


| Basic Information | |
|---|---|
| Family ID | F055631 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 49 residues |
| Representative Sequence | AEETKATFNADANIPYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.74 % |
| % of genes near scaffold ends (potentially truncated) | 97.10 % |
| % of genes from short scaffolds (< 2000 bps) | 94.93 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.217 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.188 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.232 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.22% β-sheet: 16.22% Coil/Unstructured: 67.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF02472 | ExbD | 92.03 |
| PF03030 | H_PPase | 7.25 |
| PF00883 | Peptidase_M17 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 92.03 |
| COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 7.25 |
| COG0260 | Leucyl aminopeptidase | Amino acid transport and metabolism [E] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.67 % |
| Unclassified | root | N/A | 33.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_10707756 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 641 | Open in IMG/M |
| 3300002568|C688J35102_119808648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → Myxococcus stipitatus | 781 | Open in IMG/M |
| 3300003152|Ga0052254_1027769 | Not Available | 567 | Open in IMG/M |
| 3300004092|Ga0062389_104182260 | Not Available | 543 | Open in IMG/M |
| 3300004798|Ga0058859_11431993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → Myxococcus stipitatus | 628 | Open in IMG/M |
| 3300004801|Ga0058860_12094718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 500 | Open in IMG/M |
| 3300004803|Ga0058862_12463216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 714 | Open in IMG/M |
| 3300005260|Ga0074072_1130652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300005329|Ga0070683_102321383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 515 | Open in IMG/M |
| 3300005334|Ga0068869_101459051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 607 | Open in IMG/M |
| 3300005337|Ga0070682_101411535 | Not Available | 596 | Open in IMG/M |
| 3300005340|Ga0070689_101644926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 584 | Open in IMG/M |
| 3300005340|Ga0070689_101667392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300005364|Ga0070673_100407584 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300005435|Ga0070714_101085527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300005437|Ga0070710_11103192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → Myxococcus stipitatus | 583 | Open in IMG/M |
| 3300005456|Ga0070678_100565918 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 1011 | Open in IMG/M |
| 3300005457|Ga0070662_101067176 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 692 | Open in IMG/M |
| 3300005466|Ga0070685_10044462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 2542 | Open in IMG/M |
| 3300005530|Ga0070679_101484965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300005543|Ga0070672_100934747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → Myxococcus stipitatus | 767 | Open in IMG/M |
| 3300005544|Ga0070686_101748031 | Not Available | 528 | Open in IMG/M |
| 3300005564|Ga0070664_100576887 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300005569|Ga0066705_10376547 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 892 | Open in IMG/M |
| 3300005614|Ga0068856_101465632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300005614|Ga0068856_102417498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 533 | Open in IMG/M |
| 3300005950|Ga0066787_10074662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 689 | Open in IMG/M |
| 3300009098|Ga0105245_10782331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 991 | Open in IMG/M |
| 3300009168|Ga0105104_10519328 | Not Available | 672 | Open in IMG/M |
| 3300009176|Ga0105242_11458194 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 714 | Open in IMG/M |
| 3300009609|Ga0105347_1355279 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 625 | Open in IMG/M |
| 3300010320|Ga0134109_10223313 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 702 | Open in IMG/M |
| 3300010325|Ga0134064_10454477 | Not Available | 523 | Open in IMG/M |
| 3300010375|Ga0105239_11957340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300010397|Ga0134124_12921711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300010399|Ga0134127_10473309 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 1258 | Open in IMG/M |
| 3300010399|Ga0134127_11110883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300010403|Ga0134123_12027227 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 634 | Open in IMG/M |
| 3300011120|Ga0150983_11135237 | Not Available | 604 | Open in IMG/M |
| 3300011340|Ga0151652_12098643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300011395|Ga0137315_1062775 | Not Available | 535 | Open in IMG/M |
| 3300012167|Ga0137319_1010779 | All Organisms → cellular organisms → Bacteria | 1911 | Open in IMG/M |
| 3300012212|Ga0150985_103165786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1975 | Open in IMG/M |
| 3300012212|Ga0150985_115854596 | Not Available | 558 | Open in IMG/M |
| 3300012469|Ga0150984_116077050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 976 | Open in IMG/M |
| 3300012469|Ga0150984_119091136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1086 | Open in IMG/M |
| 3300012892|Ga0157294_10071730 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 835 | Open in IMG/M |
| 3300012901|Ga0157288_10398704 | Not Available | 514 | Open in IMG/M |
| 3300012923|Ga0137359_11237811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300012955|Ga0164298_10279632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1022 | Open in IMG/M |
| 3300012960|Ga0164301_11449699 | Not Available | 563 | Open in IMG/M |
| 3300012961|Ga0164302_10203147 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300012982|Ga0168317_1028804 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300012986|Ga0164304_10885473 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 697 | Open in IMG/M |
| 3300012988|Ga0164306_11175716 | Not Available | 642 | Open in IMG/M |
| 3300013105|Ga0157369_11436123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300013105|Ga0157369_12543077 | Not Available | 518 | Open in IMG/M |
| 3300013307|Ga0157372_13280681 | Not Available | 516 | Open in IMG/M |
| 3300014318|Ga0075351_1007898 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300014326|Ga0157380_12280233 | Not Available | 606 | Open in IMG/M |
| 3300014745|Ga0157377_10684402 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 743 | Open in IMG/M |
| 3300015200|Ga0173480_10474396 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 743 | Open in IMG/M |
| 3300015372|Ga0132256_102539068 | Not Available | 613 | Open in IMG/M |
| 3300015373|Ga0132257_101855486 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 775 | Open in IMG/M |
| 3300016270|Ga0182036_11208311 | Not Available | 629 | Open in IMG/M |
| 3300018060|Ga0187765_11280679 | Not Available | 518 | Open in IMG/M |
| 3300018081|Ga0184625_10482910 | Not Available | 629 | Open in IMG/M |
| 3300018083|Ga0184628_10081911 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 1648 | Open in IMG/M |
| 3300018433|Ga0066667_10882716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 768 | Open in IMG/M |
| 3300018469|Ga0190270_10826078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 936 | Open in IMG/M |
| 3300018481|Ga0190271_12419845 | Not Available | 628 | Open in IMG/M |
| 3300020034|Ga0193753_10070466 | Not Available | 1810 | Open in IMG/M |
| 3300021180|Ga0210396_10388138 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 1228 | Open in IMG/M |
| 3300021405|Ga0210387_10018224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5452 | Open in IMG/M |
| 3300021475|Ga0210392_11225752 | Not Available | 562 | Open in IMG/M |
| 3300022506|Ga0242648_1029914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300022512|Ga0242676_1022836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae | 662 | Open in IMG/M |
| 3300022708|Ga0242670_1028883 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 706 | Open in IMG/M |
| 3300022708|Ga0242670_1041821 | Not Available | 627 | Open in IMG/M |
| 3300022711|Ga0242674_1029799 | Not Available | 680 | Open in IMG/M |
| 3300022714|Ga0242671_1052559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300022724|Ga0242665_10130945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300023062|Ga0247791_1033665 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 788 | Open in IMG/M |
| 3300023077|Ga0247802_1048012 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 669 | Open in IMG/M |
| 3300024055|Ga0247794_10257626 | Not Available | 578 | Open in IMG/M |
| 3300024245|Ga0247677_1067527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300024254|Ga0247661_1118062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300025504|Ga0208356_1058529 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 759 | Open in IMG/M |
| 3300025898|Ga0207692_11131321 | Not Available | 519 | Open in IMG/M |
| 3300025928|Ga0207700_11951393 | Not Available | 514 | Open in IMG/M |
| 3300025930|Ga0207701_11457547 | Not Available | 556 | Open in IMG/M |
| 3300025934|Ga0207686_11278178 | Not Available | 602 | Open in IMG/M |
| 3300025936|Ga0207670_11301493 | Not Available | 616 | Open in IMG/M |
| 3300025942|Ga0207689_10589900 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 934 | Open in IMG/M |
| 3300025945|Ga0207679_11381790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300026088|Ga0207641_11658081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300026089|Ga0207648_10130967 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 2208 | Open in IMG/M |
| 3300026215|Ga0209849_1051760 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 718 | Open in IMG/M |
| 3300026281|Ga0209863_10234471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 527 | Open in IMG/M |
| 3300027513|Ga0208685_1030625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1189 | Open in IMG/M |
| 3300027867|Ga0209167_10645239 | Not Available | 579 | Open in IMG/M |
| 3300027886|Ga0209486_11316984 | Not Available | 500 | Open in IMG/M |
| 3300028065|Ga0247685_1024511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300028381|Ga0268264_12318013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300028800|Ga0265338_11023660 | Not Available | 558 | Open in IMG/M |
| 3300029984|Ga0311332_11325198 | Not Available | 582 | Open in IMG/M |
| 3300030741|Ga0265459_12222905 | Not Available | 666 | Open in IMG/M |
| 3300030988|Ga0308183_1052206 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 824 | Open in IMG/M |
| 3300030988|Ga0308183_1064092 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 769 | Open in IMG/M |
| 3300030990|Ga0308178_1073747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300030990|Ga0308178_1149109 | Not Available | 536 | Open in IMG/M |
| 3300031057|Ga0170834_106882257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae | 521 | Open in IMG/M |
| 3300031100|Ga0308180_1036574 | Not Available | 528 | Open in IMG/M |
| 3300031114|Ga0308187_10255344 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 639 | Open in IMG/M |
| 3300031123|Ga0308195_1073540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300031231|Ga0170824_117173074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300031231|Ga0170824_127556463 | Not Available | 544 | Open in IMG/M |
| 3300031446|Ga0170820_17825935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 871 | Open in IMG/M |
| 3300031469|Ga0170819_11077772 | Not Available | 537 | Open in IMG/M |
| 3300031474|Ga0170818_104428260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 714 | Open in IMG/M |
| 3300031474|Ga0170818_112109472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300031545|Ga0318541_10575491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300031546|Ga0318538_10020366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 2945 | Open in IMG/M |
| 3300031595|Ga0265313_10050421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1997 | Open in IMG/M |
| 3300031640|Ga0318555_10228926 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 1003 | Open in IMG/M |
| 3300031835|Ga0318517_10385982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300032013|Ga0310906_11139996 | Not Available | 565 | Open in IMG/M |
| 3300032091|Ga0318577_10189600 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 983 | Open in IMG/M |
| 3300032421|Ga0310812_10282361 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 735 | Open in IMG/M |
| 3300032782|Ga0335082_11666173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae | 511 | Open in IMG/M |
| 3300032955|Ga0335076_11101882 | Not Available | 677 | Open in IMG/M |
| 3300033289|Ga0310914_11716363 | Not Available | 532 | Open in IMG/M |
| 3300033290|Ga0318519_10363676 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium A1Q1_fos_1807 | 857 | Open in IMG/M |
| 3300034643|Ga0370545_060613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300034667|Ga0314792_158243 | Not Available | 610 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.22% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.07% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.62% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.17% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.17% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 2.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.45% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.45% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.72% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.72% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.72% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.72% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005260 | Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300011395 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2 | Environmental | Open in IMG/M |
| 3300012167 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023062 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4 | Environmental | Open in IMG/M |
| 3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031100 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_107077561 | 3300001686 | Soil | NADASTPYDVVIATLDAMRQEEDGKILFPDVSFAAGIL* |
| C688J35102_1198086482 | 3300002568 | Soil | NAEETKATFNADANIPYDIVIATLDAMRQSEEGKILFPDVNFAAGIQ* |
| Ga0052254_10277691 | 3300003152 | Sediment | VDETKATFNADAMIPYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ* |
| Ga0062389_1041822602 | 3300004092 | Bog Forest Soil | NFSADANVPYDIVVATLDAMRTTEEGKVLFPDISFAAGIM* |
| Ga0058859_114319932 | 3300004798 | Host-Associated | DNADETKVNFNADSNVAYDIVVATLDAMRQDEAGKVLFPDVAFSAGIL* |
| Ga0058860_120947182 | 3300004801 | Host-Associated | ETKATFNADANIPYDVVIATLDAMRQAEDGKILFPDVNFAAGIQ* |
| Ga0058862_124632162 | 3300004803 | Host-Associated | KLQEIKGAPGNVDETKANFNADATIPYDIVVATLDAMRQNSDGKVLFPDVAFAAGIL* |
| Ga0074072_11306521 | 3300005260 | Soil | AVTVTVTKKLLEIKSSPDNKDETKVNFNADSNTSYDIDVATLDAMRQDDDGRALFPDVAFSAGIL* |
| Ga0070683_1023213831 | 3300005329 | Corn Rhizosphere | DNAEETKATFNADANIPYDIVIATLDAMRQSDDGKILFPDVNFAAGIQ* |
| Ga0068869_1014590511 | 3300005334 | Miscanthus Rhizosphere | NPDNADETKATFNADANIAYDIVIATLDAMRQAEDGKLLFPDVNFAAGIQ* |
| Ga0070682_1014115352 | 3300005337 | Corn Rhizosphere | KATFNADAMIPYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ* |
| Ga0070689_1016449262 | 3300005340 | Switchgrass Rhizosphere | KLKEIKSNPDNADETKATFNADANIPYDTVIATLDAMRQTDEGKLLFPDVNFAAGIQ* |
| Ga0070689_1016673921 | 3300005340 | Switchgrass Rhizosphere | GNGDETKVNFNADANTSYDIVVATLDAMRQDDSGKVLFPDVAFSAGIL* |
| Ga0070673_1004075841 | 3300005364 | Switchgrass Rhizosphere | TPDAADETKATFNADANIPYDIVIPTLDAMRTAEDGKILFPDVNFAAGIQ* |
| Ga0070714_1010855272 | 3300005435 | Agricultural Soil | DETKANFNADATIPYDIVVATLDAMRQNSDGKVLFPDVAFAAGIL* |
| Ga0070710_111031921 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | NADETKANFNADASTPYDVVIATLDAMRQEEGTGKILFPDVAFAAGIL* |
| Ga0070678_1005659181 | 3300005456 | Miscanthus Rhizosphere | DETKATFNADAMIPYDIVIATLDAMRQADDGKLLFPDVNFAAGIQ* |
| Ga0070662_1010671762 | 3300005457 | Corn Rhizosphere | IKSNPDNADETKATFNADAMIPYDIVIATLDAMRQADDGKLLFPDVNFAAGIQ* |
| Ga0070685_100444621 | 3300005466 | Switchgrass Rhizosphere | DNAEETKATFNADANIPYDIVIATLDAMRQSEEGKLLFPDVNFAAGIQ* |
| Ga0070679_1014849652 | 3300005530 | Corn Rhizosphere | NFNADATIPYDIVVATLDAMRQNNDGKVLFPDVAFAAGIL* |
| Ga0070672_1009347471 | 3300005543 | Miscanthus Rhizosphere | AEETKATFNADANIPYDIVISTLDAMRQADDGKILFPDVNFAAGIQ* |
| Ga0070686_1017480312 | 3300005544 | Switchgrass Rhizosphere | KLIEIKSSPDNATETKVNFNADANTSYDIVVATLDAMRQDEAGKVLFPDVAFSAGIL* |
| Ga0070664_1005768871 | 3300005564 | Corn Rhizosphere | ETKATFNADANIPYDIVIATLDAMRQSEEGKLLFPDVNFAAGIQ* |
| Ga0066705_103765472 | 3300005569 | Soil | ANIPYDIVIATLDAMRQADDGKILFPDVNFAAGIQ* |
| Ga0068856_1014656322 | 3300005614 | Corn Rhizosphere | ANFNADANIPYDIVVATLDAMRTDDAGKILFPDVAFAAGIQ* |
| Ga0068856_1024174982 | 3300005614 | Corn Rhizosphere | EIKSNPDNAEETKATFNADANIPYDIVIATLDAMRQSEEGKILFPDVNFAAGIQ* |
| Ga0066787_100746622 | 3300005950 | Soil | TLTTKLKEIKSSADNADETKATFNADANVPYDIVVATLDAMRTTEEGKALFPDILFAAGIL* |
| Ga0079222_112004752 | 3300006755 | Agricultural Soil | QYDYKSLATKLKEIKSAPDNAAETKANFSADANVPYDIVVATLDAMRTTEEGKVLFPDISFAAGIL* |
| Ga0105245_107823313 | 3300009098 | Miscanthus Rhizosphere | DSNTSYDIVVATLDAMHQDDNGKALFPDVAFSAGII* |
| Ga0105104_105193281 | 3300009168 | Freshwater Sediment | TAKLKEIKGTADAADETKATFNADANIPYDIVIATLDAMRTAEDGKILFPDVNFAAGIQ* |
| Ga0105242_114581942 | 3300009176 | Miscanthus Rhizosphere | TTKLKEIKSNPDNADETKATFNADAMIPYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ* |
| Ga0105347_13552792 | 3300009609 | Soil | DANIPYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ* |
| Ga0134109_102233132 | 3300010320 | Grasslands Soil | AEETKATFNADANIPYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ* |
| Ga0134064_104544772 | 3300010325 | Grasslands Soil | KEIKSNPDNAEETKATFNADANIPYDIVIATLDAMRQSEEGKILFPDVNFAAGIQ* |
| Ga0105239_119573401 | 3300010375 | Corn Rhizosphere | IKSNPDNADETKANFNADASTPYDVVIATLDAMRQEEGTGKILFPDVAFAAGIL* |
| Ga0134124_129217112 | 3300010397 | Terrestrial Soil | YKTLTTKLKEIKTNPDNAEETKATFNADANIPYDVVIATLDAMRQAEDGKILFPDVNFAAGIQ* |
| Ga0134127_104733091 | 3300010399 | Terrestrial Soil | KEIKSNPDNADETKATFNADANIAYDIVIATLDAMRQAEDGKLLFPDVNFAAGIQ* |
| Ga0134127_111108831 | 3300010399 | Terrestrial Soil | TAKLKEIKSNPDNATETKANFNADASTPYDVVIATLDAMRQDEASGKILFPDVAFAAGIL |
| Ga0134123_120272271 | 3300010403 | Terrestrial Soil | AMIPYDIVIATLDAMRQGDDGKILFPDVNFAAGIQ* |
| Ga0150983_111352372 | 3300011120 | Forest Soil | ATETKANFNADAATPYDVVIATLDAMRQEDIPGGKILFPDVSFAAGIQ* |
| Ga0150983_153235992 | 3300011120 | Forest Soil | QYDYKSLATKLKEIKSAPDNAAETKANFSADANVPYDIVVATLDAMRVAEDGKILFPDISFAAGIL* |
| Ga0151652_120986431 | 3300011340 | Wetland | FNADATTSYDVVVATLDAMRQDDAGKVLFPDVAFSAGIL* |
| Ga0137315_10627751 | 3300011395 | Soil | GNAEETKVTVNADAHIPYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ* |
| Ga0137319_10107793 | 3300012167 | Soil | NPDNAEETKAIFNADANIAYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ* |
| Ga0150985_1031657861 | 3300012212 | Avena Fatua Rhizosphere | TKVNFNADSNTSYDIVVATLDAMRQDDSGKALFPDVAFSAGIL* |
| Ga0150985_1158545962 | 3300012212 | Avena Fatua Rhizosphere | EETKATFNADANIPYDIVIATLDAMRQGEDGKILFPDVNFAAGIQ* |
| Ga0150984_1160770501 | 3300012469 | Avena Fatua Rhizosphere | TTKLLEIKAIPGNGDETKVNFNADANTSYDIVVATLDAMRQDDAGKVLFPDVAFSAGIL* |
| Ga0150984_1190911363 | 3300012469 | Avena Fatua Rhizosphere | SNPDNAEETKATFNADANIPYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ* |
| Ga0157294_100717303 | 3300012892 | Soil | EATFNADANIPYDIVIATLDAMRTAEDGKILFPDVNFAAGIQ* |
| Ga0157288_103987041 | 3300012901 | Soil | KATFNADANIPYDIVIATLDAMRTAEDGKILFPDVNFAAGIQ* |
| Ga0157308_101245091 | 3300012910 | Soil | YDYKTLTTKLKEIKSNPDNAEETKATFNADANIAYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ* |
| Ga0137359_112378111 | 3300012923 | Vadose Zone Soil | ANVSYDIVVATLDAMRQADDGKILFPDVAFAAGIL* |
| Ga0164298_102796321 | 3300012955 | Soil | IKTNPDNAEETKATFNADAMIPYDIVIATLDAMRQSEEGKILFPDVNFAAGIQ* |
| Ga0164301_114496991 | 3300012960 | Soil | ATFNADANIPYDIVIATLDAMRQSEEGKILFPDVNFAAGIQ* |
| Ga0164302_102031471 | 3300012961 | Soil | ADAMIPYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ* |
| Ga0168317_10288043 | 3300012982 | Weathered Mine Tailings | DANIPYDIVVATLDAMRTDEAGKILFPDVAFAAGIQ* |
| Ga0164304_108854732 | 3300012986 | Soil | KTNPDNAEETKATFNADAMIPYDIVIATLDAMRQSEEGKILFPDVNFAAGIQ* |
| Ga0164306_111757161 | 3300012988 | Soil | NPDNADETKANFNADASTPYDVVIATLDAMRQSEDGKILFPDVNFAAGIQ* |
| Ga0157369_114361232 | 3300013105 | Corn Rhizosphere | NFNADATIPYDIVVATLDAMRQNSDGKVLFPDVAFAAGIL* |
| Ga0157369_125430771 | 3300013105 | Corn Rhizosphere | AETKANFNADANIPYDIVVATLDAMRTDDAGKILFPDVAFAAGIQ* |
| Ga0157372_132806811 | 3300013307 | Corn Rhizosphere | ETKANFNADASTPYDVVIATLDAMRQEEGTGKILFPDVAFAAGIL* |
| Ga0075351_10078981 | 3300014318 | Natural And Restored Wetlands | DANIAYDVVIATLDAMRQADDGKLLFPDVNFAAGIQ* |
| Ga0157380_122802331 | 3300014326 | Switchgrass Rhizosphere | KSNPDNAEETKATFNADANIAYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ* |
| Ga0157377_106844021 | 3300014745 | Miscanthus Rhizosphere | ATFNADANIAYDIVIATLDAMRQAEDGKLLFPDVNFAAGIQ* |
| Ga0173480_104743961 | 3300015200 | Soil | ADETKATFNADANIPYDIVIATLDAMRTAEDGKILFPDVNFAAGIQ* |
| Ga0132256_1025390682 | 3300015372 | Arabidopsis Rhizosphere | SNPDNADETKATFNADANVPYDIVIATLDAMRQGDDGKILFPDVNFAAGIQ* |
| Ga0132257_1018554861 | 3300015373 | Arabidopsis Rhizosphere | DETKATFNADAMIPYDIVIATLDAMRQSEDGKLLFPDVNFAAGIQ* |
| Ga0182036_112083112 | 3300016270 | Soil | TTKLKEIKSNPDNADETKANFNADANTSYDVVIATLDAMRQGDDGKILFPDVAFAAGIL |
| Ga0187765_112806791 | 3300018060 | Tropical Peatland | DNAVETKANFNADAIIPYDVVVATLDAMRTTDEGKILFPDVAFAAGIL |
| Ga0184625_104829101 | 3300018081 | Groundwater Sediment | KALTAKLKEIKGTADAADETKATFNADANIPYDIVIATLDAMRTAEDGKILFPDVNFAAGIQ |
| Ga0184628_100819113 | 3300018083 | Groundwater Sediment | LTAKLKEIKSAPDNADETKATFNADANVPYDVVIATLDAMRQADDGKILFPDVNFAAGIQ |
| Ga0066667_108827161 | 3300018433 | Grasslands Soil | QYNYPALTAKLKEIKSNPDNAEETKANFSADANVPYDVVVATLDAMRQADDGKILFPDVSFAAGI |
| Ga0190270_108260781 | 3300018469 | Soil | KETPDAAGETKATFNADANIPYDIVIPTLDAMRTAEDGKILFPDVNFAAGIQ |
| Ga0190271_124198452 | 3300018481 | Soil | ETKATFNADANIPYDIVIPTLDAMGTAEDGKILFPDVNFAAGIQ |
| Ga0193753_100704662 | 3300020034 | Soil | FNADANIVYDVVVATLDAMRQTDEGKVLFPDVAFAAGIL |
| Ga0210396_103881381 | 3300021180 | Soil | YDYPGLTVKLKEIKSNPDNATETKANFNADASTPYDVVIATLDAMRQEEDGKILFPDVSFAAGIL |
| Ga0210387_100182246 | 3300021405 | Soil | LTTKLKEIKSNPDYATETKANFNADASTSYDIVIATLDAMRQEEDGKILFPDVSFAAGIL |
| Ga0210392_112257522 | 3300021475 | Soil | KSAPDNATETKANFSADANVPYDIVVATLDAMRQTEEGKILFPDISFAAGIL |
| Ga0242648_10299142 | 3300022506 | Soil | VKLKEIKSAPDNAAETKANFSADANIPYDTVIATLDAMRLADDGKILFPDISFAAGIL |
| Ga0242676_10228361 | 3300022512 | Soil | ANFSADANVPYDIVVATLDTMRQTEEGKILFPDISFAAGIL |
| Ga0242670_10288832 | 3300022708 | Soil | TTKLKEIKSNPDYATETKANFNADASTSYDIVIATLDAMRQQEDGKILFPDVSFAAGIL |
| Ga0242670_10418211 | 3300022708 | Soil | DYKSLQVKLKEIKSAPDNATETKANFSADANVPYDIVVATLDTMRQTEEGKILFPDISFAAGIL |
| Ga0242674_10297991 | 3300022711 | Soil | LTTKLKEIKGSTDNADETKATFNADANVPYDIVVATLDAMRTTEDGKALFPDILFAAGIL |
| Ga0242671_10525592 | 3300022714 | Soil | FNADASTSYDIVIATLDAMRQEEDGKILFPDVSFAAGIL |
| Ga0242665_101309451 | 3300022724 | Soil | DYKSLTTKLKEIKSAPDNATETKANFSADANIPYDVVVATLDAMRITDEGKILFPDISFAAGIL |
| Ga0247791_10336652 | 3300023062 | Soil | ETKATFNADAMIPYDIVIATLDAMRQSEEGKILFPDVNFAAGIQ |
| Ga0247802_10480121 | 3300023077 | Soil | FNADAMIPYDIVIATLDAMRQSEEGKILFPDVNFAAGIQ |
| Ga0247794_102576262 | 3300024055 | Soil | AEETKATFNADAMVPYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ |
| Ga0247677_10675271 | 3300024245 | Soil | NVDETKANFNADATIPYDIVVATLDAMRQNSDGKVLFPDVAFAAGIL |
| Ga0247661_11180621 | 3300024254 | Soil | NFNADATIPYDIVVATLDAMRQNSDGKVLFPDVAFAAGIL |
| Ga0208356_10585292 | 3300025504 | Arctic Peat Soil | AKLKEIKSNPENATETKANFNADAATSYDVVIATLDAMRQEDIPGGKILFPDVSFAAGIQ |
| Ga0207692_111313211 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | NPDNADETKANFNADASTPYDVVIATLDAMRQEEGTGKILFPDVAFAAGIL |
| Ga0207700_119513931 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LQEIKGAPGNVDETKANFNADATIPYDIVVATLDAMRQNSDGKVLFPDVAFAAGIL |
| Ga0207701_114575471 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | ETKANFSADANISYDVVVATLDAMRMDDAGKILFPDVAFAAGIL |
| Ga0207686_112781782 | 3300025934 | Miscanthus Rhizosphere | ATFNADAMIPYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ |
| Ga0207670_113014932 | 3300025936 | Switchgrass Rhizosphere | LEIKAIPGNGDETKVNFNADANTSYDIVVATLDAMRQDDSGKVLFPDVAFSAGIL |
| Ga0207689_105899003 | 3300025942 | Miscanthus Rhizosphere | IKSNPDNADETKATFNADANIAYDIVIATLDAMRQAEDGKLLFPDVNFAAGIQ |
| Ga0207679_113817901 | 3300025945 | Corn Rhizosphere | NAEETKATFNADANIPYDIVIATLDAMRQSEEGKLLFPDVNFAAGIQ |
| Ga0207641_116580812 | 3300026088 | Switchgrass Rhizosphere | ETKATFNADANIPYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ |
| Ga0207648_101309674 | 3300026089 | Miscanthus Rhizosphere | KSNPDNADETKATFNADANIAYDIVIATLDAMRQAEDGKLLFPDVNFAAGIQ |
| Ga0209849_10517601 | 3300026215 | Soil | DANTSYDVVIATLDAMRQEDSGKILFPDVSFAAGIL |
| Ga0209863_102344711 | 3300026281 | Prmafrost Soil | GLTAKLKEIKTNPDNATETKANFNADASTPYDVVIATLDAMRQEESGKILFPDVSFAAGI |
| Ga0208685_10306253 | 3300027513 | Soil | TTKLKEIKSNPDNAEETKATFNADANIAYDIVIATLDAMRQAEDGKILFPDVNFAAGIQ |
| Ga0209167_106452391 | 3300027867 | Surface Soil | ETKANFNADATISYDIVVATLDAMRTTDEGKVLFPDVAFAAGIE |
| Ga0209486_113169841 | 3300027886 | Agricultural Soil | GTPDAADETKATFNADANIAYDIVIATLDAMRTAEDGKVLFPDVNFAAGIQ |
| Ga0247685_10245112 | 3300028065 | Soil | TAKLQEIKGAPGNVDETKANFNADATIPYDIVVATLDAMRQNSDGKVLFPDVAFAAGIL |
| Ga0268264_123180131 | 3300028381 | Switchgrass Rhizosphere | VDETKVNFNADSNTSYDIVVATLDAMRQDDNGKALFPDVAFSAGII |
| Ga0265338_110236602 | 3300028800 | Rhizosphere | TVRLLEIKSAPGNADETKVNFNADSTTSYDVVVATLDAMRQDEAGKILFPDVAFSAGIL |
| Ga0311332_113251982 | 3300029984 | Fen | NADANTSYDIVVATLDAMRQDEAGKVLFPDVAFSAGIL |
| Ga0265459_122229051 | 3300030741 | Soil | PDNATETKANFNADAATPYDVVIATLDAMRQEDIPGGKILFPDVSFAAGIQ |
| Ga0308183_10522061 | 3300030988 | Soil | LTAKLKEIKTNPDNAEETKATFNADANIPYDVVIATLDAMRQAEDGKILFPDVNFAAGIQ |
| Ga0308183_10640921 | 3300030988 | Soil | AKLKEIKSSPDNASETKANFSADATVPYEIVVGTLDAMRTTDDGKLLFPDVAFAAGLI |
| Ga0308178_10737472 | 3300030990 | Soil | KLLEIKSSPDNAEETKVNFNADSNVSYDIVVATLDAMRQDDGGKVMFPDVAFSAGIQ |
| Ga0308178_11491092 | 3300030990 | Soil | ANFSADATIPYEVVVATLDAMRISDEGKILFPDVAFAAGIL |
| Ga0170834_1068822572 | 3300031057 | Forest Soil | SNPDNATETKANFNADASTPYDVVIATLDAMRQEEGGKILFPDVSFAAGIL |
| Ga0308180_10365741 | 3300031100 | Soil | TFNADAQIPYDIVVDTLDAMRETPAGKLLFPDVVFSAGIL |
| Ga0308187_102553442 | 3300031114 | Soil | ANVPYEIVVATLDAMRTAPDGKILFPDVAFAAGIL |
| Ga0308195_10735402 | 3300031123 | Soil | NFNADANTSYDIVVATLDAMRQDDNGKVLFPDVAFSAGIL |
| Ga0170824_1171730743 | 3300031231 | Forest Soil | PDNADETKATFNADANIPYDVVIATLDAMRQADDGKILFPDVNFAAGIQ |
| Ga0170824_1275564632 | 3300031231 | Forest Soil | PDNATETKANFNADASTPYDVVIATLDAMRQEEDGKILFPDVSFAAGIL |
| Ga0170820_178259351 | 3300031446 | Forest Soil | QEIKLTPGNAEETKANFNADATIPYDIVVATLDAMRQNNDGKVLFPDVAFAAGIL |
| Ga0170819_110777722 | 3300031469 | Forest Soil | LLEIKSSPENAEETKANFNADANVPYDTVVVTLDAMRQTDAGKVLFPDVAFAAGIQ |
| Ga0170818_1044282603 | 3300031474 | Forest Soil | ANIPYDVVIATLDAMRQAEDGKLLFPDVNFAAGIQ |
| Ga0170818_1121094722 | 3300031474 | Forest Soil | LVEIKSSPENAEETKANFNADANVPYDTVVVTLDAMRQTDAGKVLFPDVAFAAGIL |
| Ga0318541_105754911 | 3300031545 | Soil | DANTSYDVVIATLDAMRQGDDGKILFPDVAFAAGIL |
| Ga0318538_100203661 | 3300031546 | Soil | ANTSYDVVIATLDAMRQGEDGKILFPDVSFAAGIL |
| Ga0265313_100504213 | 3300031595 | Rhizosphere | DNKDETKVNFNADSNTSYDIVVATLDAMRQDDEGRALFPDVAFSAGIL |
| Ga0318555_102289261 | 3300031640 | Soil | LKEIKSNPDNADETKANFNADANTSYDVVIATLDAMRQGDDGKILFPDVAFAAGIL |
| Ga0318517_103859821 | 3300031835 | Soil | ADETKANFNADANTSYDVVIATLDAMRQGDDGKILFPDVAFAAGIL |
| Ga0310906_111399961 | 3300032013 | Soil | SNPDNADETKATFNADAMIPYDIVIATLDAMRQADDGKLLFPDVNFAAGIQ |
| Ga0318577_101896001 | 3300032091 | Soil | IKSNPDNADETKANFNADANTSYDVVIATLDAMRQGEDGKILFPDVSFAAGIL |
| Ga0310812_102823612 | 3300032421 | Soil | TKATFNADAMIPYDIVIATLDAMRQSEEGKILFPDVNFAAGIQ |
| Ga0335082_116661732 | 3300032782 | Soil | YASLTAKLQEIKAAPDNADETKANFNADATIPYDVVVATLDAMRQNNDGKVLFPDVAFAAGIL |
| Ga0335076_111018822 | 3300032955 | Soil | KSNPDNAEETKANFNADANTPYDIVIATLDAMRTAEDGKVLFPDVAFAAGIL |
| Ga0310914_117163632 | 3300033289 | Soil | NFNADANTSYDVVIATLDAMRQGEDGKILFPDVSFAAGIL |
| Ga0318519_103636761 | 3300033290 | Soil | LTAKLKEIKSNPDNADETKANFNADANTSYDVVIATLDAMRQGEDGKILFPDVAFAAGIL |
| Ga0370545_060613_3_176 | 3300034643 | Soil | KLKEIKSSPDNAAETKANFNADAAIPYDIVVATLDAMRTTDEGKVLFPDVAFAAGIL |
| Ga0314792_158243_1_183 | 3300034667 | Soil | LTTKLKEIKSNPDNAEETKATFNADANIPYDVVVATLDAMRQADDGKVLFPDVNFAAGIQ |
| ⦗Top⦘ |