


| Basic Information | |
|---|---|
| Family ID | F055844 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VYLLSVAGLIACKDANLFEAFSCSWTPSSTFYKLL |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 36.76 % |
| % of genes near scaffold ends (potentially truncated) | 90.58 % |
| % of genes from short scaffolds (< 2000 bps) | 88.41 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.797 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.290 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.913 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.101 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 36.51% β-sheet: 0.00% Coil/Unstructured: 63.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF02775 | TPP_enzyme_C | 2.19 |
| PF02826 | 2-Hacid_dh_C | 1.46 |
| PF01471 | PG_binding_1 | 1.46 |
| PF07592 | DDE_Tnp_ISAZ013 | 1.46 |
| PF00296 | Bac_luciferase | 1.46 |
| PF12681 | Glyoxalase_2 | 1.46 |
| PF00690 | Cation_ATPase_N | 1.46 |
| PF06056 | Terminase_5 | 1.46 |
| PF00072 | Response_reg | 0.73 |
| PF00501 | AMP-binding | 0.73 |
| PF13561 | adh_short_C2 | 0.73 |
| PF00496 | SBP_bac_5 | 0.73 |
| PF00196 | GerE | 0.73 |
| PF13847 | Methyltransf_31 | 0.73 |
| PF01979 | Amidohydro_1 | 0.73 |
| PF04075 | F420H2_quin_red | 0.73 |
| PF00856 | SET | 0.73 |
| PF00127 | Copper-bind | 0.73 |
| PF00903 | Glyoxalase | 0.73 |
| PF01738 | DLH | 0.73 |
| PF01522 | Polysacc_deac_1 | 0.73 |
| PF01593 | Amino_oxidase | 0.73 |
| PF13586 | DDE_Tnp_1_2 | 0.73 |
| PF01656 | CbiA | 0.73 |
| PF12151 | MVL | 0.73 |
| PF13565 | HTH_32 | 0.73 |
| PF01751 | Toprim | 0.73 |
| PF01609 | DDE_Tnp_1 | 0.73 |
| PF05199 | GMC_oxred_C | 0.73 |
| PF00271 | Helicase_C | 0.73 |
| PF06925 | MGDG_synth | 0.73 |
| PF12204 | DUF3598 | 0.73 |
| PF13414 | TPR_11 | 0.73 |
| PF01381 | HTH_3 | 0.73 |
| PF13613 | HTH_Tnp_4 | 0.73 |
| PF13546 | DDE_5 | 0.73 |
| PF12762 | DDE_Tnp_IS1595 | 0.73 |
| PF13649 | Methyltransf_25 | 0.73 |
| PF12760 | Zn_Tnp_IS1595 | 0.73 |
| PF02518 | HATPase_c | 0.73 |
| PF00465 | Fe-ADH | 0.73 |
| PF01139 | RtcB | 0.73 |
| PF07690 | MFS_1 | 0.73 |
| PF02416 | TatA_B_E | 0.73 |
| PF13193 | AMP-binding_C | 0.73 |
| PF13625 | Helicase_C_3 | 0.73 |
| PF00085 | Thioredoxin | 0.73 |
| PF01814 | Hemerythrin | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 1.46 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.46 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.73 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.73 |
| COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.73 |
| COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.73 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.73 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.73 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.73 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.73 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.73 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.73 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.73 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.80 % |
| All Organisms | root | All Organisms | 44.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100310519 | Not Available | 1570 | Open in IMG/M |
| 3300000559|F14TC_100449525 | Not Available | 898 | Open in IMG/M |
| 3300000955|JGI1027J12803_104285114 | Not Available | 580 | Open in IMG/M |
| 3300004633|Ga0066395_10678950 | Not Available | 610 | Open in IMG/M |
| 3300005176|Ga0066679_10259888 | Not Available | 1120 | Open in IMG/M |
| 3300005181|Ga0066678_10685788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300005295|Ga0065707_10329566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 952 | Open in IMG/M |
| 3300005295|Ga0065707_10688130 | Not Available | 645 | Open in IMG/M |
| 3300005438|Ga0070701_10392130 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 878 | Open in IMG/M |
| 3300005471|Ga0070698_100568548 | Not Available | 1073 | Open in IMG/M |
| 3300005540|Ga0066697_10710332 | Not Available | 550 | Open in IMG/M |
| 3300005540|Ga0066697_10795143 | Not Available | 514 | Open in IMG/M |
| 3300005554|Ga0066661_10915251 | Not Available | 513 | Open in IMG/M |
| 3300005557|Ga0066704_10799852 | Not Available | 586 | Open in IMG/M |
| 3300005559|Ga0066700_10518319 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300005764|Ga0066903_100228572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2833 | Open in IMG/M |
| 3300005764|Ga0066903_102496307 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300005764|Ga0066903_102563281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
| 3300005764|Ga0066903_106303288 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005764|Ga0066903_106733082 | Not Available | 597 | Open in IMG/M |
| 3300005764|Ga0066903_109059260 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005937|Ga0081455_10002615 | All Organisms → cellular organisms → Bacteria | 21337 | Open in IMG/M |
| 3300005937|Ga0081455_10006211 | All Organisms → cellular organisms → Bacteria | 12878 | Open in IMG/M |
| 3300005937|Ga0081455_10038570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 4229 | Open in IMG/M |
| 3300005981|Ga0081538_10021306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4736 | Open in IMG/M |
| 3300005983|Ga0081540_1049534 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
| 3300006058|Ga0075432_10351800 | Not Available | 624 | Open in IMG/M |
| 3300006196|Ga0075422_10104816 | Not Available | 1089 | Open in IMG/M |
| 3300006797|Ga0066659_10182715 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
| 3300006797|Ga0066659_11817515 | Not Available | 516 | Open in IMG/M |
| 3300006806|Ga0079220_10247877 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300006845|Ga0075421_100233005 | All Organisms → cellular organisms → Bacteria | 2264 | Open in IMG/M |
| 3300006845|Ga0075421_101012462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 940 | Open in IMG/M |
| 3300006845|Ga0075421_101125611 | Not Available | 880 | Open in IMG/M |
| 3300006847|Ga0075431_101523256 | Not Available | 627 | Open in IMG/M |
| 3300006854|Ga0075425_102351076 | Not Available | 592 | Open in IMG/M |
| 3300006880|Ga0075429_101051178 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300006969|Ga0075419_10041917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2864 | Open in IMG/M |
| 3300006969|Ga0075419_10349259 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300007255|Ga0099791_10546500 | Not Available | 564 | Open in IMG/M |
| 3300007255|Ga0099791_10601562 | Not Available | 538 | Open in IMG/M |
| 3300007258|Ga0099793_10152768 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300007258|Ga0099793_10688799 | Not Available | 515 | Open in IMG/M |
| 3300009012|Ga0066710_100077875 | All Organisms → cellular organisms → Bacteria | 4302 | Open in IMG/M |
| 3300009012|Ga0066710_103547588 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300009038|Ga0099829_10110483 | Not Available | 2151 | Open in IMG/M |
| 3300009089|Ga0099828_10679348 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 925 | Open in IMG/M |
| 3300009090|Ga0099827_10776390 | Not Available | 829 | Open in IMG/M |
| 3300009094|Ga0111539_11125603 | Not Available | 912 | Open in IMG/M |
| 3300009094|Ga0111539_11981169 | Not Available | 675 | Open in IMG/M |
| 3300009100|Ga0075418_12304254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 587 | Open in IMG/M |
| 3300009137|Ga0066709_102331977 | Not Available | 732 | Open in IMG/M |
| 3300009143|Ga0099792_10647630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300009147|Ga0114129_10679936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1325 | Open in IMG/M |
| 3300009147|Ga0114129_10826718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1179 | Open in IMG/M |
| 3300009162|Ga0075423_12575972 | Not Available | 556 | Open in IMG/M |
| 3300009553|Ga0105249_10797585 | Not Available | 1008 | Open in IMG/M |
| 3300010043|Ga0126380_10109500 | Not Available | 1679 | Open in IMG/M |
| 3300010046|Ga0126384_10791477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 848 | Open in IMG/M |
| 3300010046|Ga0126384_11512902 | Not Available | 629 | Open in IMG/M |
| 3300010047|Ga0126382_10436362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1033 | Open in IMG/M |
| 3300010047|Ga0126382_10464984 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300010092|Ga0127468_1032144 | Not Available | 557 | Open in IMG/M |
| 3300010102|Ga0127453_1025323 | Not Available | 622 | Open in IMG/M |
| 3300010114|Ga0127460_1006375 | Not Available | 552 | Open in IMG/M |
| 3300010124|Ga0127498_1040479 | Not Available | 540 | Open in IMG/M |
| 3300010358|Ga0126370_10141347 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300010358|Ga0126370_11361024 | Not Available | 668 | Open in IMG/M |
| 3300010359|Ga0126376_10486203 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon | 1138 | Open in IMG/M |
| 3300010360|Ga0126372_12248209 | Not Available | 595 | Open in IMG/M |
| 3300010360|Ga0126372_12267468 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300010360|Ga0126372_13155332 | Not Available | 512 | Open in IMG/M |
| 3300010362|Ga0126377_12395202 | Not Available | 604 | Open in IMG/M |
| 3300010366|Ga0126379_12240429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300010366|Ga0126379_13770892 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010399|Ga0134127_12710427 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 575 | Open in IMG/M |
| 3300011269|Ga0137392_11164618 | Not Available | 629 | Open in IMG/M |
| 3300012189|Ga0137388_10864401 | Not Available | 837 | Open in IMG/M |
| 3300012206|Ga0137380_11338446 | Not Available | 601 | Open in IMG/M |
| 3300012210|Ga0137378_10377643 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300012349|Ga0137387_11042645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300012350|Ga0137372_10719043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300012351|Ga0137386_11048774 | Not Available | 578 | Open in IMG/M |
| 3300012356|Ga0137371_10073584 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 2647 | Open in IMG/M |
| 3300012359|Ga0137385_10249368 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300012361|Ga0137360_10894222 | Not Available | 765 | Open in IMG/M |
| 3300012361|Ga0137360_11100815 | Not Available | 686 | Open in IMG/M |
| 3300012363|Ga0137390_10037318 | All Organisms → cellular organisms → Bacteria | 4670 | Open in IMG/M |
| 3300012363|Ga0137390_11245550 | Not Available | 690 | Open in IMG/M |
| 3300012371|Ga0134022_1110271 | Not Available | 500 | Open in IMG/M |
| 3300012373|Ga0134042_1030272 | Not Available | 507 | Open in IMG/M |
| 3300012375|Ga0134034_1178466 | Not Available | 537 | Open in IMG/M |
| 3300012387|Ga0134030_1082463 | Not Available | 598 | Open in IMG/M |
| 3300012513|Ga0157326_1095653 | Not Available | 506 | Open in IMG/M |
| 3300012917|Ga0137395_10253314 | Not Available | 1237 | Open in IMG/M |
| 3300012917|Ga0137395_10253314 | Not Available | 1237 | Open in IMG/M |
| 3300012918|Ga0137396_11194410 | Not Available | 537 | Open in IMG/M |
| 3300012923|Ga0137359_10217726 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1706 | Open in IMG/M |
| 3300012930|Ga0137407_10262860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1567 | Open in IMG/M |
| 3300012930|Ga0137407_10925219 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300012948|Ga0126375_10279173 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300012971|Ga0126369_12736001 | Not Available | 577 | Open in IMG/M |
| 3300012989|Ga0164305_10776903 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 792 | Open in IMG/M |
| 3300014968|Ga0157379_11725367 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300015264|Ga0137403_10611177 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300015371|Ga0132258_10294605 | All Organisms → cellular organisms → Bacteria | 3988 | Open in IMG/M |
| 3300015371|Ga0132258_12710955 | Not Available | 1236 | Open in IMG/M |
| 3300016319|Ga0182033_10311277 | Not Available | 1303 | Open in IMG/M |
| 3300016319|Ga0182033_11212444 | Not Available | 676 | Open in IMG/M |
| 3300017997|Ga0184610_1257925 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300018468|Ga0066662_12600695 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300019259|Ga0184646_1600641 | Not Available | 542 | Open in IMG/M |
| 3300025918|Ga0207662_11256947 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300025922|Ga0207646_10565009 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300025961|Ga0207712_11077006 | Not Available | 715 | Open in IMG/M |
| 3300026088|Ga0207641_10345204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1417 | Open in IMG/M |
| 3300026296|Ga0209235_1169039 | Not Available | 829 | Open in IMG/M |
| 3300026318|Ga0209471_1336423 | Not Available | 500 | Open in IMG/M |
| 3300026550|Ga0209474_10609902 | Not Available | 559 | Open in IMG/M |
| 3300027577|Ga0209874_1060586 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300027874|Ga0209465_10392665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300027880|Ga0209481_10219541 | Not Available | 952 | Open in IMG/M |
| 3300027909|Ga0209382_10224688 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium SCN 62-11 | 2141 | Open in IMG/M |
| 3300028608|Ga0247819_10667068 | Not Available | 632 | Open in IMG/M |
| 3300030829|Ga0308203_1096288 | Not Available | 503 | Open in IMG/M |
| 3300030902|Ga0308202_1093243 | Not Available | 613 | Open in IMG/M |
| 3300030989|Ga0308196_1030589 | Not Available | 675 | Open in IMG/M |
| 3300031091|Ga0308201_10236463 | Not Available | 622 | Open in IMG/M |
| 3300031093|Ga0308197_10355326 | Not Available | 559 | Open in IMG/M |
| 3300031740|Ga0307468_100828942 | Not Available | 793 | Open in IMG/M |
| 3300031890|Ga0306925_11072778 | Not Available | 816 | Open in IMG/M |
| 3300031908|Ga0310900_11877392 | Not Available | 511 | Open in IMG/M |
| 3300031947|Ga0310909_10631002 | Not Available | 894 | Open in IMG/M |
| 3300032075|Ga0310890_10395646 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1024 | Open in IMG/M |
| 3300033551|Ga0247830_10750152 | Not Available | 776 | Open in IMG/M |
| 3300034644|Ga0370548_142182 | Not Available | 514 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.29% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.62% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.17% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010092 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010102 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1003105194 | 3300000559 | Soil | GGAVYLLSAAERIACKDASLFEAFSCPWTPPLTFYKLR* |
| F14TC_1004495252 | 3300000559 | Soil | LSGAGLITCKDVGPFEAFSCPWPPSPTFYKLREIERGLFTKLATS* |
| JGI1027J12803_1042851141 | 3300000955 | Soil | MCLLSMVGFIACKDASFCHAFLCSWTPPSMFYKLLEIE |
| Ga0066395_106789501 | 3300004633 | Tropical Forest Soil | VSVLSGAWLIACKDVGLFEAFSCPWTPPATFYTLLYIERL* |
| Ga0066679_102598881 | 3300005176 | Soil | DHLLSISEPIACKDANLFEDFSCPWPPSWTFYKLLEIERVG* |
| Ga0066678_106857882 | 3300005181 | Soil | KHGKLLAVAGLIACKDASLFEALVPLDPTFDTLREMERAQ* |
| Ga0065707_103295663 | 3300005295 | Switchgrass Rhizosphere | VYCLSRAGLIVCKDAGLFEASSCPWPLSPTFYKLLEIERIM |
| Ga0065707_106881303 | 3300005295 | Switchgrass Rhizosphere | DHLLSISEPIACKDAHLFEAFSCLWTPPSTFYILLEIECLG* |
| Ga0070701_103921302 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VYLLSVAELIACKDANLFEAFSCSWTPSSTFYKLREIERQL* |
| Ga0070698_1005685481 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RIKSGGGAVYCLAVAGRSACKDVSRFDAFSCPLTPSSTFYKLL* |
| Ga0066697_107103322 | 3300005540 | Soil | YFLSGAGLIACTDVGLCEAFSGPWPPSPTFDTLAG* |
| Ga0066697_107951431 | 3300005540 | Soil | VYFLSIAGFIACKDASPFEAFSCPSTLSSTFYKLLEIER |
| Ga0066661_109152512 | 3300005554 | Soil | VKSGGGAAYLLAVAGLIACKDASLFDAFSCSWIPSSTFYKLL* |
| Ga0066704_107998521 | 3300005557 | Soil | VYFLSIAGFIACKDASPFEAFSCPSTLSSTFYKRLEIERPAFAPFHI |
| Ga0066700_105183191 | 3300005559 | Soil | AVYLLAVAGLIACKDASLFEAFSGPWTPSSTFYKLL* |
| Ga0066903_1002285721 | 3300005764 | Tropical Forest Soil | ADHLLSIAEPIACKDANPFEGFSCPWPPFSTFYKLL* |
| Ga0066903_1024963071 | 3300005764 | Tropical Forest Soil | YFLSGAGHIACKDVGVFEATSCLWPLCPAFYKLLEIERHDLETATV* |
| Ga0066903_1025632811 | 3300005764 | Tropical Forest Soil | VVSLLAVGGLIACKDISLFDAFSYPWPPSSTFYKLL |
| Ga0066903_1063032881 | 3300005764 | Tropical Forest Soil | AGYFLSGAGLIACKDVSLFEVFSCLWTPSSAFYKLL* |
| Ga0066903_1067330821 | 3300005764 | Tropical Forest Soil | AAYYLTVTGLIACKDVRLFEASSCLLTLPSTFYKLLEIERLK* |
| Ga0066903_1090592602 | 3300005764 | Tropical Forest Soil | VYLLSVAGLIACKDVSLFEAFSCPWTPSSSFYKLREIERPK* |
| Ga0081455_100026153 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VYLLAAAGLIACKDVSLFETFSRPWPPSSTFYKLLEIER* |
| Ga0081455_100062119 | 3300005937 | Tabebuia Heterophylla Rhizosphere | RVKSGGGAVYFFSSTGLIAYKDVGIFEAFSCPLPSSPTFYKPL* |
| Ga0081455_100385701 | 3300005937 | Tabebuia Heterophylla Rhizosphere | DSVNLLSVAGLIACKDVSLFEAFSCPWTLPLTFYKLLEIERTV* |
| Ga0081455_102835373 | 3300005937 | Tabebuia Heterophylla Rhizosphere | GGVASLRAVTGLIACTAVRLFDTSSCPWTPPSTFAKLL* |
| Ga0081538_100213061 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VVYLLSVAGLIACKDASLFEAFAGLWPPSSPFYKLR* |
| Ga0081540_10495345 | 3300005983 | Tabebuia Heterophylla Rhizosphere | GGAVYLLIVAGLIACNDASLFDAFSCLWTPPATFYKLL* |
| Ga0075432_103518002 | 3300006058 | Populus Rhizosphere | VYFFSSAGLIACKDVGFFEAFSCPWTPSPTFYKLL* |
| Ga0075422_101048161 | 3300006196 | Populus Rhizosphere | VYLLSVAGPIACKDVSLFDTFSCSWTPPSTFYKLAG* |
| Ga0066659_101827151 | 3300006797 | Soil | VYFLSVAGLIACKDASRSEAFSCLWTPPLTFYKLL |
| Ga0066659_118175151 | 3300006797 | Soil | GAASLLAVAGRIACKDARLFEVFSYPWRPSSTFYKLL* |
| Ga0079220_102478774 | 3300006806 | Agricultural Soil | MAGLIACKDVSLFHGFLCSWRLSSMFYKLPEIKRYPL |
| Ga0075421_1002330054 | 3300006845 | Populus Rhizosphere | VYLLTVAGLIACKDARLFEAFSYPWPPSPTFYKLL* |
| Ga0075421_1010124621 | 3300006845 | Populus Rhizosphere | HLLSISEPIACKDANLFEAFSCSWTPSATFYKLL* |
| Ga0075421_1011256111 | 3300006845 | Populus Rhizosphere | VYFFSSAGRIVCKDVGLFEGFSCPWSPSPTFYKLAG* |
| Ga0075431_1015232562 | 3300006847 | Populus Rhizosphere | ADHLLSISEPIACKDVNLFEAFSCPWTPPSTFYKLLEIERPY* |
| Ga0075425_1023510763 | 3300006854 | Populus Rhizosphere | YLLAGAGRIACKDARFFKAFSWLWPQSSTFYKLL* |
| Ga0075429_1010511782 | 3300006880 | Populus Rhizosphere | VYLLSVAGLIACKDANLFEAFSCSWTPSSTFYKLL* |
| Ga0075419_100419175 | 3300006969 | Populus Rhizosphere | VYLLSVAGLIACKDANLFEAFSCSWTLSATFDKLLEIERWDLGFRVLIPPLRRF |
| Ga0075419_103492592 | 3300006969 | Populus Rhizosphere | VYLLTVTGLIACKDTHLFDASSYPLTPPSTFYKLLEIERSGSAL |
| Ga0099791_105465001 | 3300007255 | Vadose Zone Soil | SGGGAASLLAVAGLIACNDVSLVDGFSCSYTPLSIFYKLL* |
| Ga0099791_106015621 | 3300007255 | Vadose Zone Soil | SRVKSGGGAVYLLSGAGLIACKDVRLLAALSCPCPPPSTFYKLL* |
| Ga0099793_101527681 | 3300007258 | Vadose Zone Soil | GGAVYFLSGAGLIACKDVGLCEAFACPWPPSPTFYKLL* |
| Ga0099793_106887991 | 3300007258 | Vadose Zone Soil | GAVYLLAVAGLIACKDASLFEAFSGPWTPSSTFYKLL* |
| Ga0066710_1000778751 | 3300009012 | Grasslands Soil | GAAYLLAVAGLIACKDASLFKTFSCPWPPSSIFYKLL |
| Ga0066710_1035475881 | 3300009012 | Grasslands Soil | KSGEGVASLLSMAGRIACKDASLFDAFSCPWTPLSTFDKLL |
| Ga0099829_101104831 | 3300009038 | Vadose Zone Soil | YLLSVAGLIACKDASLFEAFLCPWTPPSTCYKLL* |
| Ga0099828_106793481 | 3300009089 | Vadose Zone Soil | GAAYLFSVAGRIACKDASLFDAFSGPWTSSSTFYKLL* |
| Ga0099827_107763901 | 3300009090 | Vadose Zone Soil | AASLLAVAGLIACNDVSLVDGFSCSYTPLSIFYNLL* |
| Ga0111539_111256031 | 3300009094 | Populus Rhizosphere | GAVYWFSSAGLIACKAVGLFETFSCPWSPSPTFYKLL* |
| Ga0111539_119811691 | 3300009094 | Populus Rhizosphere | VYLLSVAGLIACKDANLFEAFSCSWTLSATFDKLLEIERWDLGFRVL |
| Ga0075418_123042542 | 3300009100 | Populus Rhizosphere | AVYLLAAAGLIACKDASLFDAFSGSWAPSSTFYKLL* |
| Ga0066709_1023319772 | 3300009137 | Grasslands Soil | GGAAYLLAVAELSVYKDASLFEAFSCLWPAPSTFYKQL* |
| Ga0099792_106476303 | 3300009143 | Vadose Zone Soil | FGGGAAYLLAVAGLSACKDTSLFEAFSCLWTLSSIFYKLL* |
| Ga0114129_106799361 | 3300009147 | Populus Rhizosphere | GAAYLLSVVGLIACQNASLFEALWCPWTSSSTFYKLR* |
| Ga0114129_108267181 | 3300009147 | Populus Rhizosphere | HLLSISEPIACKDANLFEAFSCSWPPSSAFYNLL* |
| Ga0075423_125759722 | 3300009162 | Populus Rhizosphere | LLSISEPIACKDVNLFEAFSCPWTPPSTFYKLLEIERPY* |
| Ga0105249_107975851 | 3300009553 | Switchgrass Rhizosphere | LLSIAGLIACNGASLFEAFSCSWTPSLTFYKLAG* |
| Ga0126380_101095002 | 3300010043 | Tropical Forest Soil | GGGAGYFLSVAGFIACKDVSLFEAFSYLWTPSSTFYKLL* |
| Ga0126384_107914772 | 3300010046 | Tropical Forest Soil | MVYFLSMAGFIACQDASPFEAFSCPSTPSSTFYKLL |
| Ga0126384_115129022 | 3300010046 | Tropical Forest Soil | LSISEPIACKDVNPFKAFSCPWLPFSSFYKLVEIERTKLHT* |
| Ga0126382_104363622 | 3300010047 | Tropical Forest Soil | AVYLHAVVELIACNDASLFDAFSCLWTPPSTFYKLR* |
| Ga0126382_104649842 | 3300010047 | Tropical Forest Soil | SLLAIAERITCKDASLFEAFSCPWPPSATFDPLLEIER* |
| Ga0127468_10321441 | 3300010092 | Grasslands Soil | VYFFSSAGLIACKDVGLFEAFSCPWTPSPTFYKLLEIERPRL |
| Ga0127453_10253231 | 3300010102 | Grasslands Soil | VYFFSSAGLIACKDVGLFEAFSCPWTPSPTFYKLLEIERP |
| Ga0127460_10063751 | 3300010114 | Grasslands Soil | VYFFSSAGLIACKDVGLFEAFSCPWTPSPTFYKLLEIERHR |
| Ga0127498_10404792 | 3300010124 | Grasslands Soil | VYFFSSAGLIVCKDVGFFEAFSCPWTPSPTCYKLLEIERP |
| Ga0126370_101413475 | 3300010358 | Tropical Forest Soil | GAGYFLSGAGLIACKDVSLFEVFSCLWTPSSAFYKLL* |
| Ga0126370_113610241 | 3300010358 | Tropical Forest Soil | VYFFSSAGRIACKDVGLVEAFSGPWRLSPTCYKLREIERMG |
| Ga0126376_104862032 | 3300010359 | Tropical Forest Soil | VISVVGLVACKDARLFKVFSCSEPPSATFYKLLEIERYI* |
| Ga0126372_122482091 | 3300010360 | Tropical Forest Soil | KSGAGAVYLHAVVELIACNDASLFDAFSCLWTPPSTFYKLR* |
| Ga0126372_122674681 | 3300010360 | Tropical Forest Soil | VFCLSGAGLIACKDVDLFEAFSCPWPPSSTFYKLR |
| Ga0126372_128910402 | 3300010360 | Tropical Forest Soil | VYLLTGAGRIACKDARLFKAFSWLWPHSSTFYKLIYIDRLCSME |
| Ga0126372_131553322 | 3300010360 | Tropical Forest Soil | VNLLSVVGLIACKDANLFEAFSCSWTRPATFYKLLG |
| Ga0126377_123952021 | 3300010362 | Tropical Forest Soil | GAAYLLAVAGLIACKDVGLFDAFSCSWTPSSTFYKCREIERALFGA* |
| Ga0126379_122404291 | 3300010366 | Tropical Forest Soil | VASLLSMAGLIACKDASLFHTFLCSRPPPSMFYKLLEIERS |
| Ga0126379_137708921 | 3300010366 | Tropical Forest Soil | LSVVGLIAYKDANLFEAFSCSWTRSATFYKLLEIEREPFGSTRY* |
| Ga0134127_127104272 | 3300010399 | Terrestrial Soil | YLLSVAELIACKDANLFEAFSCSWTPSSTFYKLREIERQL* |
| Ga0137392_111646181 | 3300011269 | Vadose Zone Soil | AYLLSVAGRIASKDASLFEALSCPWTPPATFYKLL* |
| Ga0137388_108644011 | 3300012189 | Vadose Zone Soil | GTAYLLSVAGLIACKDASLFEAFLCPWTPPSTCYKLL* |
| Ga0137380_113384461 | 3300012206 | Vadose Zone Soil | YLLSVAGLIACKDASLFEAFSCPWTPPLTFYKLL* |
| Ga0137378_103776431 | 3300012210 | Vadose Zone Soil | AYLLAVAGLSACKDTSLFEAFSCLWTLSSIFYKLL* |
| Ga0137387_110426452 | 3300012349 | Vadose Zone Soil | DGGAAYLLAVAGLIGCKDASLFDAFSCPWTPPLTFYKLL* |
| Ga0137372_107190431 | 3300012350 | Vadose Zone Soil | SGGGAAYLLSDTEPIACKDVRLLDAFSYLCTPLSTFYKLAG* |
| Ga0137386_110487741 | 3300012351 | Vadose Zone Soil | VYLLSAAERIACTDASLFGAFSCPWAPLSTFYKLLYIERCSLPML |
| Ga0137371_100735841 | 3300012356 | Vadose Zone Soil | GAVYLLSVAGLIACKDANLFEAFSCSWTPSSTFYKLL* |
| Ga0137385_102493681 | 3300012359 | Vadose Zone Soil | KSGGGAVYFLAGAGLIACTDVGLCEAFACLWPPSPTFYKLL* |
| Ga0137360_108942221 | 3300012361 | Vadose Zone Soil | AAYLLAVIGLIACKDARLFDASSRPWTPPSPFYKLL* |
| Ga0137360_111008152 | 3300012361 | Vadose Zone Soil | VKPGEGAASLLAVTGLIACKDASFVEAFSCSWTPPSTFYTLL* |
| Ga0137390_100373181 | 3300012363 | Vadose Zone Soil | AYFLSVAGLIACKDASLFDAFSCPWPPPSTFYKLR* |
| Ga0137390_112455501 | 3300012363 | Vadose Zone Soil | KSGGGAAYLFSVAGRIACKDASLFDAFSGPWTSSSTFYKL* |
| Ga0134022_11102712 | 3300012371 | Grasslands Soil | VYFFSSAGLIACKDVGLFEAFSCPWTPSPTFYKLLEI |
| Ga0134042_10302721 | 3300012373 | Grasslands Soil | VYFFSSAGLIACKDVGFFEAFSCPWTPSPTCYKLLEIERP |
| Ga0134034_11784661 | 3300012375 | Grasslands Soil | VYFFSSAGLIACKDVGLFEAFSCPWTPSPTFYKLL |
| Ga0134030_10824633 | 3300012387 | Grasslands Soil | AYLLAVAGLIACKDVGLFDAFSCPWTPLSTFYKLL* |
| Ga0157326_10956532 | 3300012513 | Arabidopsis Rhizosphere | RVKSGGGAVYLLSVAGLIAYKDANLFEAFSCSWTLSATFYKLL* |
| Ga0137395_102533141 | 3300012917 | Vadose Zone Soil | RVQSGGGAASLLAVAGLIACNDVSLVDGFSCSYTPLSIFYNLL* |
| Ga0137395_102533143 | 3300012917 | Vadose Zone Soil | GGGAASLLAVAGLIACNDVSLVDAFSCSYTPLSIFYNLL* |
| Ga0137396_111944101 | 3300012918 | Vadose Zone Soil | AYLLSVAGRIASKDASLFEALSCPWTPPATFDKLL* |
| Ga0137359_102177261 | 3300012923 | Vadose Zone Soil | GAAYLFSVAGRIACKDASLFDAFSGPWTSSSTFYTLL* |
| Ga0137407_102628602 | 3300012930 | Vadose Zone Soil | AVYLFSVAVRIAGKDASLFDAFSGPWTSSSTFDTLL* |
| Ga0137407_109252191 | 3300012930 | Vadose Zone Soil | SGGAAYLLSVTGLIACKDARLFEASSCPLTPPSTFYKLL* |
| Ga0126375_102791731 | 3300012948 | Tropical Forest Soil | VYYLSGTGLIVCKDAGVIEAFSCPWSPSSTFYKLLEIE |
| Ga0126369_127360011 | 3300012971 | Tropical Forest Soil | KSGGGAACILSVARLIACKDASLFNAFSCPWTPPSTFYNG* |
| Ga0164305_107769032 | 3300012989 | Soil | AVYLLSVAGLIACKDANLFEAFSCSWTPSSTFYKLL* |
| Ga0157379_117253671 | 3300014968 | Switchgrass Rhizosphere | YLLSVARLIACKDANLFEAFSCSWTPSSIFYKLR* |
| Ga0137403_106111771 | 3300015264 | Vadose Zone Soil | SGGAAYLLTITGLIACKDAHLFDASSCPLTSPSTFYKLL* |
| Ga0132258_102946054 | 3300015371 | Arabidopsis Rhizosphere | MCPFSVAGLIACKDARLFNAFTCPWTSPSTFYKLLEIERS* |
| Ga0132258_127109551 | 3300015371 | Arabidopsis Rhizosphere | RVKSGGGAVYLLSVAGLIACKDANLFEAFSCSWTPSSTFYKLL* |
| Ga0182033_103112771 | 3300016319 | Soil | SLLAVAGLIAYKDASLFEAFSCLWPPSATLYTLREIERGEFGV |
| Ga0182033_112124442 | 3300016319 | Soil | VYYLSGAGLIVCKDVGVIEAFSCPWSPSSTFYKLLEIDR |
| Ga0184610_12579252 | 3300017997 | Groundwater Sediment | AYLLSVAGLIACKDASLFEAFSCPWTPPLTFYKLL |
| Ga0066662_126006951 | 3300018468 | Grasslands Soil | GGGAVYLLSVAGRIACKDANIFEAFSYSWTPSSTFYKLREIERQL |
| Ga0184646_16006411 | 3300019259 | Groundwater Sediment | VYFFSNAGLIACKDVGFCEAFSCPWTPSPTFYKLLKIERPRLA |
| Ga0207662_112569471 | 3300025918 | Switchgrass Rhizosphere | VKSGGGTVYLLSVAGLIAYKDTNLFEVFSCLWTLSSAFYKLR |
| Ga0207646_105650092 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GGAVYLLSVAGLIACKDASLFDAFSCPWTSSSTFYKLL |
| Ga0207712_110770061 | 3300025961 | Switchgrass Rhizosphere | GAVYLLSVAGLIACKDANLFEAFSCSWTLSATFYKLL |
| Ga0207641_103452041 | 3300026088 | Switchgrass Rhizosphere | VYLLSVAELIACKDANLFEAFSCSWTPSSTFYKLREI |
| Ga0209235_11690392 | 3300026296 | Grasslands Soil | GGAVYFLSGAGLIACKDVGLCEAFACLWPPSPTFYKLL |
| Ga0209471_13364231 | 3300026318 | Soil | GGGAACLLSVARLTACKDASRFEALSCPWILPSPFYKLL |
| Ga0209474_106099021 | 3300026550 | Soil | VYLLAVAGLIACKDASLFEAFSCPWTPSSTFYKLLEIERLL |
| Ga0209874_10605862 | 3300027577 | Groundwater Sand | VYLLSVAGLIACKDANLFEAFSCSWTPSSTFYKLL |
| Ga0209465_103926652 | 3300027874 | Tropical Forest Soil | VASLLSMAGLIACKDASLFHTFLCSRPPPSMFYKLLEIERRCFLV |
| Ga0209481_102195411 | 3300027880 | Populus Rhizosphere | VYLLSVAGLIACKDANLFEAFSCSWTLSATFDKLL |
| Ga0209382_102246881 | 3300027909 | Populus Rhizosphere | VYFFSSAGRIVCKDVGLFEGFSCPWSPSPTFYKLAG |
| Ga0247819_106670681 | 3300028608 | Soil | VSLLAVARLIACKDASLCEAFSCPWIPPSTFYKLLYIERPE |
| Ga0308203_10962881 | 3300030829 | Soil | VYFFSSAGLIACKDVGFCEAFSCPWTPSPTFYKLLKIERP |
| Ga0308202_10932431 | 3300030902 | Soil | VYFFSSAGLIACKDVGFCEAFSCPWTPSPTFYKLLKIE |
| Ga0308196_10305891 | 3300030989 | Soil | VYFFSSAGLIACKDVGFCEAFSCPWTPSPTFYKLLKIERPR |
| Ga0308201_102364631 | 3300031091 | Soil | VYFFSSAGLIACKDVGFCEAFSCPWTPSPTFYKLLKIERPRL |
| Ga0308197_103553261 | 3300031093 | Soil | VYFFSSAGLIACKDVGFCEAFSCPWTPSPTFYKLLKIERPRLA |
| Ga0307468_1008289421 | 3300031740 | Hardwood Forest Soil | MYLLAVVGLLACKDAHLFEAFSCSWTRSATFYKLLEIERTTQALALF |
| Ga0306925_110727782 | 3300031890 | Soil | SGEGAASLLAVAGFIACKDASLFEAFSCLWLPSVTF |
| Ga0310900_118773922 | 3300031908 | Soil | VYLLAVAGLIACKDANLFEAFSCSWTPSPTFYKLLEIERAFF |
| Ga0310909_106310021 | 3300031947 | Soil | VYYLSGAGLIVCKDVGVIEAFSCPWSPSSTFYKLLEIDRLHLSLSRLS |
| Ga0310890_103956461 | 3300032075 | Soil | RGAVYLLSAAERIACKDASLFGACSWPWAPLSTFYKLL |
| Ga0247830_107501521 | 3300033551 | Soil | VYLLSVAGLIACKDANLFEAFSCSWPPPSTFYKRLEIERPST |
| Ga0370548_142182_2_127 | 3300034644 | Soil | MYFFSSAGLIACKDVGFCEAFSCPWTPSPTFYKLLKIERPRL |
| ⦗Top⦘ |