


| Basic Information | |
|---|---|
| Family ID | F055846 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VYVPRGTVHRNQNLSNRPARSIELNITDKDKPQTEQVP |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.80 % |
| % of genes near scaffold ends (potentially truncated) | 92.75 % |
| % of genes from short scaffolds (< 2000 bps) | 91.30 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.507 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.464 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.623 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF00753 | Lactamase_B | 10.14 |
| PF07883 | Cupin_2 | 9.42 |
| PF03807 | F420_oxidored | 6.52 |
| PF13577 | SnoaL_4 | 2.90 |
| PF00561 | Abhydrolase_1 | 2.90 |
| PF01774 | UreD | 2.17 |
| PF00903 | Glyoxalase | 2.17 |
| PF01494 | FAD_binding_3 | 2.17 |
| PF03401 | TctC | 1.45 |
| PF01402 | RHH_1 | 1.45 |
| PF00296 | Bac_luciferase | 1.45 |
| PF07681 | DoxX | 0.72 |
| PF07237 | DUF1428 | 0.72 |
| PF13305 | TetR_C_33 | 0.72 |
| PF08388 | GIIM | 0.72 |
| PF06271 | RDD | 0.72 |
| PF04140 | ICMT | 0.72 |
| PF03079 | ARD | 0.72 |
| PF13384 | HTH_23 | 0.72 |
| PF04909 | Amidohydro_2 | 0.72 |
| PF07676 | PD40 | 0.72 |
| PF12681 | Glyoxalase_2 | 0.72 |
| PF13424 | TPR_12 | 0.72 |
| PF07769 | PsiF_repeat | 0.72 |
| PF03972 | MmgE_PrpD | 0.72 |
| PF01025 | GrpE | 0.72 |
| PF13505 | OMP_b-brl | 0.72 |
| PF07690 | MFS_1 | 0.72 |
| PF02781 | G6PD_C | 0.72 |
| PF00083 | Sugar_tr | 0.72 |
| PF00800 | PDT | 0.72 |
| PF03466 | LysR_substrate | 0.72 |
| PF01906 | YbjQ_1 | 0.72 |
| PF00072 | Response_reg | 0.72 |
| PF01436 | NHL | 0.72 |
| PF01384 | PHO4 | 0.72 |
| PF14492 | EFG_III | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 4.35 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 2.17 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 2.17 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 2.17 |
| COG0829 | Urease accessory protein UreH | Posttranslational modification, protein turnover, chaperones [O] | 2.17 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.45 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.45 |
| COG0077 | Prephenate dehydratase | Amino acid transport and metabolism [E] | 0.72 |
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.72 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.72 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.72 |
| COG0576 | Molecular chaperone GrpE (heat shock protein HSP-70) | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.72 |
| COG1791 | Acireductone dioxygenase (methionine salvage), cupin superfamily | Amino acid transport and metabolism [E] | 0.72 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.72 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.72 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.72 |
| COG5507 | Uncharacterized conserved protein YbaA, DUF1428 family | Function unknown [S] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.51 % |
| Unclassified | root | N/A | 14.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10638738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 506 | Open in IMG/M |
| 3300001851|RCM31_10111068 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005332|Ga0066388_100874286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1481 | Open in IMG/M |
| 3300005332|Ga0066388_105089843 | Not Available | 668 | Open in IMG/M |
| 3300005332|Ga0066388_105903031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300005533|Ga0070734_10516193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300005559|Ga0066700_10256883 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300005561|Ga0066699_10659472 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005615|Ga0070702_101246698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300005764|Ga0066903_101508251 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300005764|Ga0066903_109162020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300005921|Ga0070766_10407241 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300006028|Ga0070717_10432622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1184 | Open in IMG/M |
| 3300006032|Ga0066696_10316632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1015 | Open in IMG/M |
| 3300006046|Ga0066652_101189198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300006046|Ga0066652_101381278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprobacter → Lamprobacter modestohalophilus | 660 | Open in IMG/M |
| 3300006195|Ga0075366_10784986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300006804|Ga0079221_10210163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300006854|Ga0075425_102910425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300006865|Ga0073934_10616202 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300006871|Ga0075434_100212435 | Not Available | 1955 | Open in IMG/M |
| 3300007788|Ga0099795_10018501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2240 | Open in IMG/M |
| 3300009038|Ga0099829_10989775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300009100|Ga0075418_10523648 | Not Available | 1274 | Open in IMG/M |
| 3300009137|Ga0066709_102574334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300009143|Ga0099792_10002219 | All Organisms → cellular organisms → Bacteria | 7385 | Open in IMG/M |
| 3300009156|Ga0111538_12644205 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300009525|Ga0116220_10086808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1320 | Open in IMG/M |
| 3300009525|Ga0116220_10381821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300009633|Ga0116129_1055489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1214 | Open in IMG/M |
| 3300009683|Ga0116224_10069380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1717 | Open in IMG/M |
| 3300009792|Ga0126374_11392735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300010036|Ga0126305_10954862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300010047|Ga0126382_11330634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 651 | Open in IMG/M |
| 3300010304|Ga0134088_10057259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1797 | Open in IMG/M |
| 3300010325|Ga0134064_10309288 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300010358|Ga0126370_10555032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300010360|Ga0126372_10239004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1548 | Open in IMG/M |
| 3300010360|Ga0126372_11362209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprobacter → Lamprobacter modestohalophilus | 741 | Open in IMG/M |
| 3300010362|Ga0126377_10095403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2702 | Open in IMG/M |
| 3300010366|Ga0126379_10953941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300010398|Ga0126383_12842267 | Not Available | 565 | Open in IMG/M |
| 3300010400|Ga0134122_10219917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1586 | Open in IMG/M |
| 3300010400|Ga0134122_12683464 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300010401|Ga0134121_10937699 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300011120|Ga0150983_11609418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300011120|Ga0150983_12024819 | Not Available | 586 | Open in IMG/M |
| 3300011403|Ga0137313_1087789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300011420|Ga0137314_1006938 | All Organisms → cellular organisms → Bacteria | 3133 | Open in IMG/M |
| 3300011423|Ga0137436_1010862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 2240 | Open in IMG/M |
| 3300011435|Ga0137426_1057137 | Not Available | 1035 | Open in IMG/M |
| 3300012189|Ga0137388_10161391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1994 | Open in IMG/M |
| 3300012199|Ga0137383_11027089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300012201|Ga0137365_10159541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1692 | Open in IMG/M |
| 3300012207|Ga0137381_10600247 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300012208|Ga0137376_10384697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1218 | Open in IMG/M |
| 3300012350|Ga0137372_10497043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300012354|Ga0137366_10741285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300012362|Ga0137361_10235337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1666 | Open in IMG/M |
| 3300012582|Ga0137358_10606623 | Not Available | 734 | Open in IMG/M |
| 3300012917|Ga0137395_10534824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
| 3300012918|Ga0137396_10993257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300012925|Ga0137419_11978843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300012929|Ga0137404_12051537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300012930|Ga0137407_11732364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300012971|Ga0126369_11136441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprobacter → Lamprobacter modestohalophilus | 870 | Open in IMG/M |
| 3300014489|Ga0182018_10346971 | Not Available | 800 | Open in IMG/M |
| 3300014495|Ga0182015_10669163 | Not Available | 656 | Open in IMG/M |
| 3300014501|Ga0182024_11125624 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300014658|Ga0181519_11049580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300015054|Ga0137420_1439299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2389 | Open in IMG/M |
| 3300015264|Ga0137403_10518703 | Not Available | 1062 | Open in IMG/M |
| 3300015358|Ga0134089_10268554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300015358|Ga0134089_10409088 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300015373|Ga0132257_104412803 | Not Available | 512 | Open in IMG/M |
| 3300016294|Ga0182041_10421533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
| 3300016294|Ga0182041_11425225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 636 | Open in IMG/M |
| 3300016371|Ga0182034_11072370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300018028|Ga0184608_10215608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 842 | Open in IMG/M |
| 3300018062|Ga0187784_10689824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 817 | Open in IMG/M |
| 3300018062|Ga0187784_11454339 | Not Available | 543 | Open in IMG/M |
| 3300018468|Ga0066662_10886419 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300019238|Ga0180112_1322085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300019244|Ga0180111_1297570 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300021180|Ga0210396_11667568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300021407|Ga0210383_10507463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1041 | Open in IMG/M |
| 3300021432|Ga0210384_11884320 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300021476|Ga0187846_10185926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300021858|Ga0213852_1151573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
| 3300023046|Ga0233356_1044774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300024251|Ga0247679_1067562 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300026088|Ga0207641_12049478 | Not Available | 573 | Open in IMG/M |
| 3300026329|Ga0209375_1015669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4507 | Open in IMG/M |
| 3300026342|Ga0209057_1159480 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300026377|Ga0257171_1090969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300026481|Ga0257155_1062799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 590 | Open in IMG/M |
| 3300026536|Ga0209058_1348136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300026555|Ga0179593_1060427 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR39 | 2363 | Open in IMG/M |
| 3300027513|Ga0208685_1076518 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300027616|Ga0209106_1073744 | Not Available | 765 | Open in IMG/M |
| 3300027676|Ga0209333_1060218 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300027826|Ga0209060_10392564 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300027826|Ga0209060_10412872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300027882|Ga0209590_10454314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 828 | Open in IMG/M |
| 3300027882|Ga0209590_10685101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Paraglaciecola → Paraglaciecola psychrophila → Paraglaciecola psychrophila 170 | 656 | Open in IMG/M |
| 3300027882|Ga0209590_10732513 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300028556|Ga0265337_1002915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7600 | Open in IMG/M |
| 3300028748|Ga0302156_10238765 | Not Available | 837 | Open in IMG/M |
| 3300028879|Ga0302229_10279232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 753 | Open in IMG/M |
| 3300029882|Ga0311368_11077096 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300029943|Ga0311340_10462441 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300029944|Ga0311352_10401963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 1121 | Open in IMG/M |
| 3300030007|Ga0311338_10792199 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300030056|Ga0302181_10155981 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300030490|Ga0302184_10060024 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300030509|Ga0302183_10187674 | Not Available | 808 | Open in IMG/M |
| 3300030520|Ga0311372_11013027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 1094 | Open in IMG/M |
| 3300030580|Ga0311355_11632246 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031233|Ga0302307_10037302 | All Organisms → cellular organisms → Bacteria | 2638 | Open in IMG/M |
| 3300031234|Ga0302325_11854456 | Not Available | 752 | Open in IMG/M |
| 3300031236|Ga0302324_101549697 | Not Available | 857 | Open in IMG/M |
| 3300031564|Ga0318573_10794762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300031679|Ga0318561_10806542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300031740|Ga0307468_100051470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2154 | Open in IMG/M |
| 3300031846|Ga0318512_10296715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 803 | Open in IMG/M |
| 3300031890|Ga0306925_11027954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300031912|Ga0306921_11423144 | Not Available | 761 | Open in IMG/M |
| 3300031954|Ga0306926_11035008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300031954|Ga0306926_13023957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300032001|Ga0306922_12165519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300032051|Ga0318532_10265278 | Not Available | 610 | Open in IMG/M |
| 3300032066|Ga0318514_10230673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 973 | Open in IMG/M |
| 3300032076|Ga0306924_10070354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3903 | Open in IMG/M |
| 3300032076|Ga0306924_10314238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1797 | Open in IMG/M |
| 3300032261|Ga0306920_101089042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1159 | Open in IMG/M |
| 3300032261|Ga0306920_101099701 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300032829|Ga0335070_11898150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 537 | Open in IMG/M |
| 3300033289|Ga0310914_11801628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.42% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.80% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.17% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.17% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.17% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.45% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.45% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.45% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.72% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.72% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.72% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.72% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.72% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019244 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023046 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_106387382 | 3300001661 | Forest Soil | LMKAGDYVYVPRGTIHRNQNVSKSPARSIELNITDKDKPQTEQVP* |
| RCM31_101110682 | 3300001851 | Marine Plankton | KPGDFVYVPRGTIHRNQNMTNRPARSIELNITDKDKPQTEQVPN* |
| Ga0066388_1008742863 | 3300005332 | Tropical Forest Soil | KVGDSAYIPRGTVHRNQNLTDKPARTIELNIMDKDKPLLEPVAD* |
| Ga0066388_1050898431 | 3300005332 | Tropical Forest Soil | LKVGDWVYVPRGTIHRNQNLSNAPARAVEMNITDKDAPQTEQVP* |
| Ga0066388_1059030311 | 3300005332 | Tropical Forest Soil | VLKVGDWVYVPRGTIHRNQNLTNAPARAVEMNITDKDVPQTEVVPE* |
| Ga0070734_105161931 | 3300005533 | Surface Soil | DSAYIPRGTVHRNQNLTDKPARTIELNVMDKDKPLIEQVPVTQ* |
| Ga0066700_102568833 | 3300005559 | Soil | MKAGDYVYVPRGTIHRNQNLSKSPARSIELNITDKDKPQTEQV |
| Ga0066699_106594721 | 3300005561 | Soil | PRGTIHRNQNLSKAPARSIELNITDKDKPQTEQVP* |
| Ga0070702_1012466982 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | FVYVPRGTVHRNQNLTNRPARSFELNITDKDKPQTEQVTN* |
| Ga0066903_1015082511 | 3300005764 | Tropical Forest Soil | YVPRGTIHRNQNLSDKPARSIELNITDKDKPQTEQVTE* |
| Ga0066903_1091620201 | 3300005764 | Tropical Forest Soil | SAYIPRGTVHRNENKTDKAARTIELNVLDKDQPALQPVAETQ* |
| Ga0070766_104072411 | 3300005921 | Soil | GESVYVPRGTVHRNQNLSNKPVRSIELNITDKDKPQTEAVTN* |
| Ga0070717_104326222 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LKAGDYVYVPRGTIHRNQNLSNRPARAIELNITDKDKPQTEQAPE* |
| Ga0066696_103166321 | 3300006032 | Soil | PRGTVHRNQNLSDKPARSIELNIMDKDKPGLELVAD* |
| Ga0066652_1011891982 | 3300006046 | Soil | YVPRGTVHRNQNVSNRPARSIELNITDKDKPQTEQVP* |
| Ga0066652_1013812782 | 3300006046 | Soil | YVPRGTIHRNQNLTNAPARAVEMNITDKDVPQTEVVPE* |
| Ga0075366_107849862 | 3300006195 | Populus Endosphere | LKVGDWVYVPRGTIHRNQNLTNAPARAVEMNITDKDVPQTEVVPE* |
| Ga0079221_102101631 | 3300006804 | Agricultural Soil | LKVGDSAYIPRGTVHRNQNMTDKPARSIELNIWDKDKPGLELVTE* |
| Ga0075425_1029104253 | 3300006854 | Populus Rhizosphere | YIPRGTVHRNQNMTDKPARSIELNIWDKDKPGLELVTE* |
| Ga0073934_106162021 | 3300006865 | Hot Spring Sediment | RTMRPGDWVYVPRGTIHRNQNLSTQPARSIELNITDKDAPQTEVVPN* |
| Ga0075434_1002124351 | 3300006871 | Populus Rhizosphere | PRGTIHRNQNVSGRPARSIELNITDNDQPQTEQVP* |
| Ga0099795_100185015 | 3300007788 | Vadose Zone Soil | VHIPRGTVHRNENLTDKPARSIELNIMDKDKPGLGLVND* |
| Ga0099829_109897751 | 3300009038 | Vadose Zone Soil | VGDSAYIPRGTVHRNQNMTDKPARSIELNIIDKDKPALELVAE* |
| Ga0075418_105236481 | 3300009100 | Populus Rhizosphere | PRKMRPGDWVYVPRGTVHRNQNLSGAMARSIELNITDKDAPQTEVVK* |
| Ga0066709_1025743342 | 3300009137 | Grasslands Soil | FTVRGQQPRLMKAGNFVYVPRGTIHRNQNLSKLPARSIELNITDKDKPQTEQVP* |
| Ga0099792_100022196 | 3300009143 | Vadose Zone Soil | LCRPLVRVHIPRGTVHRNENLTDKPARSIELNIMDKDKPGLGLVND* |
| Ga0111538_126442052 | 3300009156 | Populus Rhizosphere | YVPRGTVHRNQNLSGAMARSIELNITDKDAPQTEVVK* |
| Ga0116220_100868081 | 3300009525 | Peatlands Soil | AYIPRGTIHRNQNLTDKPARTIELNILDKDKPALEPVAETQ* |
| Ga0116220_103818212 | 3300009525 | Peatlands Soil | SVYIPRGTIHRNQNLSDKPSRRIELNIIDKDKPALEPVNN* |
| Ga0116129_10554893 | 3300009633 | Peatland | PRGTIHRNQNMTDKPARTIELVILDKDKPALEQVDE* |
| Ga0116224_100693801 | 3300009683 | Peatlands Soil | IHRNQNLTDKPARTIELNILDKDKPALEPVAETQ* |
| Ga0126374_113927352 | 3300009792 | Tropical Forest Soil | DFVYVPRGTIHRNQNLSDKPARSIELNITDKDKPQTEQVTE* |
| Ga0126305_109548621 | 3300010036 | Serpentine Soil | PRVLKVGDWVYVPRGTIHRNQNLTNMPARAVEMNLTDKGVPQTEVVKD* |
| Ga0126382_113306341 | 3300010047 | Tropical Forest Soil | TVKGQAPRVLKVGDWVYVPRGTIHRNQNLTNAPARAVEMNITDKDVPQTEVVPE* |
| Ga0134088_100572591 | 3300010304 | Grasslands Soil | AGDFVYVPRGTVHRNQNLSKLPARSIELNITDKDKPQTEQVP* |
| Ga0134064_103092881 | 3300010325 | Grasslands Soil | VKGQQPRVMKPGEFVYVPRGTIHRNQNLSKLPARSIELNITDKDKPQTEQVP* |
| Ga0126370_105550323 | 3300010358 | Tropical Forest Soil | IPRGTVHRNQNLTDKPARTIELNIMDKDKPLLEPVPVTQ* |
| Ga0126372_102390041 | 3300010360 | Tropical Forest Soil | TLKVGDSAYIPRGTVHRNQNLTDKPARSIELNIMDKDKPALEPVTE* |
| Ga0126372_113622092 | 3300010360 | Tropical Forest Soil | PPRVLKVGDWVYVPRGTIHRNQNLTNAPARAVEMNITDKDVPQTEVVPE* |
| Ga0126377_100954034 | 3300010362 | Tropical Forest Soil | VPRGTIHRNQNLTNAPARAVEMNITDKDVPQTEVVPE* |
| Ga0126379_109539411 | 3300010366 | Tropical Forest Soil | GTIHRNQNLSDKPARSIELNITDKDKPQTEQVTE* |
| Ga0126383_128422671 | 3300010398 | Tropical Forest Soil | IPRGTVHRNQNLTDKPARSIELNIMDKDKPGLELVSE* |
| Ga0134122_102199174 | 3300010400 | Terrestrial Soil | PRGTIHRNQNMTNRPVRSIELNITDKDAPQTEVVK* |
| Ga0134122_126834642 | 3300010400 | Terrestrial Soil | HIPRGTIHRNHNMTDKPARSVELNIMDKGKPVLEVVKD* |
| Ga0134121_109376993 | 3300010401 | Terrestrial Soil | KPGDFVYVPRGTIHRNQNMTNRPVRSIELTITDKDAPQTEVVK* |
| Ga0150983_116094182 | 3300011120 | Forest Soil | PRGTVHRNQNLSDKPARSIELNITDKDKPQTEPVTN* |
| Ga0150983_120248192 | 3300011120 | Forest Soil | RGTVHRNQNLTDKPARAINLNIMDKDKPQTEQVTN* |
| Ga0137313_10877891 | 3300011403 | Soil | WVYVPRGTIHRNQNLSGQSARSIELNITDKDAPQTEVVPN* |
| Ga0137314_10069381 | 3300011420 | Soil | PRGTIHRNQNLSGQSARSIELNITDKDAPQTEVVPN* |
| Ga0137436_10108621 | 3300011423 | Soil | PRKLKVGDSVHILRGTIHRNQNMTDKPSRSVELVIVDKDKPQTEQVAD* |
| Ga0137426_10571372 | 3300011435 | Soil | YVPRGTVHRNQNLSGSMARSIELNITDKDAPQTEVVK* |
| Ga0137388_101613911 | 3300012189 | Vadose Zone Soil | PRGTIHRNQNVSANSARAIELNITDKDKPQTEQVAE* |
| Ga0137383_110270891 | 3300012199 | Vadose Zone Soil | RTLKPGDFVYVPRGTIHRNQNVSANSARAIELNITDKDKPQTEQVAE* |
| Ga0137365_101595412 | 3300012201 | Vadose Zone Soil | GDYVYVPRGTVHRNQNLSNRPARSIELNITDKDKPQTEQVP* |
| Ga0137381_106002471 | 3300012207 | Vadose Zone Soil | APRVLKPGEYVYVPRGTIHRNQNMTNRPVRSIELNITDKGKPQTEPVPD* |
| Ga0137376_103846971 | 3300012208 | Vadose Zone Soil | RGTIHRNQNVSANSARAIELNITDKDKPQTEQVAE* |
| Ga0137372_104970431 | 3300012350 | Vadose Zone Soil | PPRHMKTGDFVYVPRGTIHRNQNLSKSPARSIELNITDKDKPPTEQVP* |
| Ga0137366_107412851 | 3300012354 | Vadose Zone Soil | DSVHIPRGTVHRNQNLTDKPARSIELNIMDKDKPVLELVKE* |
| Ga0137361_102353372 | 3300012362 | Vadose Zone Soil | WVYVPRGTIHRNQNLTNAPARAVEMNITDKGVPQTEAVPE* |
| Ga0137358_106066232 | 3300012582 | Vadose Zone Soil | LCRPLDSVHIPRGTVHRNQNLTDKPARSNELNIWDKDKPGLELVND* |
| Ga0137395_105348241 | 3300012917 | Vadose Zone Soil | DFVYVPRGTVHRNQNLSKSPARSIELNITDKDKPQTEQVP* |
| Ga0137396_109932571 | 3300012918 | Vadose Zone Soil | VGDSVHIPRGTVHRNQNLTDKPARSIELNIMDKDKPALELVKE* |
| Ga0137419_119788431 | 3300012925 | Vadose Zone Soil | VPRGTIHRNQNVSANSARAIELNITDKDKPQTEQVAD* |
| Ga0137404_120515371 | 3300012929 | Vadose Zone Soil | APRVLKVGDWVYVPRGTIHRNQNLTNAPASAVEMNITDKGVPQTEAVPE* |
| Ga0137407_117323642 | 3300012930 | Vadose Zone Soil | RVLKVGDWVYVPRGTIHRNQNLTSEPARAVEMNITDKDVPQTEVVPE* |
| Ga0126369_111364412 | 3300012971 | Tropical Forest Soil | WVYVPRGTIHRNQNLTNAPARAVEMNITDKDVPQTEVVPE* |
| Ga0182018_103469712 | 3300014489 | Palsa | PRGTVHRNQNLSGQPVRTVELMIVDKDKPHTEPVN* |
| Ga0182015_106691632 | 3300014495 | Palsa | VIVVVYIPRGTIHRNQNLSGQLVRTVELMIVDKDKPHTEPVN* |
| Ga0182024_111256242 | 3300014501 | Permafrost | VIVVVYIPRGTVHRNQNLSGQPVRTVELMIVDKDKPHTEPVN* |
| Ga0181519_110495801 | 3300014658 | Bog | RGTIHRNQNLTDKPARSVELVILDKDKPGLEAVPE* |
| Ga0137420_14392991 | 3300015054 | Vadose Zone Soil | MKAGDYVYVPRGTIHRNQNVSKSPARSIELNITDKDKPQTEQVP* |
| Ga0137403_105187031 | 3300015264 | Vadose Zone Soil | VPRGTIHRNQNLTNAPARAVEMNITDKGVPQTEAVPE* |
| Ga0134089_102685541 | 3300015358 | Grasslands Soil | KACDYVYVPRGTIHRNQNVSKSPARSIELNITDKDKPQTEQVP* |
| Ga0134089_104090881 | 3300015358 | Grasslands Soil | VYVPRGTVHRNQNLSNRPARSIELNITDKDKPQTEQVP* |
| Ga0132257_1044128032 | 3300015373 | Arabidopsis Rhizosphere | VYVPRGTIHRNQNLSNRPARAVEMNITDKDKPQTEEVPN* |
| Ga0182041_104215332 | 3300016294 | Soil | TIYVPRGTVHRNQNLSNAPARSIEVNVTDKDKPQTEQVTN |
| Ga0182041_114252252 | 3300016294 | Soil | DSIYVPRGTVHRNQNLTDKPARAINLNIMDKDKPQTTPVTN |
| Ga0182034_110723702 | 3300016371 | Soil | YIPRGTIHRNQNLTDKPARTIELNIMDKDKPLLEPVVGQ |
| Ga0184608_102156083 | 3300018028 | Groundwater Sediment | PRVLKVGDWVYVPRGTIHRNQNLTNAPARAVEMNITDKDVPQTEVVPE |
| Ga0187784_106898241 | 3300018062 | Tropical Peatland | RGTVHRNQNLSSMPARSIELNITDKDKPQTEPVAE |
| Ga0187784_114543391 | 3300018062 | Tropical Peatland | PRGTVHRNQNLSDKPSRSVELNIIEKDKPALENVTN |
| Ga0066662_108864192 | 3300018468 | Grasslands Soil | DFVYVPRGTIHRNQNLSKLPARSIELNITDKDKPQTEQVP |
| Ga0180112_13220851 | 3300019238 | Groundwater Sediment | RGQAPRTMKPGDWVYVPRGTIHRNQNLSSQPVRSIELNITDKDAPQTEVVPN |
| Ga0180111_12975702 | 3300019244 | Groundwater Sediment | VYVPRGTIHRNQNLSSQPVRSIELNITDKDAPQTEVVPN |
| Ga0210396_116675681 | 3300021180 | Soil | WVYIPRGKVHRNQNNTDKPARSIELVIIDKDKPALQVVEE |
| Ga0210383_105074631 | 3300021407 | Soil | SIYVPRGTIHRNQNLTDKPARSINLNIMDKDQPQTEQITN |
| Ga0210384_118843201 | 3300021432 | Soil | GDSVHIPRGTVHRNQNLTDKPARSIELNIMDKDKPALELVTN |
| Ga0187846_101859262 | 3300021476 | Biofilm | YVPRGTVHRNQNVSDKPARSIEVNITDKDKPQTEQVAE |
| Ga0213852_11515733 | 3300021858 | Watersheds | PRGTVHRNQNLTDKPARTVELNIMDKDKPLLEPVAE |
| Ga0233356_10447741 | 3300023046 | Soil | YIPRGTVHRNQNLTDKPARTIELNIMDKDKPLLELVTQ |
| Ga0247679_10675621 | 3300024251 | Soil | GDSVYIPRGTVHRNQNLTDMPARSIELNIMDKDKPALELVTN |
| Ga0207641_120494781 | 3300026088 | Switchgrass Rhizosphere | RGTVHRNQNMTDKPARSIELNIWDKDKPGLELVTE |
| Ga0209375_10156691 | 3300026329 | Soil | GDFVYVPRGTIHRNQNLSKLPARSIELNITDKDKPQTEQVP |
| Ga0209057_11594802 | 3300026342 | Soil | DFVYVPRGTVHRNQNLSKLPARSIELNITDKDKPQTEQVP |
| Ga0257171_10909692 | 3300026377 | Soil | GDSAYIPRGTVHRNQNLTDKPARTIELNIMDKDKPLLEQVTE |
| Ga0257155_10627992 | 3300026481 | Soil | FVYVPRGTVHRNQNVSANSARAIELNITDKDKPQTEQVVE |
| Ga0209058_13481361 | 3300026536 | Soil | MKAGDFVYVPRGTIHRNQNVSKSPARSIELNITDKDKPQTEQVP |
| Ga0179593_10604272 | 3300026555 | Vadose Zone Soil | LCRPLVRVHIPRGTVHRNENLTDKPARSIELNIMDKDKPGLGLVND |
| Ga0208685_10765181 | 3300027513 | Soil | DWVYVPRGTVHRNQNLSGSMARSIELNITDKDAPQTEVVK |
| Ga0209106_10737441 | 3300027616 | Forest Soil | KAGDTIYVPRGTVHRNQNLSNAPARSIEVNVTDKDKPQTEQVTN |
| Ga0209333_10602182 | 3300027676 | Forest Soil | VIVVVYIPRGTVHRNQNLSGQPVRTVELMIVDKDKPHTEPVN |
| Ga0209060_103925642 | 3300027826 | Surface Soil | RGTVHRNQNLTDKPARTIELNIMDKDKPMVEQVPVTQ |
| Ga0209060_104128721 | 3300027826 | Surface Soil | MFPRGTVHRNQNLTNRPARSIELNITDKDKPQTEQVP |
| Ga0209590_104543142 | 3300027882 | Vadose Zone Soil | DFVYVPRGTIHRNQNLSKRPARSIELNITDKDKPQTEQVP |
| Ga0209590_106851011 | 3300027882 | Vadose Zone Soil | GEFVYVPRGTIHRNQNVSNSPARAIELNITDKDKPQTEPVAE |
| Ga0209590_107325131 | 3300027882 | Vadose Zone Soil | PRVLKAGDFVYVPRGTIHRNQNVSANSARAIELNITDKDKPQTEQVAE |
| Ga0265337_10029159 | 3300028556 | Rhizosphere | YVPRGTVHRNQNLTDRPARSIELNITDKDKPQTEQVN |
| Ga0302156_102387651 | 3300028748 | Bog | YIPRGTVHRNQNLSGQPVRTVELMIVDKDKPHTEPVN |
| Ga0302229_102792323 | 3300028879 | Palsa | KVGDSVYIPRGTVHRNQNLTDKPARTVELVILDKDKPGLEVVKDESVAP |
| Ga0311368_110770962 | 3300029882 | Palsa | SVYIPRGTVHRNQNLTDKPARSVELVIIDKDKPQSEVTN |
| Ga0311340_104624411 | 3300029943 | Palsa | VIVVVYIPRGTVHRNQNLSGQPVRTVELMIVDKDKP |
| Ga0311352_104019631 | 3300029944 | Palsa | PRGTVHRNQNLSGQPVRTVELMIVDKDKPHTEPVN |
| Ga0311338_107921992 | 3300030007 | Palsa | VGDSVYIPRGTIHRNQNMTDKPARTIELVILDKDKPALEQVDE |
| Ga0302181_101559811 | 3300030056 | Palsa | VLKVGESVYIPRGTIHRNQNLTDKPARTVELVILDKDKPGLEVVKDESVAP |
| Ga0302184_100600241 | 3300030490 | Palsa | YIPRGTIHRNQNLTDKPARTVELVILDKDKPGLEVVKDESVAP |
| Ga0302183_101876741 | 3300030509 | Palsa | IYIPRGTVHRNQNLSGQPVRTVELMIVDKDKPHTEPVN |
| Ga0311372_110130271 | 3300030520 | Palsa | GDAIYSPRGTVHRNQNLSGQPVRTVELMIVDKDKPHTEPVN |
| Ga0311355_116322462 | 3300030580 | Palsa | GDVVYIPRGTVHRNQNLSGQPVRTVELMIVDKDKPHTEPVN |
| Ga0302307_100373025 | 3300031233 | Palsa | VIVVVYIPRGTVHRNQNLSGQPVRTVELMIVDKDKPH |
| Ga0302325_118544562 | 3300031234 | Palsa | DAIYIPRGAVHRNQNLSGQPVRTVELMIVDKDKPHTEPVK |
| Ga0302324_1015496971 | 3300031236 | Palsa | IPRGTVHRNQNLSGQPVRTVELMIVDKDKPHTEVVN |
| Ga0318573_107947622 | 3300031564 | Soil | IPRGTVHRNENKTDKPARTVELNVLDKDQPALQPVAETQ |
| Ga0318561_108065421 | 3300031679 | Soil | KAGDWVYVPRGTVHRNQNLSGRPARSIELNITDKDKPQTEQVAN |
| Ga0307468_1000514701 | 3300031740 | Hardwood Forest Soil | VRGQPPRVLKVGDWVYVPRGTIHRNQNLTNAPARAVEMNITDKDVPQTEVVPE |
| Ga0318512_102967151 | 3300031846 | Soil | QPRLMKAGEFVYVPRGTVHRNQNLSKLPARSIELNITDKDKPQTEQVP |
| Ga0306925_110279542 | 3300031890 | Soil | MKAGDWVYVPRGTVHRNQNLSGRPARSIELNITDKDKPQTEQVTN |
| Ga0306921_114231441 | 3300031912 | Soil | SYHIPRGTVHRNQNMTDKPARTIELNIVDKDKPLLEPVE |
| Ga0306926_110350081 | 3300031954 | Soil | TFTIKGQQPRLMKAGEFVYVPRGAIHRNQNLSKLPALSIELNITDKDKPQTEQVP |
| Ga0306926_130239572 | 3300031954 | Soil | EPRTLKVGDYAYLPRGTVHRNQNLTDKPALVIELNIMDKDKPDLEPVTE |
| Ga0306922_121655191 | 3300032001 | Soil | YYIPRGTVHRNQNMTDKPARTIELNIMDKDKPLLEPVTE |
| Ga0318532_102652782 | 3300032051 | Soil | WVYVPRGTVHRNQNLSGRPARSIELNITDKDKPQTEQVTN |
| Ga0318514_102306731 | 3300032066 | Soil | KGQAPRVLKAGEFVYVPRGTVHRNQNMSSMPARSIELNITDKGVPQTEVVN |
| Ga0306924_100703546 | 3300032076 | Soil | TVYVPRGTVHRNQNLSNAPARSIEVNVTDKDKPQTEQVAN |
| Ga0306924_103142383 | 3300032076 | Soil | EVTFTIKGEAPRLMKAGEWVYVPRGTVHRNQNLSGRPARSIELNITDKDKPQTEQVTN |
| Ga0306920_1010890422 | 3300032261 | Soil | DTVYVPRGTVHRNQNLSNAPARSIEVNVTDKDKPQTEQVAN |
| Ga0306920_1010997012 | 3300032261 | Soil | VPRGTVHRNQNLSNAPARSIEVNITDKDVPQTEPLVE |
| Ga0335070_118981502 | 3300032829 | Soil | AGDYVYVPRGTVHRNQNLTNRPARAIELNITDKGVPQTEQMGD |
| Ga0310914_118016281 | 3300033289 | Soil | GDFVYVPRGTIHRNQNLSDKPARSIELNITDKDKPQTEQVTE |
| ⦗Top⦘ |