


| Basic Information | |
|---|---|
| Family ID | F055545 |
| Family Type | Metagenome |
| Number of Sequences | 138 |
| Average Sequence Length | 40 residues |
| Representative Sequence | SLKLSTVGGAKVKADVIASHAPNMAHQALNGNLMSGGEH |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.45 % |
| % of genes near scaffold ends (potentially truncated) | 98.55 % |
| % of genes from short scaffolds (< 2000 bps) | 73.91 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.232 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater (37.681 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.536 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (38.406 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF13683 | rve_3 | 2.90 |
| PF12008 | EcoR124_C | 2.17 |
| PF00589 | Phage_integrase | 2.17 |
| PF13358 | DDE_3 | 2.17 |
| PF13340 | DUF4096 | 2.17 |
| PF09334 | tRNA-synt_1g | 1.45 |
| PF02742 | Fe_dep_repr_C | 1.45 |
| PF12728 | HTH_17 | 1.45 |
| PF00005 | ABC_tran | 1.45 |
| PF06226 | DUF1007 | 1.45 |
| PF04963 | Sigma54_CBD | 1.45 |
| PF13362 | Toprim_3 | 0.72 |
| PF00092 | VWA | 0.72 |
| PF04851 | ResIII | 0.72 |
| PF14833 | NAD_binding_11 | 0.72 |
| PF02107 | FlgH | 0.72 |
| PF11972 | HTH_13 | 0.72 |
| PF05016 | ParE_toxin | 0.72 |
| PF00953 | Glycos_transf_4 | 0.72 |
| PF13592 | HTH_33 | 0.72 |
| PF05598 | DUF772 | 0.72 |
| PF09234 | DUF1963 | 0.72 |
| PF00156 | Pribosyltran | 0.72 |
| PF01189 | Methyltr_RsmB-F | 0.72 |
| PF05015 | HigB-like_toxin | 0.72 |
| PF13586 | DDE_Tnp_1_2 | 0.72 |
| PF15515 | MvaI_BcnI | 0.72 |
| PF09346 | SMI1_KNR4 | 0.72 |
| PF13701 | DDE_Tnp_1_4 | 0.72 |
| PF01609 | DDE_Tnp_1 | 0.72 |
| PF00665 | rve | 0.72 |
| PF09722 | Xre_MbcA_ParS_C | 0.72 |
| PF04290 | DctQ | 0.72 |
| PF00012 | HSP70 | 0.72 |
| PF03819 | MazG | 0.72 |
| PF01694 | Rhomboid | 0.72 |
| PF06808 | DctM | 0.72 |
| PF03595 | SLAC1 | 0.72 |
| PF02661 | Fic | 0.72 |
| PF13598 | DUF4139 | 0.72 |
| PF00872 | Transposase_mut | 0.72 |
| PF07969 | Amidohydro_3 | 0.72 |
| PF13614 | AAA_31 | 0.72 |
| PF13337 | BrxL_ATPase | 0.72 |
| PF01381 | HTH_3 | 0.72 |
| PF08448 | PAS_4 | 0.72 |
| PF13264 | DUF4055 | 0.72 |
| PF12849 | PBP_like_2 | 0.72 |
| PF01965 | DJ-1_PfpI | 0.72 |
| PF13936 | HTH_38 | 0.72 |
| PF10124 | Mu-like_gpT | 0.72 |
| PF04221 | RelB | 0.72 |
| PF00462 | Glutaredoxin | 0.72 |
| PF05534 | HicB | 0.72 |
| PF00753 | Lactamase_B | 0.72 |
| PF00468 | Ribosomal_L34 | 0.72 |
| PF07508 | Recombinase | 0.72 |
| PF02899 | Phage_int_SAM_1 | 0.72 |
| PF08530 | PepX_C | 0.72 |
| PF03441 | FAD_binding_7 | 0.72 |
| PF01863 | YgjP-like | 0.72 |
| PF01527 | HTH_Tnp_1 | 0.72 |
| PF01051 | Rep_3 | 0.72 |
| PF12973 | Cupin_7 | 0.72 |
| PF13411 | MerR_1 | 0.72 |
| PF13817 | DDE_Tnp_IS66_C | 0.72 |
| PF07669 | Eco57I | 0.72 |
| PF08378 | NERD | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.45 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.45 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.45 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.45 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.45 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.45 |
| COG1321 | Mn-dependent transcriptional regulator MntR, DtxR family | Transcription [K] | 1.45 |
| COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 1.45 |
| COG3683 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.45 |
| COG0144 | 16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0230 | Ribosomal protein L34 | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0415 | Deoxyribodipyrimidine photolyase | Replication, recombination and repair [L] | 0.72 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG0472 | UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG1275 | Tellurite resistance protein TehA and related permeases | Defense mechanisms [V] | 0.72 |
| COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 0.72 |
| COG1598 | Antitoxin component HicB of the HicAB toxin-antitoxin system | Defense mechanisms [V] | 0.72 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.72 |
| COG2063 | Flagellar basal body L-ring protein FlgH | Cell motility [N] | 0.72 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.72 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.72 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.72 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.72 |
| COG3077 | Antitoxin component of the RelBE or YafQ-DinJ toxin-antitoxin module | Defense mechanisms [V] | 0.72 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.72 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.72 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.72 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.72 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.72 |
| COG3878 | Uncharacterized conserved protein YwqG, DUF1963 family | Function unknown [S] | 0.72 |
| COG4226 | Predicted nuclease of the RNAse H fold, HicB family | General function prediction only [R] | 0.72 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.72 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.72 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.72 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.72 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.72 |
| COG5527 | Protein involved in initiation of plasmid replication | Mobilome: prophages, transposons [X] | 0.72 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.23 % |
| Unclassified | root | N/A | 13.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000365|SL_9KL_010_SEDDRAFT_10001217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 18559 | Open in IMG/M |
| 3300000365|SL_9KL_010_SEDDRAFT_10100104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 1036 | Open in IMG/M |
| 3300001580|Draft_10051307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 2615 | Open in IMG/M |
| 3300003830|Ga0051980_10034152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3478 | Open in IMG/M |
| 3300005590|Ga0070727_10016008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 5127 | Open in IMG/M |
| 3300005590|Ga0070727_10787944 | Not Available | 533 | Open in IMG/M |
| 3300005647|Ga0079203_1164630 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005933|Ga0075118_10228490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HIMB11 | 591 | Open in IMG/M |
| 3300006803|Ga0075467_10061375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. | 2314 | Open in IMG/M |
| 3300006803|Ga0075467_10111697 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300007516|Ga0105050_10025147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 5122 | Open in IMG/M |
| 3300007516|Ga0105050_10047554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudorhodobacter → Pseudorhodobacter ferrugineus | 3157 | Open in IMG/M |
| 3300007516|Ga0105050_10099167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1926 | Open in IMG/M |
| 3300007516|Ga0105050_10101970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. SW2 | 1894 | Open in IMG/M |
| 3300007516|Ga0105050_10109419 | Not Available | 1811 | Open in IMG/M |
| 3300007516|Ga0105050_10111015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1795 | Open in IMG/M |
| 3300007516|Ga0105050_10144752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1524 | Open in IMG/M |
| 3300007516|Ga0105050_10154041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Roseibaca → Roseibaca ekhonensis | 1467 | Open in IMG/M |
| 3300007516|Ga0105050_10351389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 891 | Open in IMG/M |
| 3300007517|Ga0105045_10409768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1006 | Open in IMG/M |
| 3300007517|Ga0105045_11066274 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300007519|Ga0105055_10052647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. SW2 | 4371 | Open in IMG/M |
| 3300007519|Ga0105055_10364438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1290 | Open in IMG/M |
| 3300007519|Ga0105055_10432105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1136 | Open in IMG/M |
| 3300007519|Ga0105055_10663291 | Not Available | 822 | Open in IMG/M |
| 3300007519|Ga0105055_10683279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Roseibaca → Roseibaca ekhonensis | 803 | Open in IMG/M |
| 3300007519|Ga0105055_11181747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300007520|Ga0105054_10173173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2116 | Open in IMG/M |
| 3300007520|Ga0105054_10212898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Octadecabacter | 1847 | Open in IMG/M |
| 3300007521|Ga0105044_10536107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1001 | Open in IMG/M |
| 3300007521|Ga0105044_11196938 | Not Available | 564 | Open in IMG/M |
| 3300007522|Ga0105053_10035870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. SW2 | 5320 | Open in IMG/M |
| 3300007522|Ga0105053_10150065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2316 | Open in IMG/M |
| 3300007522|Ga0105053_10987976 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300007523|Ga0105052_10010427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudorhodobacter → Pseudorhodobacter ferrugineus | 8333 | Open in IMG/M |
| 3300007523|Ga0105052_10020409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 5203 | Open in IMG/M |
| 3300007523|Ga0105052_10104456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1947 | Open in IMG/M |
| 3300007626|Ga0102932_1174995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 800 | Open in IMG/M |
| 3300007722|Ga0105051_10022125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudorhodobacter → Pseudorhodobacter ferrugineus | 5436 | Open in IMG/M |
| 3300007722|Ga0105051_10065273 | All Organisms → cellular organisms → Bacteria | 2886 | Open in IMG/M |
| 3300007723|Ga0102928_1507646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium | 525 | Open in IMG/M |
| 3300007799|Ga0105049_10502682 | Not Available | 903 | Open in IMG/M |
| 3300007799|Ga0105049_10812825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 644 | Open in IMG/M |
| 3300007799|Ga0105049_11137458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCD6228 | 511 | Open in IMG/M |
| 3300007965|Ga0100401_1000857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 25007 | Open in IMG/M |
| 3300007965|Ga0100401_1139051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1094 | Open in IMG/M |
| 3300008005|Ga0100385_1372837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 640 | Open in IMG/M |
| 3300008009|Ga0100394_1123601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1370 | Open in IMG/M |
| 3300008011|Ga0100396_1168489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 866 | Open in IMG/M |
| 3300008020|Ga0100398_1298871 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300008086|Ga0100388_10291711 | Not Available | 803 | Open in IMG/M |
| 3300009032|Ga0105048_10645509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1005 | Open in IMG/M |
| 3300009032|Ga0105048_11478149 | Not Available | 531 | Open in IMG/M |
| 3300009083|Ga0105047_11437882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCD6228 | 519 | Open in IMG/M |
| 3300009084|Ga0105046_11040215 | Not Available | 664 | Open in IMG/M |
| 3300009508|Ga0115567_10352350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 913 | Open in IMG/M |
| 3300010392|Ga0118731_108618822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 8276 | Open in IMG/M |
| 3300010392|Ga0118731_111688256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 4928 | Open in IMG/M |
| 3300010430|Ga0118733_100190301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 4077 | Open in IMG/M |
| 3300010883|Ga0133547_11666656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1187 | Open in IMG/M |
| 3300011012|Ga0150979_1055816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Planktomarina → Planktomarina temperata → Planktomarina temperata RCA23 | 638 | Open in IMG/M |
| 3300011188|Ga0136587_1025846 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300011188|Ga0136587_1180410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 550 | Open in IMG/M |
| 3300012036|Ga0136600_1138131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Roseibaca → Roseibaca ekhonensis | 539 | Open in IMG/M |
| 3300012036|Ga0136600_1158311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium 17-64-5 | 500 | Open in IMG/M |
| 3300012170|Ga0136598_1001453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 9772 | Open in IMG/M |
| 3300013097|Ga0136639_10305046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300017756|Ga0181382_1012747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Phaeobacter | 2800 | Open in IMG/M |
| 3300017756|Ga0181382_1077426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 922 | Open in IMG/M |
| 3300017756|Ga0181382_1103425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sulfitobacter | 770 | Open in IMG/M |
| 3300020219|Ga0163146_10266483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1026 | Open in IMG/M |
| 3300021375|Ga0213869_10324202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Thalassobacter → unclassified Thalassobacter → Thalassobacter sp. 16PALIMAR09 | 650 | Open in IMG/M |
| 3300021378|Ga0213861_10391231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 686 | Open in IMG/M |
| 3300021389|Ga0213868_10441605 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300022413|Ga0224508_10779188 | Not Available | 583 | Open in IMG/M |
| 3300023054|Ga0222648_1048502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Yoonia → Yoonia vestfoldensis | 908 | Open in IMG/M |
| 3300023243|Ga0222630_1069511 | Not Available | 668 | Open in IMG/M |
| 3300023429|Ga0222710_1037534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Yoonia → Yoonia vestfoldensis | 832 | Open in IMG/M |
| 3300025767|Ga0209137_1155321 | Not Available | 825 | Open in IMG/M |
| 3300025831|Ga0210015_1126005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 999 | Open in IMG/M |
| 3300025868|Ga0210051_1177734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1002 | Open in IMG/M |
| 3300025881|Ga0209309_10297443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 729 | Open in IMG/M |
| 3300025887|Ga0208544_10200247 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300026156|Ga0209936_1059440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1194 | Open in IMG/M |
| 3300026367|Ga0163215_115088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 876 | Open in IMG/M |
| 3300027554|Ga0209831_1179975 | Not Available | 528 | Open in IMG/M |
| 3300027832|Ga0209491_10017178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 7915 | Open in IMG/M |
| 3300027832|Ga0209491_10167734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1945 | Open in IMG/M |
| 3300027832|Ga0209491_10489986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 812 | Open in IMG/M |
| 3300027834|Ga0209344_10361152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 683 | Open in IMG/M |
| 3300027848|Ga0209390_10026421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5996 | Open in IMG/M |
| 3300027848|Ga0209390_10096243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2817 | Open in IMG/M |
| 3300027850|Ga0209591_10218793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudorhodobacter → Pseudorhodobacter antarcticus | 1500 | Open in IMG/M |
| 3300027976|Ga0209702_10090870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Roseibaca → Roseibaca ekhonensis | 1470 | Open in IMG/M |
| 3300027976|Ga0209702_10240049 | Not Available | 756 | Open in IMG/M |
| 3300027976|Ga0209702_10272010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Roseibaca → Roseibaca ekhonensis | 696 | Open in IMG/M |
| 3300027983|Ga0209284_10193714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1056 | Open in IMG/M |
| 3300027983|Ga0209284_10212817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Roseibaca → Roseibaca ekhonensis | 999 | Open in IMG/M |
| 3300028376|Ga0306912_1010574 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
| 3300028598|Ga0265306_10157089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Tateyamaria | 1195 | Open in IMG/M |
| 3300031208|Ga0307931_1056101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 804 | Open in IMG/M |
| 3300031213|Ga0307937_1042432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1000 | Open in IMG/M |
| 3300031213|Ga0307937_1090939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300031217|Ga0307940_1004491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. MCTG156(2b) | 5625 | Open in IMG/M |
| 3300031217|Ga0307940_1006421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudorhodobacter → Pseudorhodobacter antarcticus | 4217 | Open in IMG/M |
| 3300031220|Ga0307939_1005083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 4901 | Open in IMG/M |
| 3300031220|Ga0307939_1055551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 892 | Open in IMG/M |
| 3300031221|Ga0307948_1056070 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300031221|Ga0307948_1067383 | Not Available | 1460 | Open in IMG/M |
| 3300031223|Ga0307981_1001062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 25940 | Open in IMG/M |
| 3300031223|Ga0307981_1001741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 18813 | Open in IMG/M |
| 3300031329|Ga0307934_1066536 | Not Available | 949 | Open in IMG/M |
| 3300031335|Ga0307951_1078496 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300031339|Ga0307932_1013831 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
| 3300031382|Ga0307971_1205576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300031392|Ga0307975_1128408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 890 | Open in IMG/M |
| 3300031394|Ga0307963_1104499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Roseibaca → Roseibaca ekhonensis | 860 | Open in IMG/M |
| 3300031396|Ga0307944_1082481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 860 | Open in IMG/M |
| 3300031397|Ga0307960_1052832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → Ruegeria arenilitoris | 1626 | Open in IMG/M |
| 3300031397|Ga0307960_1089833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1009 | Open in IMG/M |
| 3300031397|Ga0307960_1111097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Roseibaca → Roseibaca ekhonensis | 832 | Open in IMG/M |
| 3300031398|Ga0307979_1023382 | All Organisms → cellular organisms → Bacteria | 2231 | Open in IMG/M |
| 3300031403|Ga0307933_1047491 | Not Available | 1434 | Open in IMG/M |
| 3300031403|Ga0307933_1065296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1142 | Open in IMG/M |
| 3300031600|Ga0307930_1017838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3168 | Open in IMG/M |
| 3300031607|Ga0307966_1018819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → Roseovarius nanhaiticus | 4755 | Open in IMG/M |
| 3300031607|Ga0307966_1166277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 960 | Open in IMG/M |
| 3300031613|Ga0307978_1019942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 3589 | Open in IMG/M |
| 3300031613|Ga0307978_1066281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1327 | Open in IMG/M |
| 3300031613|Ga0307978_1107084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 855 | Open in IMG/M |
| 3300031625|Ga0302135_10190506 | Not Available | 904 | Open in IMG/M |
| 3300032272|Ga0316189_10542894 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300032431|Ga0335395_10578592 | Not Available | 705 | Open in IMG/M |
| 3300032431|Ga0335395_10764778 | Not Available | 569 | Open in IMG/M |
| 3300032435|Ga0335398_10667370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Roseibaca → Roseibaca ekhonensis | 682 | Open in IMG/M |
| 3300032462|Ga0335396_10423349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 855 | Open in IMG/M |
| 3300032462|Ga0335396_10840533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Roseibaca → Roseibaca ekhonensis | 548 | Open in IMG/M |
| 3300033163|Ga0334899_1008344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 5255 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 37.68% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 23.91% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 5.80% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 4.35% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.17% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.17% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.17% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.17% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 2.17% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.45% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.45% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.45% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.45% |
| Alkaline Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment | 1.45% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.72% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.72% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.72% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.72% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.72% |
| Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine | 0.72% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.72% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.72% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.72% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.72% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.72% |
| Marine | Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine | 0.72% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.72% |
| Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000365 | Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 9KL_010_SED | Environmental | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300003830 | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 3 um filter | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005647 | Marine algae microbial communities from Bantry Bay - Bantry Bay, Ireland | Environmental | Open in IMG/M |
| 3300005933 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007517 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007519 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 | Environmental | Open in IMG/M |
| 3300007520 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300007522 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007626 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_C_D2_MG | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007723 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_D1_MG | Environmental | Open in IMG/M |
| 3300007799 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 | Environmental | Open in IMG/M |
| 3300007965 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-25 | Environmental | Open in IMG/M |
| 3300008005 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-09 | Environmental | Open in IMG/M |
| 3300008009 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-18 | Environmental | Open in IMG/M |
| 3300008011 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-20 | Environmental | Open in IMG/M |
| 3300008020 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-22 | Environmental | Open in IMG/M |
| 3300008086 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-12 | Environmental | Open in IMG/M |
| 3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
| 3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009084 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011012 | Marine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs | Environmental | Open in IMG/M |
| 3300011188 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 1 #563 | Environmental | Open in IMG/M |
| 3300012036 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698 | Environmental | Open in IMG/M |
| 3300012170 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #899 | Environmental | Open in IMG/M |
| 3300013097 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ859 (21.06) | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300020219 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP7.G1 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300022413 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300023054 | Saline water microbial communities from Ace Lake, Antarctica - #335 | Environmental | Open in IMG/M |
| 3300023243 | Saline water microbial communities from Ace Lake, Antarctica - #3 | Environmental | Open in IMG/M |
| 3300023429 | Saline water microbial communities from Ace Lake, Antarctica - #1696 | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025831 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-22 (SPAdes) | Environmental | Open in IMG/M |
| 3300025868 | Groundwater microbial communities from aquifer - Crystal Geyser CG23_combo_of_CG06-09_8/20/14_all (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026156 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_A_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026367 | Saline lake microbial communities from Ace Lake in Antarctica - Synechococcus sp. Ace-P (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300027554 | Marine algal microbial communities from Maine, USA - Maine_Asex4_metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027832 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027834 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027848 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027983 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes) | Environmental | Open in IMG/M |
| 3300028376 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla E10 #628 (v2) | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031208 | Saline water microbial communities from Organic Lake, Antarctica - #47 | Environmental | Open in IMG/M |
| 3300031213 | Saline water microbial communities from Organic Lake, Antarctica - #3 | Environmental | Open in IMG/M |
| 3300031217 | Saline water microbial communities from Organic Lake, Antarctica - #124 | Environmental | Open in IMG/M |
| 3300031220 | Saline water microbial communities from Organic Lake, Antarctica - #122 | Environmental | Open in IMG/M |
| 3300031221 | Saline water microbial communities from Organic Lake, Antarctica - #280 | Environmental | Open in IMG/M |
| 3300031223 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #987 | Environmental | Open in IMG/M |
| 3300031329 | Saline water microbial communities from Organic Lake, Antarctica - #90 | Environmental | Open in IMG/M |
| 3300031335 | Saline water microbial communities from Organic Lake, Antarctica - #374 | Environmental | Open in IMG/M |
| 3300031339 | Saline water microbial communities from Organic Lake, Antarctica - #48 | Environmental | Open in IMG/M |
| 3300031382 | Saline water microbial communities from Organic Lake, Antarctica - #714 | Environmental | Open in IMG/M |
| 3300031392 | Saline water microbial communities from Organic Lake, Antarctica - #917 | Environmental | Open in IMG/M |
| 3300031394 | Saline water microbial communities from Organic Lake, Antarctica - #594 | Environmental | Open in IMG/M |
| 3300031396 | Saline water microbial communities from Organic Lake, Antarctica - #179 | Environmental | Open in IMG/M |
| 3300031397 | Saline water microbial communities from Organic Lake, Antarctica - #542 | Environmental | Open in IMG/M |
| 3300031398 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1058 | Environmental | Open in IMG/M |
| 3300031403 | Saline water microbial communities from Organic Lake, Antarctica - #88 | Environmental | Open in IMG/M |
| 3300031600 | Saline water microbial communities from Organic Lake, Antarctica - #46 | Environmental | Open in IMG/M |
| 3300031607 | Saline water microbial communities from Organic Lake, Antarctica - #646 | Environmental | Open in IMG/M |
| 3300031613 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1056 | Environmental | Open in IMG/M |
| 3300031625 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_surface | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300032431 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300032435 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 (spades assembly) | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300033163 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_8_08-R3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SL_9KL_010_SEDDRAFT_100012171 | 3300000365 | Alkaline Sediment | ARRVAVGHQSFKLSTVGRAKIKADVRASHALGMTHPDTIGNLVSGGEH* |
| SL_9KL_010_SEDDRAFT_101001041 | 3300000365 | Alkaline Sediment | QLARRIAVGHQSFKLSTVGGAKIKADVGASHALSMTHPDTIGNLVSGGEH* |
| Draft_100513071 | 3300001580 | Hydrocarbon Resource Environments | LKFGAVGGAKIKADVITSHAQGMTHPTAVGNHLSGDEH* |
| Ga0051980_100341521 | 3300003830 | Groundwater | VAVGEQSLKLSTVGGAKVKADVITSHTPNMAHQAAVGNLASGGKH* |
| Ga0070727_100160086 | 3300005590 | Marine Sediment | LKLSTFGGAKEKADVIASHQMGMARQRALGNLMSGGEH* |
| Ga0070727_107879442 | 3300005590 | Marine Sediment | LSTFGGAKEKADVIASHQMGMARQRALGNLMSGGEH* |
| Ga0079203_11646301 | 3300005647 | Marine | GLKLRSLGGAKVKADAIASHATNIAQRVAVGNRPSGGEH* |
| Ga0075118_102284902 | 3300005933 | Saline Lake | STVGGAKVKADVIASHAPNMAHQALNGNPVSGGEH* |
| Ga0075467_100613753 | 3300006803 | Aqueous | VAVGDLGLKPRSLGGAKVKADVIASHATNIAHRANIGNRPSGVEH* |
| Ga0075467_101116974 | 3300006803 | Aqueous | GLKPRSLGGAKVKADVIASHATNIAHRADIGNRPSGVEH* |
| Ga0105050_100251478 | 3300007516 | Freshwater | SFKLSTVSGAKVKADVITSHATNMAQQALNGNPALGGEH* |
| Ga0105050_100475541 | 3300007516 | Freshwater | VGDQSLKLSTVGGAKVKADVIASHAPNMAHQALNGNPLSGGEH* |
| Ga0105050_100991671 | 3300007516 | Freshwater | QSLKLSTVGGAKVKADVIASHAPNMAHQAFNGNPVSGGEH* |
| Ga0105050_101019705 | 3300007516 | Freshwater | QNLKFSTVGGARVKADVTASDAPGMAHQAALGKLVSGG* |
| Ga0105050_101094191 | 3300007516 | Freshwater | SLKLSTVGGAKVKANIIASHAPNMAHQAINGNPMLGGEH* |
| Ga0105050_101110151 | 3300007516 | Freshwater | KSWDLHKTSLKLSTVGGAKVKADVIASHAPNMAHQALNGNLMSGGEH* |
| Ga0105050_101447521 | 3300007516 | Freshwater | KSWDLHKTSLKLSTVGGAKVKADVIASHAPNMAHQALNGNPVSGGEH* |
| Ga0105050_101540414 | 3300007516 | Freshwater | QSLKLSTVGGAKVKANIIASHAPNMAHQAINGNPMLGGEH* |
| Ga0105050_103513891 | 3300007516 | Freshwater | QSLKLSTVGGAKVKADVIASHAPNMAHQALNGNPVSGGEQ* |
| Ga0105045_104097683 | 3300007517 | Freshwater | GDKSFKLNTVGGAKVKADVIASQTPHMARQAIKGSPVSGGEH* |
| Ga0105045_110662741 | 3300007517 | Freshwater | KAVGGAKAEADIIAYHPPNMAHQALDRNPVSGGER* |
| Ga0105055_100526477 | 3300007519 | Freshwater | FKLSTVSGAKVKADVITSHATNMAQQALNGNPALGGEH* |
| Ga0105055_103644383 | 3300007519 | Freshwater | TVGGAKVKADVIASHAPNMAHQALNGNPVSGGEH* |
| Ga0105055_104321053 | 3300007519 | Freshwater | TVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEH* |
| Ga0105055_106632911 | 3300007519 | Freshwater | KTSLKLSTVGGAKVKADVIASHAPNMAHQALNGNLMSGGEH* |
| Ga0105055_106832793 | 3300007519 | Freshwater | VALVSHKSWDLHKTSLKLSTVGGAKVKADVIASHAPNMAHQALNGNPLSGGER* |
| Ga0105055_111817471 | 3300007519 | Freshwater | LLKLSTVGGAKAKANVIASHAPNIEHQALDGNPVSGGKHKAAL* |
| Ga0105054_101731734 | 3300007520 | Freshwater | DQSLKLSTVGGAKVKADVIASHTPNVAQQALNGNPVSGGKR* |
| Ga0105054_102128981 | 3300007520 | Freshwater | TSLKLSTVGGAKVKADVIASHAPNMAHQALNGNPVSGGEH* |
| Ga0105044_105361072 | 3300007521 | Freshwater | DQSLKLRAVGGAKVKADVIASHAPNMAHQTLNGNPLSGGEH* |
| Ga0105044_111969382 | 3300007521 | Freshwater | SFKLGAVGGAKVKADVIASHAPNMAHQALDGNPASGGEH* |
| Ga0105053_100358701 | 3300007522 | Freshwater | KLSTVSGAKVKADVITSHATNMAQQALNGNPALGGEH* |
| Ga0105053_101500651 | 3300007522 | Freshwater | LSTVGGAKVKANIIASHAPNMAHQAINGNPMLGGEH* |
| Ga0105053_109879763 | 3300007522 | Freshwater | GDQSLKLSTVGGAKVKANVIASHAPNMAHQALNGNPVSGGEH* |
| Ga0105052_100104279 | 3300007523 | Freshwater | DQSLKLSTVGGAKVKADVIASHAPNMAHQALNGNPLSGGEH* |
| Ga0105052_100204099 | 3300007523 | Freshwater | DQSLKLSTVGGAKVKADVIASHAPNMAHQALNGNPLSGGEQ* |
| Ga0105052_101044561 | 3300007523 | Freshwater | AVGDQSLKLSTVGGAKVKADVIASHAPNMAHQALNGNPVSGWEH* |
| Ga0102932_11749951 | 3300007626 | Pond Soil | LKLSTVGGAKVKADVGTSHARNVAHQAADGNPVSCGEH* |
| Ga0105051_100221251 | 3300007722 | Freshwater | SLKLSTVGGAKVKADVIASHAPNMAHQALNGNLMSGGEH* |
| Ga0105051_100652731 | 3300007722 | Freshwater | VGDQSLKLSTVGGAKVKANVIASHAPNMAHQALNGNPVSGGEH* |
| Ga0102928_15076461 | 3300007723 | Pond Soil | LLKLRTVGGAKVKADVIASHAPNIAHRAANGNLVSGGEH* |
| Ga0105049_105026822 | 3300007799 | Freshwater | QSLKLRAVGGAKVKADVIASHAPNMAHQTLNGNPLSGGEH* |
| Ga0105049_108128251 | 3300007799 | Freshwater | VGDQSFKLSAVGGAKVKADVIASHTPNKAHQTSDGNPLSGGEH* |
| Ga0105049_111374581 | 3300007799 | Freshwater | QSFKLSAVGGAKVKADVIASHAPNMAHQALDGNPASGGEH* |
| Ga0100401_100085731 | 3300007965 | Aquifer | QRLKLSTVGGAKVKADVIASHTPNMAHQVTEGNLVSGGEH* |
| Ga0100401_11390513 | 3300007965 | Aquifer | LKLSTVGGAKVKADVIASHTPNMAHQVTEGNLVSGGEH* |
| Ga0100385_13728371 | 3300008005 | Aquifer | SLKLCTVGGAKVKADVGASHAQGLTHPAAIRNLVSGGEH* |
| Ga0100394_11236014 | 3300008009 | Aquifer | AVGDQSLKLCTVGGAKVKADVGASHAPTLTHLTRNGNLLSGGEH* |
| Ga0100396_11684893 | 3300008011 | Aquifer | EQRFELRTVGGAKIKADVIASHASTLTHLTRNGNLLSGGEH* |
| Ga0100398_12988711 | 3300008020 | Aquifer | QGLQLSTVGGAKVKADVIASHTPNMAHQVHNGNLMSGDEH* |
| Ga0100388_102917111 | 3300008086 | Aquifer | FELRTVGGAKIKADVIASHASTLTHLTRNGNLLSGGEH* |
| Ga0105048_106455091 | 3300009032 | Freshwater | LKFSTVGGAKVKADVIASHAPSMAHQAALGNLMSGGEH* |
| Ga0105048_114781491 | 3300009032 | Freshwater | KLSTVGGAKVKADVIASHAPNMAHQALNGNPVSGGEH* |
| Ga0105047_114378821 | 3300009083 | Freshwater | IGEQSFKLSAVGGAKVKADVIASHAPNMAHQALDGNPASGGEH* |
| Ga0105046_110402151 | 3300009084 | Freshwater | RAFSTVGGAKVKADVIASHAPNMAHKSFYGNPVSGG* |
| Ga0115567_103523501 | 3300009508 | Pelagic Marine | GTVGGAKVKADVITSHARNMAHQIKVGNLMSGGQK* |
| Ga0118731_10861882211 | 3300010392 | Marine | DQSLKLSTFGGAKEKADVIASHQMGMARQRALGNLMSGGEH* |
| Ga0118731_1116882561 | 3300010392 | Marine | QSLKLSTFGGAKEKADVIASHQMGMARQRALGNLMSGGEH* |
| Ga0118733_1001903011 | 3300010430 | Marine Sediment | SLKLSTFGGAKEKADVIASHQMGMARQRALGNLMSGGEH* |
| Ga0133547_116666562 | 3300010883 | Marine | LSTLGGAKVKADVIASHPKGMKRQRTLGNLMSGGEH* |
| Ga0150979_10558162 | 3300011012 | Marine | AWSVAVSHQSFKLSTVGGAKTKADVGASHAPNIAHQTDVGNLMSGGEH* |
| Ga0136587_10258462 | 3300011188 | Saline Lake | AVGDQSLKLSTVGGAKVKANIIASHAPNMEDQALNGNPVSGGEH* |
| Ga0136587_11804101 | 3300011188 | Saline Lake | TVGGAKVKANVIASHVPNMAHQALNRNPPSGGEY* |
| Ga0136600_11381311 | 3300012036 | Saline Lake | LSTVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEQ* |
| Ga0136600_11583111 | 3300012036 | Saline Lake | SLKLSTVGGAKVKANVIASHAPNMAQKTLNGNPVSGGEH* |
| Ga0136598_100145315 | 3300012170 | Saline Lake | VAIDDQSLKLSTVGGAKVQANVITSHAPNMAHQVRNGNPMSRGEH* |
| Ga0136639_103050462 | 3300013097 | Polar Desert Sand | FKLSAVGGAKVKASVIASHAPNMARQALNGDPASGGEH* |
| Ga0181382_10127471 | 3300017756 | Seawater | QGLKLGTVGGARIKADVIASHAPNMAHHSADGNHLSGGEH |
| Ga0181382_10774261 | 3300017756 | Seawater | QGLKFSTVGGAKVKADVIASHAPNMAHHVADGNHLSGGEH |
| Ga0181382_11034251 | 3300017756 | Seawater | RSVAVADQGLKLSTVGGAKVKADVMASHASNMAHHVADGNLLSGGEH |
| Ga0163146_102664834 | 3300020219 | Freshwater Microbial Mat | QSLKLRAVGGAKVKADVIASHAPNRAHKSLNGNPLSGGEH |
| Ga0213869_103242021 | 3300021375 | Seawater | LGSIGGAKVKADVIASHARNVAHQAANGNLMSGGEH |
| Ga0213861_103912311 | 3300021378 | Seawater | LQSFKLGSIGGAKVKADVIASHARNVAHQAANGNLMSGGEH |
| Ga0213868_104416051 | 3300021389 | Seawater | QSLKLSTGGGAKVKADIIASHARNMARQRPLGNLMSGGEH |
| Ga0224508_107791881 | 3300022413 | Sediment | DGFEPDPVGRAHVKADVIASHAPSLIDLQADGNPLSGGEH |
| Ga0222648_10485022 | 3300023054 | Saline Water | SWDLHKTSLKLNTVGGAKVKADVIASHAPNMAHQALNGNPVSGGEH |
| Ga0222630_10695112 | 3300023243 | Saline Water | EQSLKLSTVGGAKVKADVFASHAPSMAHQAALGNLMSGGEH |
| Ga0222710_10375342 | 3300023429 | Saline Water | LHKTSLKLNTVGGAKVKADVIASHAPNMAHQALNGNPVSGGEH |
| Ga0209137_11553211 | 3300025767 | Marine | RSLGGAKVKADVIASHATNIAQRVAVGNLLSGGEH |
| Ga0210015_11260052 | 3300025831 | Aquifer | QRLKLSTVGGAKVKADVIASHTPNMAHQVTEGNLVSGGEH |
| Ga0210051_11777341 | 3300025868 | Groundwater | ELRTVGGAKIKADVIASHASTLTHLTRNGNLLSGGEH |
| Ga0209309_102974433 | 3300025881 | Pelagic Marine | VSTVGTVGGAKVKADIITSHARNMAHQIKVGNLMSGGQQ |
| Ga0208544_102002472 | 3300025887 | Aqueous | DLGLKPRSLGGAKVKADVIASHVTNIAHRADIGNRPSGVEH |
| Ga0209936_10594404 | 3300026156 | Pond Soil | QLLKLRTVGGAKVKADVIASHAPNIAHRAANGNLVSGGEH |
| Ga0163215_1150883 | 3300026367 | Saline Lake | KLSTVGGAKVKADVIASHAPNMAHQALNGNPVSGGEH |
| Ga0209831_11799752 | 3300027554 | Marine | GDQGLKLRSLGGAKVKADVIASHATNIAQRVAVGNRPSGGEQ |
| Ga0209491_100171781 | 3300027832 | Freshwater | FKLSTVSGAKVKADVITSHATNMAQQALNGNPALGGEH |
| Ga0209491_101677341 | 3300027832 | Freshwater | SFKLSTVSGAKVKADVITSHATNMAQQALNGNPALGGEH |
| Ga0209491_104899862 | 3300027832 | Freshwater | LNTVGGAKVKADVIASHAPNMAHQALNGNPVSGGEH |
| Ga0209344_103611522 | 3300027834 | Marine | DQSLKLSTIGGAKIKADVGASHAPNIAHQFNVGNLVSGGQH |
| Ga0209390_100264211 | 3300027848 | Freshwater | RVAVGDQSLKLSTVGGAKVKADVITSHAPSTAYQTDLGNLMSGGEH |
| Ga0209390_100962431 | 3300027848 | Freshwater | LSTVGGAKVKANIIASHAPNMAHQAINGNPMLGGEH |
| Ga0209591_102187931 | 3300027850 | Freshwater | RAFSTVGGAKVKADVIASHAPNMAHKSFYGNPVSGG |
| Ga0209702_100908701 | 3300027976 | Freshwater | DQSLKLSTVGGAKVKANIIASHAPNMAHQAINGNPMLGGEH |
| Ga0209702_102400492 | 3300027976 | Freshwater | NLKFSTVGGAKVKADVFASHAPSMAHQATLGNLMSRGEH |
| Ga0209702_102720103 | 3300027976 | Freshwater | STVGGAKVKADVIASHAPYMAHQALNGNPVSGGEH |
| Ga0209284_101937144 | 3300027983 | Freshwater | SLKLSTVGGAKVKANVIASHAPNMAHQALNGNPLSGGER |
| Ga0209284_102128171 | 3300027983 | Freshwater | STVGGAKVKADVIASHAPNMAHQALNGNPVSGWEH |
| Ga0306912_10105741 | 3300028376 | Saline Lake | SLKLSTVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEQ |
| Ga0265306_101570891 | 3300028598 | Sediment | DQGLKLRSVGGAKVKADVSASHIPNMAHKLNRGNLASGGQH |
| Ga0307931_10561012 | 3300031208 | Saline Water | MSRGVAVADQRLKLSTVGGAKVKADVIASHAPNMAYRAADGNFVSGGEH |
| Ga0307937_10424322 | 3300031213 | Saline Water | QSLKLSTVGGAKVKANVIASHAPNMAQKTLNGNPVSGGEH |
| Ga0307937_10909391 | 3300031213 | Saline Water | GTVSGAKKKADVIASHTPNMAHQAVDGNPMSGGEH |
| Ga0307940_10044911 | 3300031217 | Saline Water | DQSLKLSTVGGAKVKANVIASHAPNMAQKTLNGNPVSGGEH |
| Ga0307940_10064211 | 3300031217 | Saline Water | SLKLSTVGGAKVKANVIASHAPNMAQKTLNGNPVSGGEH |
| Ga0307939_10050831 | 3300031220 | Saline Water | DDQSLKLSTVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEQ |
| Ga0307939_10555511 | 3300031220 | Saline Water | DDQSLKLSTVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEH |
| Ga0307948_10560701 | 3300031221 | Saline Water | DQGLKLSTVGGAKVKADVIASHAPNMAHYVADGNLLSGAEH |
| Ga0307948_10673831 | 3300031221 | Saline Water | QCFKLSAVGGAKVKAVVIASHTPNMAHQAFYGNPASGGEL |
| Ga0307981_10010621 | 3300031223 | Saline Water | ADLGLKLSTVGGAKVKADVIASHAPNMAHHVADGNLLSGGEQ |
| Ga0307981_100174123 | 3300031223 | Saline Water | DLGLKLSTVGGAKVKADVIASHAPNMAHHVADGNLLSGGEH |
| Ga0307934_10665362 | 3300031329 | Saline Water | CFKLSAVGGAKVKAVVIASHTPNMAHQAFYGNPASGGEL |
| Ga0307951_10784964 | 3300031335 | Saline Water | STVGGAKVKANVIASHAPNMAQKTLNGNPVSGGEH |
| Ga0307932_10138311 | 3300031339 | Saline Water | STVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEQ |
| Ga0307971_12055761 | 3300031382 | Saline Water | LKLSTVGGAKVKANVIASHAPNMAQKTLNGNPVSGGEH |
| Ga0307975_11284083 | 3300031392 | Saline Water | DQSLKLSTVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEH |
| Ga0307963_11044991 | 3300031394 | Saline Water | QSLKLSTVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEQ |
| Ga0307944_10824813 | 3300031396 | Saline Water | SLKLSTVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEH |
| Ga0307960_10528321 | 3300031397 | Saline Water | SVAIDDQSLKLSTVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEH |
| Ga0307960_10898332 | 3300031397 | Saline Water | DQSLKLSTVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEQ |
| Ga0307960_11110972 | 3300031397 | Saline Water | LSTVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEH |
| Ga0307979_10233821 | 3300031398 | Saline Water | LKLSTVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEQ |
| Ga0307933_10474911 | 3300031403 | Saline Water | DQCFKLSAVGGAKVKAVVIASHTPNMAHQAFYGNPASGGEL |
| Ga0307933_10652961 | 3300031403 | Saline Water | CFKLSAVGGAKVKAVVIASHTPNMAHQAFYGNPASGGEH |
| Ga0307930_10178381 | 3300031600 | Saline Water | MSRGVAVADQRLKLSTVGGAKVKADVIASHAPNMAYRAADGNLVSGGEH |
| Ga0307966_10188198 | 3300031607 | Saline Water | KLARSVAIDDQSLKLSTVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEH |
| Ga0307966_11662772 | 3300031607 | Saline Water | VGDQCFKLSAVGGAKVKAVVIASHTPNMAHQAFYGNPASGGEH |
| Ga0307978_10199421 | 3300031613 | Saline Water | ARSVAIDDQSLKLSTVGGAKVQANVITSHAPNTANQVRNGNPMSGGEH |
| Ga0307978_10662811 | 3300031613 | Saline Water | AIDDQSLKLSTVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEH |
| Ga0307978_11070842 | 3300031613 | Saline Water | LKLSTVGGAKVQANVITSHAPNMAHQVRNGNPMSGGEH |
| Ga0302135_101905061 | 3300031625 | Marine | SLKLSTLGGAKVKADVIASHPKSMTRQRALGNLMSGGEH |
| Ga0316189_105428942 | 3300032272 | Worm Burrow | EESLKLGTVGGAKVKADVGASHAPYMAYQAADGNLVSGGEHWCSAPDT |
| Ga0335395_105785921 | 3300032431 | Freshwater | KLSTVGEAKVKANIIASHAPNMAHQAINGNPALGGEH |
| Ga0335395_107647782 | 3300032431 | Freshwater | QLSAVGGAKVKANVIASHAPSMAHQAALGNLMSGGEH |
| Ga0335398_106673701 | 3300032435 | Freshwater | DLHKTSLKLSTVGGAKVKADVIASHAPNMAHQALNGNPLSGGER |
| Ga0335396_104233491 | 3300032462 | Freshwater | QNLKFSTVGGAKVKANIIASHAPNMAHQAINGNPMLGGEH |
| Ga0335396_108405332 | 3300032462 | Freshwater | STVGGAKVKADVIASHAPNMAHQALNGNPVSGGEH |
| Ga0334899_10083448 | 3300033163 | Sludge | SFKLSTLGGAKIKADVGASHAPNIAHQTDVGNLMSGGEH |
| ⦗Top⦘ |