


| Basic Information | |
|---|---|
| Family ID | F055992 |
| Family Type | Metagenome |
| Number of Sequences | 138 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MARRLKDLKEVKIERPPRIKLSAKESLKRTQEFDKRKEQFIAAVRKGKS |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.42 % |
| % of genes near scaffold ends (potentially truncated) | 28.99 % |
| % of genes from short scaffolds (< 2000 bps) | 75.36 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.406 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (18.841 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.609 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.377 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.75% β-sheet: 0.00% Coil/Unstructured: 53.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF01916 | DS | 7.25 |
| PF00491 | Arginase | 5.07 |
| PF05201 | GlutR_N | 2.90 |
| PF05199 | GMC_oxred_C | 2.17 |
| PF01379 | Porphobil_deam | 1.45 |
| PF04030 | ALO | 1.45 |
| PF05016 | ParE_toxin | 1.45 |
| PF16277 | DUF4926 | 1.45 |
| PF02321 | OEP | 1.45 |
| PF00326 | Peptidase_S9 | 1.45 |
| PF07366 | SnoaL | 1.45 |
| PF00550 | PP-binding | 0.72 |
| PF13470 | PIN_3 | 0.72 |
| PF04255 | DUF433 | 0.72 |
| PF00149 | Metallophos | 0.72 |
| PF00829 | Ribosomal_L21p | 0.72 |
| PF12732 | YtxH | 0.72 |
| PF00578 | AhpC-TSA | 0.72 |
| PF00486 | Trans_reg_C | 0.72 |
| PF11528 | DUF3224 | 0.72 |
| PF07238 | PilZ | 0.72 |
| PF09335 | SNARE_assoc | 0.72 |
| PF13588 | HSDR_N_2 | 0.72 |
| PF00656 | Peptidase_C14 | 0.72 |
| PF00160 | Pro_isomerase | 0.72 |
| PF11941 | DUF3459 | 0.72 |
| PF12900 | Pyridox_ox_2 | 0.72 |
| PF10137 | TIR-like | 0.72 |
| PF02113 | Peptidase_S13 | 0.72 |
| PF00082 | Peptidase_S8 | 0.72 |
| PF02518 | HATPase_c | 0.72 |
| PF02687 | FtsX | 0.72 |
| PF12704 | MacB_PCD | 0.72 |
| PF00857 | Isochorismatase | 0.72 |
| PF00483 | NTP_transferase | 0.72 |
| PF14684 | Tricorn_C1 | 0.72 |
| PF00587 | tRNA-synt_2b | 0.72 |
| PF15902 | Sortilin-Vps10 | 0.72 |
| PF00278 | Orn_DAP_Arg_deC | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG1899 | Deoxyhypusine synthase | Translation, ribosomal structure and biogenesis [J] | 7.25 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 5.07 |
| COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 2.90 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 2.90 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 2.17 |
| COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 1.45 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.45 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.72 |
| COG0261 | Ribosomal protein L21 | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.72 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.72 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.72 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.72 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.72 |
| COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.72 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.41 % |
| Unclassified | root | N/A | 11.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002907|JGI25613J43889_10044004 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300002915|JGI25387J43893_1001238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2931 | Open in IMG/M |
| 3300003203|JGI25406J46586_10011754 | All Organisms → cellular organisms → Bacteria | 3823 | Open in IMG/M |
| 3300003203|JGI25406J46586_10043099 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300003203|JGI25406J46586_10230805 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300004778|Ga0062383_10059970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1526 | Open in IMG/M |
| 3300005167|Ga0066672_10351072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 963 | Open in IMG/M |
| 3300005167|Ga0066672_10969938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300005172|Ga0066683_10723401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300005176|Ga0066679_10454546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300005176|Ga0066679_10455172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 837 | Open in IMG/M |
| 3300005178|Ga0066688_10072775 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
| 3300005181|Ga0066678_10450809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300005294|Ga0065705_10201625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1426 | Open in IMG/M |
| 3300005441|Ga0070700_101985838 | Not Available | 504 | Open in IMG/M |
| 3300005445|Ga0070708_100370452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1350 | Open in IMG/M |
| 3300005450|Ga0066682_10072595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 2126 | Open in IMG/M |
| 3300005451|Ga0066681_10400424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300005540|Ga0066697_10064953 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
| 3300005540|Ga0066697_10291002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 962 | Open in IMG/M |
| 3300005540|Ga0066697_10810849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300005553|Ga0066695_10300453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
| 3300005556|Ga0066707_10307404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300005559|Ga0066700_10248903 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300005560|Ga0066670_10884773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300005561|Ga0066699_10361489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300005561|Ga0066699_10574442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300005598|Ga0066706_10502115 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300005764|Ga0066903_100743531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1740 | Open in IMG/M |
| 3300005764|Ga0066903_108450338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300005985|Ga0081539_10293443 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300006034|Ga0066656_10225214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
| 3300006173|Ga0070716_100580674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300006796|Ga0066665_11127422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300006796|Ga0066665_11458006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300006800|Ga0066660_10689512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300007258|Ga0099793_10361421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300009012|Ga0066710_100099399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3885 | Open in IMG/M |
| 3300009089|Ga0099828_11220981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300009094|Ga0111539_12959105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 549 | Open in IMG/M |
| 3300009137|Ga0066709_101000078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1224 | Open in IMG/M |
| 3300009177|Ga0105248_11843282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300010039|Ga0126309_11239990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300010043|Ga0126380_10513255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300010166|Ga0126306_11358259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300010303|Ga0134082_10336645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300010304|Ga0134088_10061743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1731 | Open in IMG/M |
| 3300010320|Ga0134109_10222300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300011120|Ga0150983_15036837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300011269|Ga0137392_10036719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3601 | Open in IMG/M |
| 3300011271|Ga0137393_10135071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2046 | Open in IMG/M |
| 3300011271|Ga0137393_11684038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 523 | Open in IMG/M |
| 3300011410|Ga0137440_1081695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 649 | Open in IMG/M |
| 3300011414|Ga0137442_1000036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 54435 | Open in IMG/M |
| 3300011433|Ga0137443_1255920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 520 | Open in IMG/M |
| 3300011438|Ga0137451_1184515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300012040|Ga0137461_1228686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 543 | Open in IMG/M |
| 3300012186|Ga0136620_10080133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1515 | Open in IMG/M |
| 3300012198|Ga0137364_10428821 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300012198|Ga0137364_10838851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 695 | Open in IMG/M |
| 3300012201|Ga0137365_10229786 | Not Available | 1383 | Open in IMG/M |
| 3300012206|Ga0137380_10579167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
| 3300012206|Ga0137380_10644071 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300012208|Ga0137376_10659211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 904 | Open in IMG/M |
| 3300012208|Ga0137376_11071470 | Not Available | 689 | Open in IMG/M |
| 3300012356|Ga0137371_11423592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300012363|Ga0137390_11698667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 566 | Open in IMG/M |
| 3300012679|Ga0136616_10222878 | Not Available | 868 | Open in IMG/M |
| 3300012681|Ga0136613_10465908 | Not Available | 686 | Open in IMG/M |
| 3300012684|Ga0136614_10006958 | All Organisms → cellular organisms → Bacteria | 7705 | Open in IMG/M |
| 3300012685|Ga0137397_10061970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2699 | Open in IMG/M |
| 3300012918|Ga0137396_11158639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300012918|Ga0137396_11190152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300012923|Ga0137359_10282644 | Not Available | 1479 | Open in IMG/M |
| 3300012930|Ga0137407_10924186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300012948|Ga0126375_11337537 | Not Available | 604 | Open in IMG/M |
| 3300012975|Ga0134110_10040878 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300014154|Ga0134075_10056770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1623 | Open in IMG/M |
| 3300014487|Ga0182000_10007775 | All Organisms → cellular organisms → Bacteria | 2511 | Open in IMG/M |
| 3300014487|Ga0182000_10109190 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300014745|Ga0157377_10936590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300015069|Ga0167633_102329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4049 | Open in IMG/M |
| 3300015085|Ga0167632_1002398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2822 | Open in IMG/M |
| 3300015252|Ga0180075_1007047 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300015253|Ga0180081_1053820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 695 | Open in IMG/M |
| 3300015371|Ga0132258_10429531 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3289 | Open in IMG/M |
| 3300017789|Ga0136617_10090128 | All Organisms → cellular organisms → Bacteria | 2665 | Open in IMG/M |
| 3300017789|Ga0136617_10102482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2477 | Open in IMG/M |
| 3300017789|Ga0136617_10313695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1287 | Open in IMG/M |
| 3300017789|Ga0136617_10694391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300017789|Ga0136617_10831181 | Not Available | 708 | Open in IMG/M |
| 3300018031|Ga0184634_10110616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300018061|Ga0184619_10026014 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300018429|Ga0190272_10061488 | All Organisms → cellular organisms → Bacteria | 2230 | Open in IMG/M |
| 3300018431|Ga0066655_11161359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300018433|Ga0066667_11359447 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300018468|Ga0066662_11664516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300018476|Ga0190274_12467677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300018482|Ga0066669_10574416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 985 | Open in IMG/M |
| 3300018918|Ga0193616_1042851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1306 | Open in IMG/M |
| 3300018920|Ga0190273_11408665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300018920|Ga0190273_12037952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300019767|Ga0190267_11045121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300020215|Ga0196963_10169523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300021374|Ga0213881_10430111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 596 | Open in IMG/M |
| 3300024246|Ga0247680_1028097 | Not Available | 814 | Open in IMG/M |
| 3300025885|Ga0207653_10000033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 103535 | Open in IMG/M |
| 3300025922|Ga0207646_10272610 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300025922|Ga0207646_11216355 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300025926|Ga0207659_11701033 | Not Available | 537 | Open in IMG/M |
| 3300025939|Ga0207665_10680920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300026295|Ga0209234_1170976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 758 | Open in IMG/M |
| 3300026300|Ga0209027_1003685 | All Organisms → cellular organisms → Bacteria | 5765 | Open in IMG/M |
| 3300026312|Ga0209153_1250748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300026315|Ga0209686_1176971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300026320|Ga0209131_1007093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → Bdellovibrionaceae → Bdellovibrio | 7116 | Open in IMG/M |
| 3300026551|Ga0209648_10033422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 4484 | Open in IMG/M |
| 3300026552|Ga0209577_10276037 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300027831|Ga0209797_10032395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2366 | Open in IMG/M |
| 3300027862|Ga0209701_10069968 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
| 3300027875|Ga0209283_10144087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1578 | Open in IMG/M |
| 3300027903|Ga0209488_10554069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300030510|Ga0268243_1034667 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300031754|Ga0307475_10918670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1149168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300032162|Ga0272424_1035305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 4590 | Open in IMG/M |
| 3300034004|Ga0334926_000171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 35122 | Open in IMG/M |
| 3300034026|Ga0334946_093981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300034144|Ga0334962_000008 | All Organisms → cellular organisms → Bacteria | 194683 | Open in IMG/M |
| 3300034172|Ga0334913_014435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1821 | Open in IMG/M |
| 3300034172|Ga0334913_014981 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300034391|Ga0334917_121386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.70% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 7.25% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.62% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 2.90% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.17% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.45% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.45% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.45% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 1.45% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.45% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.72% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.72% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000231 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4 | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011410 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015069 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake | Environmental | Open in IMG/M |
| 3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
| 3300015253 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300018918 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 0 min after wetting v1 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031877 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9 | Environmental | Open in IMG/M |
| 3300032162 | Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte nord | Environmental | Open in IMG/M |
| 3300034004 | Biocrust microbial communities from Mojave Desert, California, United States - 22HNC | Environmental | Open in IMG/M |
| 3300034026 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 42SMS | Environmental | Open in IMG/M |
| 3300034144 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 58SNS | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| 3300034391 | Biocrust microbial communities from Mojave Desert, California, United States - 13HMC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB_LI09_4DRAFT_100584533 | 3300000231 | Groundwater | MAKRLKDVRDLKISRPPRAKVSAKEALKRMEEFSKRKEDFVAAVRKGTN* |
| JGI25613J43889_100440043 | 3300002907 | Grasslands Soil | MARRLKELKELKIERPPRIKLSAKESLKRTKDFDKRKERFIAAVRKSQS* |
| JGI25387J43893_10012385 | 3300002915 | Grasslands Soil | MARRLKELKELKIERPPRLKLSAKESLKRTQEFEKRKEQFIATVRKGKN* |
| JGI25406J46586_100117542 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MARRLKDLKELKIERPPRLKLSAKESLKRTQEFEKRKEQFIATVRKGKN* |
| JGI25406J46586_100430993 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MAKRLKDLKELKIERPPRVKLTAKESLKRTQEFDKRKERLIAAIRKSEEQN* |
| JGI25406J46586_102308052 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MAKRLKDLKELKIERPPRVKLSAKESLKRTQEFDKRKEQF |
| Ga0062383_100599702 | 3300004778 | Wetland Sediment | MANRLEDVKELKTKRQPRVKLSANESLKRTLEFSKRKERFVAAVRKSKG* |
| Ga0066672_103510721 | 3300005167 | Soil | MAKNLRDLKEVKSERAPRVKLSAKESLKRTQEFDKRKEQFIAAVRKGKS* |
| Ga0066672_109699381 | 3300005167 | Soil | EMKIERPPRLKLSAKESLKRTKEFDKRKERFIAAIRKSKNRSLPA* |
| Ga0066683_107234011 | 3300005172 | Soil | MARRLNDLKELKIERPPRLKLSAKESLKRTKEFEKRKEQFIATVRKGKN* |
| Ga0066679_104545461 | 3300005176 | Soil | MARRLKDLSEMKIERPRRLKLSAKESLKRTKEFDKRKERFIAAI |
| Ga0066679_104551721 | 3300005176 | Soil | MARRLKNLRKLKIERSPRLKLSANESLKRTMEFDKRKEQFIATVRTGKNSETHFS* |
| Ga0066688_100727752 | 3300005178 | Soil | MARNLRDLKELKSERVPRVKLSAKESLKRTQEFDKRKEQFIAAVRKGKS* |
| Ga0066678_104508091 | 3300005181 | Soil | MSMARRLKELKEVKIERPPRVKLSAKESLKRTQEFAKRAEQFIAGIRTAKS* |
| Ga0065705_102016252 | 3300005294 | Switchgrass Rhizosphere | MARRLKDLKEVKTERPPRVKLSAKESLKRTEEFDKRKEQFIATVRKGKS* |
| Ga0070700_1019858382 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MARRLKDLRELKIERPPRLKLSAKESLKRTKDFDKRKEQFIATVRKGKN* |
| Ga0070708_1003704521 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKNLRDLKEAKIERPPRLKLSAKESLKRTQEFDKRKEQFIAAVRKGRS* |
| Ga0066682_100725951 | 3300005450 | Soil | MARRLKDLKEVKVELPPRVKLSEKESLKRTQEFDKRKEQFIGSV* |
| Ga0066681_104004242 | 3300005451 | Soil | MARRLKDLNEVKIERSPRIRLSAKESLKRTQEFDKRKEQFIATVRKGKS* |
| Ga0066697_100649531 | 3300005540 | Soil | MARRLKDLNEVKIERSPRIRLSAKESLKRTQEFGKRKDRFIAAVRKGKS* |
| Ga0066697_102910022 | 3300005540 | Soil | MARRLKDLSEMKIERPRRLKLSAKESLKRTKEFDKRKERFIAAIRK |
| Ga0066697_108108492 | 3300005540 | Soil | MARKLKDLKEVKIERPPRIKLSAKESLKRTSEFDKRKEQFIATVRRGKS* |
| Ga0066695_103004531 | 3300005553 | Soil | MARRLKDLKEVKIERPPRIKLSAKESLKRTSEFDKRKEQFIATVRRGKS* |
| Ga0066707_103074042 | 3300005556 | Soil | MAKRLKDLKEVKIERPPRIKLSAKESLKRTSEFDKRKEQFVATVRKGKS* |
| Ga0066700_102489034 | 3300005559 | Soil | MARRLNNLKELKIERPPRLKLSAKESLKRTKEFEKRKEQFIAAVRTGNN* |
| Ga0066670_108847731 | 3300005560 | Soil | MAKRLKDLKEVRIERPPRVKLSAEESLKRTQEFDKRKEKFVAAVRKGKG* |
| Ga0066699_103614893 | 3300005561 | Soil | MARKLKELKELKIERPPRLELSAKVSLKRTKDFDKRKEQFIATVRKGKN* |
| Ga0066699_105744423 | 3300005561 | Soil | RLKDLREMKIERPPRRKLSAKESLKRTEEFDKRKERFIAAIRKSKNRSLPA* |
| Ga0066706_105021152 | 3300005598 | Soil | EVKIERSLRIRLSAKESLKRTQEFGKRKDRFIAAVRKGKS* |
| Ga0066903_1007435312 | 3300005764 | Tropical Forest Soil | MARRLKDVKELKIERPLRLKLSAKESLKRTKEFDKRKEQFIATVRKGKN* |
| Ga0066903_1084503383 | 3300005764 | Tropical Forest Soil | KHIKSTVKRQPKRAKLSAKESLKPMGEFAKRKERIVAAVQKGKNRSVPA* |
| Ga0081539_102934432 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MAKRLKDLKELKIERPPRVKLSAKESLKRTQEFDKRKEQFIATVRKGKN* |
| Ga0066656_102252143 | 3300006034 | Soil | RLKELKELRIERPPRLKLSAKESLKRTKEFDKRKESIIAAVRKNKS* |
| Ga0070716_1005806741 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MARRLKELKALKIERPPRIKLSAKESLKRTRDFDKRKERFIAAVRKSK |
| Ga0066665_111274221 | 3300006796 | Soil | ARRLKDLNEVKIERSPRIRLSAKESLKRTQEFGKRKDRFIAAVRKGKS* |
| Ga0066665_114580062 | 3300006796 | Soil | MARGLKDLKEVKIESPPRIKLSAKESLKRTSEFDKRKEQFIATVRKGKS* |
| Ga0066660_106895122 | 3300006800 | Soil | MARRLKDLKELKIERPPRIKLSAKESLKRTKEFEKRKDSFIAAVRKSKS* |
| Ga0075424_1024077172 | 3300006904 | Populus Rhizosphere | EPTMAKKLKDVQEVKIQRPKRARLSEEETLKRMESFDERKEQFVASVRKGKS* |
| Ga0099793_103614212 | 3300007258 | Vadose Zone Soil | MARRLKELKELKIERPPRIKLSAKESLKRTKEFDQAK |
| Ga0066710_1000993995 | 3300009012 | Grasslands Soil | MARRLKELKELRIERPPRLKLSAKESLKRTKEFDKRKESIIAAVRKSKS |
| Ga0099828_112209811 | 3300009089 | Vadose Zone Soil | MARRLKDLKELKIERPPRIKLSAKESLKRTKEFDKRKESFIAAVRKSKS* |
| Ga0111539_129591051 | 3300009094 | Populus Rhizosphere | MARRLKDLKELKIERPPRIKLSAKESLKRTKAFDKRKESFIAAVRKS |
| Ga0066709_1010000781 | 3300009137 | Grasslands Soil | MARRLNDLKELKIERTPRLKLSAKESMKRTKEFDKLKERFMTTGRKGKN* |
| Ga0105248_118432821 | 3300009177 | Switchgrass Rhizosphere | ARRLKDLKELKIERPPRLKLSAKESLKRTKDFDKRKEQFIATVRKGKN* |
| Ga0126309_112399902 | 3300010039 | Serpentine Soil | MAKRLKDLKEVRIERPPRVKLSAEESLKRTQDFEKRREKFVAAVRKGKG* |
| Ga0126380_105132552 | 3300010043 | Tropical Forest Soil | MAGDLKDLKGVKRARPPRKKLSPKESLKRTQEFDKREEQFIAAVRKGKS* |
| Ga0126306_113582592 | 3300010166 | Serpentine Soil | MEVDMAKRLKDLKEVKIERPVRVKLSAKESLKRTQEFDKRREQFVAAVRKGKS* |
| Ga0134082_103366452 | 3300010303 | Grasslands Soil | MAKNLRDLKELKSERAPGVKLSAKESLKRTQEFDKRREQFIAAVRKGKS* |
| Ga0134088_100617432 | 3300010304 | Grasslands Soil | MARRLKDLKELKIERPRRIKLSAKESLKRTQDFDKRKEQFIAAVRKGKS* |
| Ga0134109_102223002 | 3300010320 | Grasslands Soil | MAKRLKDMKGVKIERRPRIKLSAKESLKRTQEFDKRKEQFIAAVRKGKS* |
| Ga0150983_150368373 | 3300011120 | Forest Soil | SSRCGDGSMAKRLKDIKEFRDIKIERPPRAKLSAQESLKRTQEFNKRKDRFVASIRKGKG |
| Ga0137392_100367191 | 3300011269 | Vadose Zone Soil | WRRQPIARGLKDLKEVKIERPPRFKLSARESLKRTSEFDKRTEQFIATVRKGKSFKIS* |
| Ga0137393_101350713 | 3300011271 | Vadose Zone Soil | MARRLKDLKEVKIDRPPRIKLSAKESLKRTSEFDKRKEQFIATVRKGKSFKIS* |
| Ga0137393_116840382 | 3300011271 | Vadose Zone Soil | MARRLEELKELKIERPPRIKLSAKESLKRTKEFDKRKERFIAAVRKSKS* |
| Ga0137440_10816952 | 3300011410 | Soil | MARRLKDLKELRIERPPRIKLSAKESLKRTKEFDKRKQRFIAAIRNGGEL* |
| Ga0137442_100003636 | 3300011414 | Soil | MARRLKDLKEVKIERPPRIKLSAKESLKRTQEFDKRKGQFIATVRKGKS* |
| Ga0137443_12559202 | 3300011433 | Soil | MARRLKDLKELRIERPPRIKLSAKESLKRTKEFDKRKERFIAAIRNGGEL* |
| Ga0137451_11845151 | 3300011438 | Soil | NEMKPERPPRVKVSPKESLERTQDFEKRKEQFVAAVRKSKN* |
| Ga0137461_12286862 | 3300012040 | Soil | MARRLKDLKQLKIERPPRIKLSAKESLKRTKEFDKRKESFIAAVRKSKSSGLFA* |
| Ga0136620_100801332 | 3300012186 | Polar Desert Sand | MARRLKDLKELKIERPPRLKLSAKESLKRTQEFEKRKEQFVAAIRKGKN* |
| Ga0137364_104288212 | 3300012198 | Vadose Zone Soil | MAKRLKDLKEVKTERLPRVKLSPKESLKRTQDFEKRKEQFIAAVRKG |
| Ga0137364_108388511 | 3300012198 | Vadose Zone Soil | MARRLKDLKELKIERPPRIKLSAKESLKRTKEFDK |
| Ga0137365_102297862 | 3300012201 | Vadose Zone Soil | MARRLKDLKEAKVERPARTKLTAKESLKRTAEFDKRKEQFIAAIRKGKS* |
| Ga0137380_105791671 | 3300012206 | Vadose Zone Soil | MARRLKDLKEVKIERPPRVKLSAKESLKRTAEFDKRKEQFIAAIRKGKS* |
| Ga0137380_106440713 | 3300012206 | Vadose Zone Soil | KDLKELKIERPPRIKLSAKESLKRTKEFDKRKESFIAAVRKSKS* |
| Ga0137376_106592112 | 3300012208 | Vadose Zone Soil | MARRLKDLKEVKIERPPRIKLSAKESLKRTQEFDKRKEQFIATIRKGK |
| Ga0137376_110714702 | 3300012208 | Vadose Zone Soil | MAKNLRDLKEVKSERAPRVKLSAKESLKRTQEFDTRKEQFIAAVRKGKS* |
| Ga0137371_114235921 | 3300012356 | Vadose Zone Soil | LSEMKIERPRRLKLSAKESLKRTKEFDKRKERFIAAIRKSKNRSLPA* |
| Ga0137390_116986671 | 3300012363 | Vadose Zone Soil | MARRLKDLKELKIERPPRIKLSAKESLKRTKEFDKRKERFIAAV |
| Ga0136616_100234552 | 3300012679 | Polar Desert Sand | MNRKLKVVKEVKIERPERAKLSAEESIKRTKEFANRKEKFIATARQGKN* |
| Ga0136616_102228782 | 3300012679 | Polar Desert Sand | MAKRLKDLKELKIERPPRLKLSAKESLKRTQEFDKRKEQFIATVRKGKS* |
| Ga0136613_104659081 | 3300012681 | Polar Desert Sand | MEVEMAKRLKDLKELKIERPPRVKLSAEESLKRTQEFDKRKEQFI |
| Ga0136614_100069586 | 3300012684 | Polar Desert Sand | MNNAIMEVEMAKRLQDLKELKIERPPRVKLSSEESLKRTQEFDQRKEKFIAAVRKSKG* |
| Ga0137397_100619702 | 3300012685 | Vadose Zone Soil | MARRLKELKELKIERPPRIKLSAKESLKRTKDFDKRKERFIAAVRKSRS* |
| Ga0137396_111586391 | 3300012918 | Vadose Zone Soil | MAKTLKDLKEVKTERPPRVKLSPKESLKRTQDFEKRKEQFIAAVRKGKS* |
| Ga0137396_111901521 | 3300012918 | Vadose Zone Soil | LKDLKELKIERPPRIKLSANESLKRTKEFDKRKESFIAAVRKSKS* |
| Ga0137359_102826442 | 3300012923 | Vadose Zone Soil | MARRLKDLKEVEIERPPRIKRSTKESLKRTQEFDKRKEQFIATIRKG* |
| Ga0137407_109241862 | 3300012930 | Vadose Zone Soil | MARNLRDLKEAKSERAPRVKLSAKESLKRTQEFDKRKEQFIAAVRKGKS* |
| Ga0126375_113375372 | 3300012948 | Tropical Forest Soil | MARKLKDLKELKIERPPRLKLSAKQSLKRTQDFDKRKEQFIATVRKGKN* |
| Ga0134110_100408783 | 3300012975 | Grasslands Soil | EMKIERPRRLKLSAKESLKRTKEFDKRKERFIVAIRKSKNRSLPA* |
| Ga0134075_100567703 | 3300014154 | Grasslands Soil | MARRLKELKELRIERPPRLKLSAKESLKRTTEFDKRKESIIAAVRKSKS* |
| Ga0182000_100077755 | 3300014487 | Soil | MKMARRLKDLKELKIERPPRLKLPAKESLKRTQEFEKRKEQFITTVRKGKD* |
| Ga0182000_101091901 | 3300014487 | Soil | MAKRLKDLKEVKIERPPRIKLSAEESLKRTQEFAKRKEKFIAAVRKGKG* |
| Ga0157377_109365901 | 3300014745 | Miscanthus Rhizosphere | LKIERPPRLKLSAKESLKRTIEFDKRKESFIAAVRKSKS* |
| Ga0167633_1023294 | 3300015069 | Glacier Forefield Soil | MGCSEVLMARRLKELKELRIERPPRIKLSAKESLKRTKDFDKRKESFIAAVRKSKS* |
| Ga0167632_10023981 | 3300015085 | Glacier Forefield Soil | MARNLRDLKEVKSERAPRAKLSAKESLKRTQEFDKRKEQFIAAVREGKS* |
| Ga0180075_10070472 | 3300015252 | Soil | MARRLKDLKELRIERPPRIKLSAKESLKRTKEFDKRKESFIAAVRKSKSSGLFA* |
| Ga0180081_10538202 | 3300015253 | Soil | MARRLKDLKELRIERPPRIKLSAKESLKRTKEFDKRKERFIAAIGNGGEL* |
| Ga0132258_104295314 | 3300015371 | Arabidopsis Rhizosphere | MARRLKDLKELKIERPPRLKLSAQESLKRTKEFDKRKESFIAAVRKRKS* |
| Ga0136617_100901283 | 3300017789 | Polar Desert Sand | MAKRLQDLKELKIERPPRVKLSSEESLKRTQEFDQRKEKFIAAVRKSKG |
| Ga0136617_101024823 | 3300017789 | Polar Desert Sand | MARRLNDLKELKIERPPRFKLSAKESLKRTKEFEKRKEQFIATVRKGKN |
| Ga0136617_103136953 | 3300017789 | Polar Desert Sand | MAKRLKDLKDVKTERPARIRLSARESLKRTQSFEKRKEQFVATVRKGKG |
| Ga0136617_106943912 | 3300017789 | Polar Desert Sand | MVKRLKDLKELRIERPPRVKLSAKESLKRTQDFDKRKERFIAAVRKSKG |
| Ga0136617_108311812 | 3300017789 | Polar Desert Sand | MARRLKDLKELKIERPPQLKLSAKESLKRTQEFEKRKEQFVAAV |
| Ga0184634_101106162 | 3300018031 | Groundwater Sediment | MAKRLIKEINIERPQRVKLSAKESLKRTKEFDKRKEKFIAAIREGKGGSVYP |
| Ga0184619_100260142 | 3300018061 | Groundwater Sediment | VARDLKDLKEVKAERAQRVKLSANESLKRTQEFDKRKEQFIAAVARLRYTIRP |
| Ga0190272_100614883 | 3300018429 | Soil | MARRLKDLKELKIERPPRLKLSAKESLKRTKEFDKRKEQFIATVRKGKN |
| Ga0066655_111613592 | 3300018431 | Grasslands Soil | MARRLKDLKEVKIERPPRVKLSAKESLKRTAEFDKRKEQFIAAIRKGKS |
| Ga0066667_113594473 | 3300018433 | Grasslands Soil | RRLNNLKELKIERPPRLKLSARESLKRTQEFDKRKDDFVSAIRNGNGRRLHL |
| Ga0066662_116645162 | 3300018468 | Grasslands Soil | MAKRLRDLKELKIERPPRVKLSAKESLKRTQEFDKRKERFIAAIRKSKS |
| Ga0190274_124676771 | 3300018476 | Soil | MARRLKDLKELKIERPPRIKLSAKESLKRTKEFDKRKESFIAAVRKSKS |
| Ga0066669_105744163 | 3300018482 | Grasslands Soil | MAKRLKDLKEVKTERLPRVKLSPKESLKRTQDFEKRKEQFIAAVR |
| Ga0193616_10428512 | 3300018918 | Soil | MAKRLKDLKELKIERPPRVKLSAKESLKRTQEFDKRKGRLIAAVRKSKG |
| Ga0190273_114086652 | 3300018920 | Soil | MNKRNLKIVKEVKIERPEPAKLSAEESIKRTKEFDKRKEKFIATVRQGKN |
| Ga0190273_120379522 | 3300018920 | Soil | MARRLKDLKELEIERPPRLKLSAKESLERTQEFEKRKEQFIATVRKGKN |
| Ga0190267_110451212 | 3300019767 | Soil | MAKRLKDLKEVRVERPPRVKLSAEESLKRTQEFGKRKEKFVAAVRKGKG |
| Ga0196963_101695231 | 3300020215 | Soil | MAKRLKDLKEVKIERPPRLKLSAKESLKRTQDFDKRKEQFIAAVRKGKG |
| Ga0213882_104968081 | 3300021362 | Exposed Rock | MKRNLKIVKEVKIERPERENLTPEESIKRTKEFNKRKEKFIAAVRKGKN |
| Ga0213881_104301112 | 3300021374 | Exposed Rock | MAKRLNDLKEVKIERPPRVKLSTEESLKRTQEFDKRKGQFIASVRKGKS |
| Ga0247680_10280973 | 3300024246 | Soil | MARRLKDLKELKIERPPRLKLTAKESLKRTKEFDRRKEQ |
| Ga0209341_1000855613 | 3300025325 | Soil | LKEIKEFKIERPERAKLSAKVSLKRMQELPKRKEKFIAAIREGKNRSLLTRST |
| Ga0207653_1000003356 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKNLRDLKEAKIERPPRLKLSAKESLKRTQEFDKRKEQFIAAVRKGRS |
| Ga0207646_102726101 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MARNLRDLKEVKIERLPRVKLSAKESLKRTQEFDKRREQFI |
| Ga0207646_112163552 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GSRQRMARNLRDLKEVKIERLPRVKLSAKESLKRTQEFDKRKEQFIATVRKGKS |
| Ga0207659_117010331 | 3300025926 | Miscanthus Rhizosphere | MARRLKDLKELKIERPPRLKLSAKESLKRTKEFDKRKESFIAAVRKS |
| Ga0207665_106809201 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MARRLKELKALKIERPPRIKLSAKESLKRTKEFDKRKERFIAAV |
| Ga0209234_11709762 | 3300026295 | Grasslands Soil | MAKRLKDLKEVRIERPPRVKLSAEESLKRTREFDKRKEKFVAAVRKGKG |
| Ga0209027_10036856 | 3300026300 | Grasslands Soil | MARRLKELKELKIERPPRLKLSAKESLKRTQEFEKRKEQFIATVRKGKN |
| Ga0209153_12507481 | 3300026312 | Soil | MARRLKDLSEMKIERPRRLKLSAKESLKRTKEFDKRKERF |
| Ga0209686_11769711 | 3300026315 | Soil | MARRLKDLREMKIERPPRRKLSAKESLKRTEEFDKRKERFIAAIRQSKNR |
| Ga0209131_10070935 | 3300026320 | Grasslands Soil | MARRLKELKELKIERPPRIKLSAKESLKRTKDFDKRKERFIAAVRKSQS |
| Ga0209648_100334224 | 3300026551 | Grasslands Soil | MARRLKDLKEVKIDRPPRIKLSAKESLKRTSEFDKRKEQFIATVRKGKS |
| Ga0209577_102760371 | 3300026552 | Soil | MARNLRDLKEVKSERASRVKLSAKESLKRTQEFDKRKEQFIAAVRKGKS |
| Ga0209689_12527922 | 3300027748 | Soil | ASKRASYEVIDMTKNSEDLKEVKIERPSRVKLSAKESLKRTQEFDKRKEQFIAAVRKGKS |
| Ga0209797_100323952 | 3300027831 | Wetland Sediment | MANRLEDVKELKTKRQPRVKLSANESLKRTLEFSKRKERFVAAVRKSKG |
| Ga0209701_100699682 | 3300027862 | Vadose Zone Soil | MARRLKDLKEVKIERPPRIKLSAKESLKRTSEFDKRKEQFIATVRKGKS |
| Ga0209283_101440871 | 3300027875 | Vadose Zone Soil | KIERGLESRVSAKESLKRTSEFDTRKEQFIATVRKGKSFKIS |
| Ga0209488_105540692 | 3300027903 | Vadose Zone Soil | MARRLKDLKEVKIERPPRIKLSAKESLKRTQEFDKRKEQFIAAVRKGKS |
| Ga0268243_10346673 | 3300030510 | Soil | MKMARRLKDLKELKIERPPRLKLPAKESLKRTQEFEKRKEQFITTVRKGKD |
| Ga0307475_109186702 | 3300031754 | Hardwood Forest Soil | MARRLKDLKEVKIERPPRVKLSAKESLKRTQEFDKRKEQFVAAVRKGKG |
| (restricted) Ga0315314_11491681 | 3300031877 | Sediment | MAKRLKDVRELKISRPPRARVSAKEALKRMAEFSKRKEDFVAAVRKGTN |
| Ga0272424_10353051 | 3300032162 | Rock | MARRLKDLKELKMERPPRLKLSAKESLKRTQEFEKRKEQFI |
| Ga0334926_000171_7487_7636 | 3300034004 | Hypolithic Biocrust | MAKRLKDLKEVKIERPPKVKLSAKESLKRTQEFDKREEQFIAAVRKGKN |
| Ga0334946_093981_35_184 | 3300034026 | Sub-Biocrust Soil | MAKRVKDLKEIRVERPARAKLSAEESLKRTQEFDKRKEKLIAAVRKGKG |
| Ga0334962_000008_117936_118085 | 3300034144 | Sub-Biocrust Soil | MAKRLKDLKEVKIERPLRVKLSAKESLKRTQEFDKRKEQFIASVRKGKG |
| Ga0334913_014435_1405_1554 | 3300034172 | Sub-Biocrust Soil | MAKRLRDLKELKIERPPRVKLSAKESLKRTQEFDKRKERFIAAVGKSKG |
| Ga0334913_014981_1562_1711 | 3300034172 | Sub-Biocrust Soil | MARRLKDLKELKIERPPRLKLSAKESLKRTQDFEKRKEQFIATVRKGKN |
| Ga0334917_121386_78_227 | 3300034391 | Hypolithic Biocrust | MARRLKDLKELKIERPPRLKLSAKESLKRTQEFEKRKEQFVAAVRKGKN |
| ⦗Top⦘ |