.72 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.72 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.72 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.72 |
| COG3131 | Periplasmic glucan biosynthesis protein OpgG | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.72 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.72 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.93 % |
| Unclassified | root | N/A | 5.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459020|G1P06HT01AZMGC | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 618 | Open in IMG/M |
| 3300001084|JGI12648J13191_1012578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300001166|JGI12694J13545_1007591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1273 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100381486 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300003218|JGI26339J46600_10134245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 585 | Open in IMG/M |
| 3300004152|Ga0062386_101431242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 576 | Open in IMG/M |
| 3300004633|Ga0066395_10129326 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300005289|Ga0065704_10762869 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
| 3300005353|Ga0070669_101775538 | Not Available | 538 | Open in IMG/M |
| 3300005406|Ga0070703_10538609 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005446|Ga0066686_10892089 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 584 | Open in IMG/M |
| 3300005569|Ga0066705_10033437 | All Organisms → cellular organisms → Bacteria | 2784 | Open in IMG/M |
| 3300005575|Ga0066702_10962039 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005576|Ga0066708_10097232 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
| 3300005617|Ga0068859_102558246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300005719|Ga0068861_101696205 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300005764|Ga0066903_108793371 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005843|Ga0068860_100998936 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300006028|Ga0070717_10921375 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300006173|Ga0070716_100245160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1217 | Open in IMG/M |
| 3300006174|Ga0075014_100541888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300006354|Ga0075021_10156918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1377 | Open in IMG/M |
| 3300006796|Ga0066665_10730970 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300006804|Ga0079221_10225192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
| 3300006844|Ga0075428_101823505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300006871|Ga0075434_100139114 | All Organisms → cellular organisms → Bacteria | 2447 | Open in IMG/M |
| 3300006918|Ga0079216_10387156 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300007255|Ga0099791_10260773 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300007265|Ga0099794_10762972 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300009012|Ga0066710_100313825 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2302 | Open in IMG/M |
| 3300009093|Ga0105240_12644311 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300009147|Ga0114129_10462039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 1663 | Open in IMG/M |
| 3300009148|Ga0105243_11995166 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 614 | Open in IMG/M |
| 3300009156|Ga0111538_12594939 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5 | 635 | Open in IMG/M |
| 3300009165|Ga0105102_10296508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300009634|Ga0116124_1143609 | Not Available | 668 | Open in IMG/M |
| 3300009792|Ga0126374_11699880 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300010048|Ga0126373_10475534 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300010326|Ga0134065_10155976 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300010341|Ga0074045_10005328 | All Organisms → cellular organisms → Bacteria | 11261 | Open in IMG/M |
| 3300010379|Ga0136449_102148347 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 817 | Open in IMG/M |
| 3300010397|Ga0134124_10479433 | Not Available | 1200 | Open in IMG/M |
| 3300011088|Ga0138576_1170633 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300011120|Ga0150983_10661313 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300011270|Ga0137391_10616783 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 908 | Open in IMG/M |
| 3300012189|Ga0137388_10546784 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1076 | Open in IMG/M |
| 3300012198|Ga0137364_10994775 | Not Available | 634 | Open in IMG/M |
| 3300012203|Ga0137399_11376863 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012207|Ga0137381_11432312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300012208|Ga0137376_11369098 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300012211|Ga0137377_10042642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4164 | Open in IMG/M |
| 3300012211|Ga0137377_11750402 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012354|Ga0137366_11029086 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012358|Ga0137368_10583203 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300012360|Ga0137375_10917831 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 694 | Open in IMG/M |
| 3300012469|Ga0150984_113821759 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012922|Ga0137394_11280410 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 596 | Open in IMG/M |
| 3300012925|Ga0137419_10019344 | All Organisms → cellular organisms → Bacteria | 3937 | Open in IMG/M |
| 3300012927|Ga0137416_10796627 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300012972|Ga0134077_10032154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1867 | Open in IMG/M |
| 3300013100|Ga0157373_11273201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300014159|Ga0181530_10072116 | All Organisms → cellular organisms → Bacteria | 2152 | Open in IMG/M |
| 3300015241|Ga0137418_10003362 | All Organisms → cellular organisms → Bacteria | 14715 | Open in IMG/M |
| 3300015357|Ga0134072_10145615 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300015359|Ga0134085_10462518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300015373|Ga0132257_102395796 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300016294|Ga0182041_10330116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1275 | Open in IMG/M |
| 3300016404|Ga0182037_11234310 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300017656|Ga0134112_10120609 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300017959|Ga0187779_11159275 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300017970|Ga0187783_10029407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4072 | Open in IMG/M |
| 3300017995|Ga0187816_10371626 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300018074|Ga0184640_10084828 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300018090|Ga0187770_10021016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4424 | Open in IMG/M |
| 3300018090|Ga0187770_10364880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
| 3300018468|Ga0066662_12375723 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300018469|Ga0190270_11847867 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300018482|Ga0066669_10512335 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300019268|Ga0181514_1400446 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300020583|Ga0210401_10001091 | All Organisms → cellular organisms → Bacteria | 32265 | Open in IMG/M |
| 3300021073|Ga0210378_10107384 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300021401|Ga0210393_10939049 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300021402|Ga0210385_10245468 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300021403|Ga0210397_10717977 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300021407|Ga0210383_10013377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6940 | Open in IMG/M |
| 3300021475|Ga0210392_10694023 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300021479|Ga0210410_11344666 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300021560|Ga0126371_10291806 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300021560|Ga0126371_10515358 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 1344 | Open in IMG/M |
| 3300022523|Ga0242663_1131450 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300022534|Ga0224452_1217773 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300024251|Ga0247679_1067143 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300025313|Ga0209431_10926962 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 622 | Open in IMG/M |
| 3300025460|Ga0208562_1074357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300025506|Ga0208937_1003564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4640 | Open in IMG/M |
| 3300025581|Ga0208355_1079960 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300025922|Ga0207646_10445533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1168 | Open in IMG/M |
| 3300026294|Ga0209839_10018938 | All Organisms → cellular organisms → Bacteria | 2729 | Open in IMG/M |
| 3300026298|Ga0209236_1162097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300026312|Ga0209153_1185053 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300026325|Ga0209152_10397490 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
| 3300026333|Ga0209158_1357815 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300026360|Ga0257173_1017208 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300026537|Ga0209157_1146172 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1067 | Open in IMG/M |
| 3300026538|Ga0209056_10050278 | All Organisms → cellular organisms → Bacteria | 3737 | Open in IMG/M |
| 3300027334|Ga0209529_1077671 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300027619|Ga0209330_1001879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5800 | Open in IMG/M |
| 3300027812|Ga0209656_10172776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 1066 | Open in IMG/M |
| 3300027825|Ga0209039_10343565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 581 | Open in IMG/M |
| 3300027867|Ga0209167_10664895 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300027895|Ga0209624_10657548 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300028536|Ga0137415_10389235 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300028748|Ga0302156_10047698 | All Organisms → cellular organisms → Bacteria | 2335 | Open in IMG/M |
| 3300028759|Ga0302224_10392717 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300029636|Ga0222749_10199823 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300029999|Ga0311339_10913922 | Not Available | 832 | Open in IMG/M |
| 3300030006|Ga0299907_10612899 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 845 | Open in IMG/M |
| 3300030011|Ga0302270_10501094 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300030738|Ga0265462_10306065 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300031231|Ga0170824_114201331 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300031474|Ga0170818_102159557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300031573|Ga0310915_10249763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1248 | Open in IMG/M |
| 3300031708|Ga0310686_109577110 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031744|Ga0306918_11156326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300031778|Ga0318498_10221098 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 857 | Open in IMG/M |
| 3300031835|Ga0318517_10575365 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
| 3300031879|Ga0306919_10845947 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300031912|Ga0306921_10061917 | All Organisms → cellular organisms → Bacteria | 4272 | Open in IMG/M |
| 3300031942|Ga0310916_11005082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 696 | Open in IMG/M |
| 3300031962|Ga0307479_10853066 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300032060|Ga0318505_10585736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300032076|Ga0306924_10418473 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300032122|Ga0310895_10336521 | Not Available | 723 | Open in IMG/M |
| 3300032180|Ga0307471_101501262 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300032180|Ga0307471_103793613 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300032893|Ga0335069_12461783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300034894|Ga0373916_0084462 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.62% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.17% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.45% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.45% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.45% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.72% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.72% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.72% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459020 | Litter degradation NP2 | Engineered | Open in IMG/M |
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300034894 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.2 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2NP_01642180 | 2170459020 | Switchgrass, Maize And Mischanthus Litter | FCHREEGAKYTGKPFPFRSLEERVALAVEIEKARYTRLPFQHTPPE |
| JGI12648J13191_10125782 | 3300001084 | Forest Soil | LDAISYKYTGKPFPFRSTEGRVALVIEIEKVRYAKLPFEHAPPK* |
| JGI12694J13545_10075913 | 3300001166 | Forest Soil | ISYKYTGKPFPFRSTEGRVALVIEIEKVRYAKLPFEHAPPK* |
| JGIcombinedJ26739_1003814861 | 3300002245 | Forest Soil | RYVGKPFPMRGYEDRIALIIEALKVRYTKLPFEHTPPK* |
| JGI26339J46600_101342452 | 3300003218 | Bog Forest Soil | SHKYIGKDFPLRNPVGRVALVIEVDKARYTKLPFQHTPPK* |
| Ga0062386_1014312422 | 3300004152 | Bog Forest Soil | RKYTGKEFPFRDPAGRVALFIEVEKARYMKLPFQHTPPE* |
| Ga0066395_101293263 | 3300004633 | Tropical Forest Soil | PNLKVMDPISVKYTGKPFPFREPEGRVALIIEIDKARHVKLPFQHTPPEQ* |
| Ga0065704_107628691 | 3300005289 | Switchgrass Rhizosphere | AAGKYTGQPFPWRNPDGRVALVIEVDKARYTKLPFTHTPLR* |
| Ga0070669_1017755381 | 3300005353 | Switchgrass Rhizosphere | HKYTGKPFPMRGGEGRVALVIEVDKARYTKLPFAHTPPG* |
| Ga0070703_105386091 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | DAAAGKYTGQPFPWRNPDGRVAIVIEVHKARYTKLPFTHTPSR* |
| Ga0066686_108920891 | 3300005446 | Soil | VSHKYIGKSFPMRNHEGRVALVIEVDKARYTKLPFAHTPPRH* |
| Ga0066705_100334371 | 3300005569 | Soil | SHKYIGKPFPMRSPEGRVALVIEVDRARYTKLPFAHTPPRQ* |
| Ga0066702_109620392 | 3300005575 | Soil | PFPFRSPEGRVALMIGVEKARYTKLPFEHTPPSK* |
| Ga0066708_100972325 | 3300005576 | Soil | YIGKPFPMRSPEGRVALVIEVDKARYTKLPFAHTPPRQ* |
| Ga0068859_1025582461 | 3300005617 | Switchgrass Rhizosphere | KYTGQPFPWRNPDGRVALVIEVDKARYTKLPFAHTPLR* |
| Ga0068861_1016962052 | 3300005719 | Switchgrass Rhizosphere | AAAGKYTGQPFPWRNPDGRVAIVIEVHKARYTKLPFTHTPSR* |
| Ga0066903_1087933712 | 3300005764 | Tropical Forest Soil | VSRKYTGKPFPMRSPEGRVALIIEIEKARHLKIPFKHEPPK* |
| Ga0068860_1009989363 | 3300005843 | Switchgrass Rhizosphere | AADKYTGQPFPWRNPDGRVALVIEVDRARYTKLPFTPTPPR* |
| Ga0070717_109213752 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GKPFPMRSYEGRVALIIEVEKERYTKLPFRHTPPIG* |
| Ga0070716_1002451601 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GQMQFRSPEGRVALVIDVEKVRYTQLPFEHTTPK* |
| Ga0075014_1005418881 | 3300006174 | Watersheds | GKPFPLRDYEGRVALIIEIDKAKYTKLPFAHTPGK* |
| Ga0075021_101569183 | 3300006354 | Watersheds | GKPFPMRSPEGRVALVIEIEKARYTKLPFEHTPAA* |
| Ga0066665_107309702 | 3300006796 | Soil | MATSKYIDPISLKYTGKPFPFRSPEGGVALVIEVEKARYTKLAFEHTPPK* |
| Ga0079221_102251921 | 3300006804 | Agricultural Soil | PFPFRNPQGRVTLVIEIDKARYTKLPFEHTPPAV* |
| Ga0075428_1018235051 | 3300006844 | Populus Rhizosphere | AQYIGKPFPMRSYEGRVALVIEVDRLRYTKLPFAHTPPRK* |
| Ga0075434_1001391141 | 3300006871 | Populus Rhizosphere | KPFPMRSYEGRVALVVQVEKAKYTKLPFEHTPPKR* |
| Ga0079216_103871562 | 3300006918 | Agricultural Soil | VDAVSQKYTGKPFPMRRPEGRVALVIKADKARYVKIPFEHWLAPAR* |
| Ga0099791_102607732 | 3300007255 | Vadose Zone Soil | GKPFPMRSHEGRVALVIEVDKARYTKLPFAHTPPRQ* |
| Ga0099794_107629721 | 3300007265 | Vadose Zone Soil | GKPFPMRKPEGRVALIIEVEKERYTKLPFQHTPPK* |
| Ga0066710_1003138254 | 3300009012 | Grasslands Soil | KPFPMRSHEGRVALVIEVDKARYTKLPFAHTPPRQ |
| Ga0105240_126443112 | 3300009093 | Corn Rhizosphere | AADAAAGKYTGQPFPWRNPDGRVALVIEVDKARYTKLPFTHTPLR* |
| Ga0114129_104620392 | 3300009147 | Populus Rhizosphere | LKAADLVSRKYTGKPFPMRSPEGRVALIIEIDKARHLKIPFKHEPPK* |
| Ga0105243_119951661 | 3300009148 | Miscanthus Rhizosphere | QPFPWRNPDGRVALVIEVDKARYTKLPFTHTPLR* |
| Ga0111538_125949391 | 3300009156 | Populus Rhizosphere | HKYTGKPFPMRGREGRVALVIELDKVRYTKLPFAHTPPSS* |
| Ga0105102_102965082 | 3300009165 | Freshwater Sediment | PFRKPEGRVALVIEVERARFTKLPFEHTPPGGEFFG* |
| Ga0116124_11436092 | 3300009634 | Peatland | TGKPFPFRSPEGRVALVIEIEKARYTKLPFEHTPHQ* |
| Ga0126374_116998801 | 3300009792 | Tropical Forest Soil | YVGQPFPMRSPAGRVALVIGVDKVRYTKLPFAHTPPAQ* |
| Ga0126373_104755341 | 3300010048 | Tropical Forest Soil | KYVDAISRKYTGKAFPFRSPEGRIALVIEADKVRYTKLPFQHTPPK* |
| Ga0134065_101559762 | 3300010326 | Grasslands Soil | SHKYIGKPFPMRSPEGRVALVIEVDKARYTKLPFAHTPPRQ* |
| Ga0074045_1000532812 | 3300010341 | Bog Forest Soil | MDAISRKYIGKEFPLRNPAGRVALVIEVDKARYTKLPFQHTPPK* |
| Ga0136449_1021483471 | 3300010379 | Peatlands Soil | DFKIMDAVSYKYTGKPFPFRNPEGRVALIVEVEKVRYTKLPFEHSPPK* |
| Ga0134124_104794332 | 3300010397 | Terrestrial Soil | GKPFPFRSPEGRVALVIEVEKERYAKLPFEHTPPK* |
| Ga0138576_11706332 | 3300011088 | Peatlands Soil | GKPFPMRGPEGRVALIIEVEKARYTKLPFQHTPPK* |
| Ga0150983_106613131 | 3300011120 | Forest Soil | IGKPFPMRSYEGRVALIIEVEKERYTKLPFQHRPPR* |
| Ga0137391_106167833 | 3300011270 | Vadose Zone Soil | TGKAFPLRSYEGRVALVIEVDKARYTKLPFAHTPPRH* |
| Ga0137388_105467843 | 3300012189 | Vadose Zone Soil | GKPFPLRSPEGRVALVIEVDKARYTKLPFAHTPPRH* |
| Ga0137364_109947751 | 3300012198 | Vadose Zone Soil | TGKPFPMREPEDRIALVIEPDKVRYIKLPFEHTPAGK* |
| Ga0137399_113768631 | 3300012203 | Vadose Zone Soil | PFPMRSHEGRVALVIEVDKARYTKLPFAHTPARQ* |
| Ga0137381_114323121 | 3300012207 | Vadose Zone Soil | WIPISRKYVGKPFPFRSPEGRVALVIEVEKARFAKLPLEHTPTA* |
| Ga0137376_113690982 | 3300012208 | Vadose Zone Soil | YIGKAFPMRSYEGRVALIIEVEKERYTKLPFQHRPPRSV* |
| Ga0137377_100426425 | 3300012211 | Vadose Zone Soil | RSPEGRVALIIEIDKARHLKIPFKHEPPTQLGNP* |
| Ga0137377_117504021 | 3300012211 | Vadose Zone Soil | TGKPFPFRQPEGKVALVVEIEKARFTKLPFEHTPPK* |
| Ga0137366_110290862 | 3300012354 | Vadose Zone Soil | SHKYTGKPFPLRNPEGRVALIIEAEKARYTKLPFDHTPPGK* |
| Ga0137368_105832031 | 3300012358 | Vadose Zone Soil | TGKPFPFRNPEGRVTLVIEIDKARYTKLPFENTPGK* |
| Ga0137375_109178312 | 3300012360 | Vadose Zone Soil | YTGKPFPMRNPEGRVVLVIEVEKARYHKLPFTHTPGK* |
| Ga0150984_1138217591 | 3300012469 | Avena Fatua Rhizosphere | RKYIGKEFPMRNPAGRVALVIEVEKAKYTKLPFQHTPSAS* |
| Ga0137394_112804101 | 3300012922 | Vadose Zone Soil | PFPMRSHAGRVALVIEVDKARYTKLPFAHTPPPQ* |
| Ga0137419_100193441 | 3300012925 | Vadose Zone Soil | CKYIDPISLKYTGKPFPFRSPEGRVALVIEIEKARYTKLPFEHMPPK* |
| Ga0137416_107966271 | 3300012927 | Vadose Zone Soil | KPFPMRSHEGRVALVIEVDKARYTKLPFAHTPPRQ* |
| Ga0134077_100321541 | 3300012972 | Grasslands Soil | MMDPISHKYVGKSFPFRNPEGRVALVIEVEEKARYTKLPFEHTPAA* |
| Ga0157373_112732012 | 3300013100 | Corn Rhizosphere | EYMDPISQKYTGKPFPFRSPEERVVLVVEIEKAPYTRLPFQHTPAN* |
| Ga0181530_100721164 | 3300014159 | Bog | RKYIGTEFPFRNPAGRVALVIEVDKARYTKLPFQHTPPK* |
| Ga0137418_100033628 | 3300015241 | Vadose Zone Soil | LKSTDLVSRKYTGKPFSMRSPEGRVALIIEIDKARHLKIPFKHEPPK* |
| Ga0134072_101456151 | 3300015357 | Grasslands Soil | KYVGKSFPFRNPEGRVALVIEVEEKARYTKLPFEHTPAA* |
| Ga0134085_104625181 | 3300015359 | Grasslands Soil | PISRKYTGKPFPMRDPEGRVALLIDVEKARYAKLPFQHTPPK* |
| Ga0132257_1023957962 | 3300015373 | Arabidopsis Rhizosphere | EISHKYIGKESPFRNPEGRVAMVIEVEKARYTKLPFEHTPPS* |
| Ga0182041_103301163 | 3300016294 | Soil | KYTGKQFPMRNPAGRVALVIEVEKARYTKLPFQHTPPA |
| Ga0182037_112343102 | 3300016404 | Soil | DFHFMDRISHKYTGSPFPFRSPEGRVALVIEIEKAKYTKLPFQHTPPG |
| Ga0134112_101206091 | 3300017656 | Grasslands Soil | IGKPFPLRSPEGRVALVVEADKVRYTKLPFVHTPPRH |
| Ga0187779_111592752 | 3300017959 | Tropical Peatland | MDAVSDKYAGTPFLSPEGRVALIIEVEKGRHTQLPFEHTPPKIKRGAVQH |
| Ga0187783_100294074 | 3300017970 | Tropical Peatland | MPTPLCRSPEGRVALIIEVEKVRTAQLPSEPTPPQK |
| Ga0187816_103716262 | 3300017995 | Freshwater Sediment | GKPFPMRTYEDRVALIIEADKVRYLKLPFEHTPAA |
| Ga0184640_100848282 | 3300018074 | Groundwater Sediment | VREEPFRNPEGRVALVIEVEMARYAKLPFEHTPPPSA |
| Ga0187770_100210161 | 3300018090 | Tropical Peatland | YTGKPFPFRNPEGRVALLIEIEKVRYTRLPFEHTPPK |
| Ga0187770_103648802 | 3300018090 | Tropical Peatland | FSMRYTGKPFPFRHPDQIALVIEVEKERYEKLPFEHTPQ |
| Ga0066662_123757231 | 3300018468 | Grasslands Soil | TGKPFPFRNPEGRVTLVIEIDKARYAKLPFQHTPPA |
| Ga0190270_118478672 | 3300018469 | Soil | YTGKPFPMRSPEGRVALVIEVEKARYVKLPFEHTPPRSA |
| Ga0066669_105123351 | 3300018482 | Grasslands Soil | KYIAKPFPFRKPEGRIALIIEAEKARYTKLPFEHTPAA |
| Ga0181514_14004461 | 3300019268 | Peatland | KPFPMRQPEGRVALVIEVEKARYTKLPFEHTPPAK |
| Ga0210401_100010911 | 3300020583 | Soil | GKPFPMRTYEVRMALIIEADKVRYMKLPFEHTPAA |
| Ga0210378_101073841 | 3300021073 | Groundwater Sediment | MDPVSHKYIGKSFPMRSHEGRVALVIEVDKARYTKLPFAHTPPLQ |
| Ga0210393_109390492 | 3300021401 | Soil | ISHKYTGNPFPFRAPEGRVVLIIEVEKVRYTKLPFAHTPPK |
| Ga0210385_102454682 | 3300021402 | Soil | TGNPFPLRAPEGRVVLLIEVEKVRYTKLPFAHTPPK |
| Ga0210397_107179772 | 3300021403 | Soil | KYTGKPFPMREHLNQVALVIAVDKERYLKLPFQHTPKK |
| Ga0210383_100133777 | 3300021407 | Soil | HKYIGKPFPMRSPEGRVALIIEVEKARYTKLPFEHAPQ |
| Ga0210392_106940231 | 3300021475 | Soil | HKYTGKPFPMREHLNQVALVIAVDKERYLKLPFQHTPKK |
| Ga0210410_108554341 | 3300021479 | Soil | MDPISLKYTGKPFQFRSPEGRVVLVIELEKARYSK |
| Ga0210410_113446663 | 3300021479 | Soil | MDPISHKYTGKPFPMRSPEGHVALIIEVEKERHTKLPF |
| Ga0126371_102918064 | 3300021560 | Tropical Forest Soil | ISRKYTGKAFPFRSPEGRIALVIEADKVRYTKLPFQHTPPK |
| Ga0126371_105153583 | 3300021560 | Tropical Forest Soil | DEDFKTMDAISNKYTQQSLPFRNRAGRVVLVVEVDKARYTKLPFKHTPA |
| Ga0242663_11314501 | 3300022523 | Soil | GYAQKYTGKPFPFRNPGQIALVIEIENARYEKLPFQHAPGK |
| Ga0224452_12177731 | 3300022534 | Groundwater Sediment | YIGKPFPMRSDEGRVALVIEVDKARYLKLPFEHTPPRA |
| Ga0247679_10671432 | 3300024251 | Soil | MMDAISQKYTGKPFPFRSPEGRVALIIEVEKERYTKLPFAHSPGN |
| Ga0209431_109269623 | 3300025313 | Soil | KYTGKEFPWRNPEGRVILVIEVDRARYTKLPFSHTPA |
| Ga0208562_10743572 | 3300025460 | Peatland | TGKPFPFRKPEGRVALVVEFEKARYTKLPFQHTPPKV |
| Ga0208937_10035641 | 3300025506 | Peatland | KPFPFRKPEGRVALVVEFEKARYTKLPFQHTPPKV |
| Ga0208355_10799602 | 3300025581 | Arctic Peat Soil | EISQKYIGKEFPFRNPEGRVALIIEVEKARYTKLPFEHTPPA |
| Ga0207646_104455333 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TGKPFPFRSPEGRVALVIEVEKARFTKLPFEHTPPA |
| Ga0209839_100189383 | 3300026294 | Soil | GKPFPFRNPEGRVALIIEVEKVRYTKLPFEHTPLK |
| Ga0209236_11620971 | 3300026298 | Grasslands Soil | GKPFPFRSPEGRVALVIEVEKARYTKLPFEHTPPK |
| Ga0209153_11850532 | 3300026312 | Soil | ISRKYVGKPFPFRNPEARVALIIEVEKARYTKLPFEHTPAA |
| Ga0209152_103974902 | 3300026325 | Soil | PLSHKYIGKPFPMRSPEGRVALVIEVDRARYTKLPFAHTPPRQ |
| Ga0209158_13578151 | 3300026333 | Soil | SHKYTGKAFPMRSHEGRVALLIEIDKARYTKLPFAHTPPRH |
| Ga0257173_10172081 | 3300026360 | Soil | TGQPFPFRNPEGRVALVIEVEKARYAKLPFEHTPPRSA |
| Ga0209157_11461722 | 3300026537 | Soil | VSHKYIGKSFPMRNHEGRVALVIEVDKARYTKLPFAHTPPRH |
| Ga0209056_100502783 | 3300026538 | Soil | MATSKYIDPISLKYTGKPFPFRSPEGGVALVIEVEKARYTKLAFEHTPPK |
| Ga0209529_10776711 | 3300027334 | Forest Soil | YTGKPYPMRSPEGRVALIIEVEKARYTKLPFQHTPPK |
| Ga0209330_10018795 | 3300027619 | Forest Soil | LDAISYKYTGKPFPFRSTEGRVALVIEIEKVRYAKLPFEHAPPK |
| Ga0209656_101727761 | 3300027812 | Bog Forest Soil | GKEFPFRNPVGRVVLVIEVDKARYTKLPFQHTPPK |
| Ga0209039_103435651 | 3300027825 | Bog Forest Soil | HKYIGKDFPLRNPVGRVALVIEVDKARYTKLPFQHTPPK |
| Ga0209167_106648952 | 3300027867 | Surface Soil | TGKPFPMRQPEGRVALVIEVEKARYTKLPFEHTPPEK |
| Ga0209624_106575482 | 3300027895 | Forest Soil | KILDPISHKYVGKPFPMRGPEGRVALIVEVDKERYMKLPFQHTPPK |
| Ga0137415_103892353 | 3300028536 | Vadose Zone Soil | GKPFPYRNPQGRVALYIELEKARYEKLPFEYTPAA |
| Ga0302156_100476981 | 3300028748 | Bog | KYAGKPFPFRSPEGRVALVIEIEKARYTKLPFEHTPPQ |
| Ga0302224_103927171 | 3300028759 | Palsa | YTGKPFPMRSPEGRVALVVEVEKERYTKLPFDHTPPK |
| Ga0222749_101998232 | 3300029636 | Soil | SHKHIAKPFPMRSYEGRGALIIEVEKERYTKLPFQHTPP |
| Ga0311339_109139223 | 3300029999 | Palsa | KYIGKPFPMRGDAQVTLVVEPEKVRYLKLPFTHTPPS |
| Ga0299907_106128991 | 3300030006 | Soil | PFPLRDPAGRVALVIEVEKARYVKLPFEHAPPRSA |
| Ga0302270_105010941 | 3300030011 | Bog | PISHKYTGKPFPFRAPEGRVALIVEVEKERYTKLPFERPPSK |
| Ga0265462_103060652 | 3300030738 | Soil | SISHKYIGKPFPMRSPEGRVALIIEVEKARYTKLPFEHAPK |
| Ga0170824_1142013311 | 3300031231 | Forest Soil | LSHKYTGNPFPMRDHAGAIALIIEAEKVRYLKLPFPHTPPK |
| Ga0170818_1021595573 | 3300031474 | Forest Soil | GKEFPFRNPEGRVALIIEVEKARYTKLPFQHTPPA |
| Ga0310915_102497632 | 3300031573 | Soil | KYTGKPFPMRNPEGRVALVIEVEKVRYTKLPFQHTPPA |
| Ga0310686_1095771101 | 3300031708 | Soil | GYAKKYTGKPFPFRNPGQIALVIEIENARYERLPFQHAPAK |
| Ga0306918_111563261 | 3300031744 | Soil | YTGKPFPFRSPKGRVALVIEIEKQRYTKLAFEHTPPK |
| Ga0318498_102210982 | 3300031778 | Soil | AHPFPFRKPEGRVALVIEVETVRYTQLPFTHTPGAKT |
| Ga0318517_105753652 | 3300031835 | Soil | KYTAHPFPFRKPEGRVALVIEVETVRYTQLPFTHTPGAKT |
| Ga0306919_108459471 | 3300031879 | Soil | SHKYTGKPFPFRSPEGRVALIIEVEKARYTKLPFQHTPPI |
| Ga0306921_100619171 | 3300031912 | Soil | PISNKYTAHPFPFRKPEGRVALVIEVETVRYTQLPFTHTPGAKT |
| Ga0310916_110050821 | 3300031942 | Soil | YTGKPFPFRNPEGRVAVIIEVEKARYTKLPFQHTPPA |
| Ga0307479_108530662 | 3300031962 | Hardwood Forest Soil | TIMDPISHKYTGNPFPFRTPEGRVALNIEVEKVRYTKLPFQHTPPK |
| Ga0318505_105857362 | 3300032060 | Soil | IPHKYTGKPFPFRSPKGRVALVIEIEKQRYTKLAFEHTPPK |
| Ga0306924_104184733 | 3300032076 | Soil | TGKQFPMRNPAGRVALVIEVEKARYTKLPFQHTPPA |
| Ga0310895_103365211 | 3300032122 | Soil | YTGKPFPMRGGEGRVALVIEVDKARYTKLPFAHTLPG |
| Ga0307471_1015012621 | 3300032180 | Hardwood Forest Soil | FPMRSHEGRVALVIEVDKARYTKLPFAHTPPPPRH |
| Ga0307471_1037936131 | 3300032180 | Hardwood Forest Soil | GKPFPFRTPEGRVALIIDAEKVRYTKLPFQHTPPK |
| Ga0335069_124617831 | 3300032893 | Soil | GKPFPWRDPKGRIALVIEVESARYTKLPFKHTPPQLEPV |
| Ga0373916_0084462_1_108 | 3300034894 | Sediment Slurry | TGKEFPWRNPQGRVILVIEVDRARYTKLPFRHTPA |
| ⦗Top⦘ |