


| Basic Information | |
|---|---|
| Family ID | F055519 |
| Family Type | Metagenome |
| Number of Sequences | 138 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MAKGKGGGSYPNPKGHTGPKTQFPQARRPPSAVVPRVVARTKASPKGR |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.54 % |
| % of genes near scaffold ends (potentially truncated) | 33.33 % |
| % of genes from short scaffolds (< 2000 bps) | 78.99 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.12 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.580 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (18.841 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.681 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.957 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.12 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF03547 | Mem_trans | 21.74 |
| PF00571 | CBS | 10.87 |
| PF00856 | SET | 5.07 |
| PF00271 | Helicase_C | 2.90 |
| PF16980 | CitMHS_2 | 2.90 |
| PF00756 | Esterase | 2.17 |
| PF00291 | PALP | 2.17 |
| PF07152 | YaeQ | 1.45 |
| PF12688 | TPR_5 | 1.45 |
| PF03976 | PPK2 | 1.45 |
| PF04228 | Zn_peptidase | 1.45 |
| PF00753 | Lactamase_B | 1.45 |
| PF03928 | HbpS-like | 1.45 |
| PF00578 | AhpC-TSA | 0.72 |
| PF01738 | DLH | 0.72 |
| PF00528 | BPD_transp_1 | 0.72 |
| PF03600 | CitMHS | 0.72 |
| PF00437 | T2SSE | 0.72 |
| PF01625 | PMSR | 0.72 |
| PF00202 | Aminotran_3 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0679 | Predicted permease, AEC (auxin efflux carrier) family | General function prediction only [R] | 21.74 |
| COG2321 | Predicted metalloprotease | General function prediction only [R] | 1.45 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 1.45 |
| COG4681 | Uncharacterized conserved protein YaeQ, suppresses RfaH defect | Function unknown [S] | 1.45 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.58 % |
| Unclassified | root | N/A | 9.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_108279864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 622 | Open in IMG/M |
| 3300004025|Ga0055433_10114919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300004048|Ga0055494_10025513 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300004156|Ga0062589_100301187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1239 | Open in IMG/M |
| 3300004463|Ga0063356_101692355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 945 | Open in IMG/M |
| 3300004479|Ga0062595_100314375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1065 | Open in IMG/M |
| 3300004479|Ga0062595_102574762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 509 | Open in IMG/M |
| 3300004778|Ga0062383_10060982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1516 | Open in IMG/M |
| 3300004778|Ga0062383_10500437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 609 | Open in IMG/M |
| 3300004779|Ga0062380_10152031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 905 | Open in IMG/M |
| 3300005168|Ga0066809_10136193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 628 | Open in IMG/M |
| 3300005328|Ga0070676_10187613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1348 | Open in IMG/M |
| 3300005328|Ga0070676_10388327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 968 | Open in IMG/M |
| 3300005331|Ga0070670_100002419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15382 | Open in IMG/M |
| 3300005331|Ga0070670_100126630 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2205 | Open in IMG/M |
| 3300005331|Ga0070670_100732487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 890 | Open in IMG/M |
| 3300005332|Ga0066388_101848370 | Not Available | 1076 | Open in IMG/M |
| 3300005332|Ga0066388_102623119 | Not Available | 918 | Open in IMG/M |
| 3300005333|Ga0070677_10156861 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1064 | Open in IMG/M |
| 3300005353|Ga0070669_100392020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1135 | Open in IMG/M |
| 3300005353|Ga0070669_101071026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 693 | Open in IMG/M |
| 3300005353|Ga0070669_101898307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 520 | Open in IMG/M |
| 3300005354|Ga0070675_100058131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3189 | Open in IMG/M |
| 3300005364|Ga0070673_101344478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. KC06 | 671 | Open in IMG/M |
| 3300005367|Ga0070667_100047013 | Not Available | 3631 | Open in IMG/M |
| 3300005367|Ga0070667_100391893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1263 | Open in IMG/M |
| 3300005445|Ga0070708_100130101 | Not Available | 2329 | Open in IMG/M |
| 3300005459|Ga0068867_101621476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 605 | Open in IMG/M |
| 3300005544|Ga0070686_100173939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1525 | Open in IMG/M |
| 3300005548|Ga0070665_100468608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1270 | Open in IMG/M |
| 3300005829|Ga0074479_10379828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 545 | Open in IMG/M |
| 3300005841|Ga0068863_100112523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp. | 2592 | Open in IMG/M |
| 3300005843|Ga0068860_100198236 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1945 | Open in IMG/M |
| 3300005844|Ga0068862_100293583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1494 | Open in IMG/M |
| 3300005956|Ga0073920_1029115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 697 | Open in IMG/M |
| 3300006844|Ga0075428_100806579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 998 | Open in IMG/M |
| 3300006881|Ga0068865_100245603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp. | 1410 | Open in IMG/M |
| 3300009075|Ga0105090_10025156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3684 | Open in IMG/M |
| 3300009091|Ga0102851_11858038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 680 | Open in IMG/M |
| 3300009131|Ga0115027_11417151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 566 | Open in IMG/M |
| 3300009176|Ga0105242_10063132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3050 | Open in IMG/M |
| 3300009177|Ga0105248_11190883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. KC06 | 861 | Open in IMG/M |
| 3300009610|Ga0105340_1201189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
| 3300010358|Ga0126370_11572783 | Not Available | 628 | Open in IMG/M |
| 3300014312|Ga0075345_1186090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 518 | Open in IMG/M |
| 3300014316|Ga0075339_1240023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 521 | Open in IMG/M |
| 3300014325|Ga0163163_10443166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1358 | Open in IMG/M |
| 3300015195|Ga0167658_1099228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 624 | Open in IMG/M |
| 3300015258|Ga0180093_1147018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 597 | Open in IMG/M |
| 3300015371|Ga0132258_12203455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 1383 | Open in IMG/M |
| 3300015371|Ga0132258_12232187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp. | 1374 | Open in IMG/M |
| 3300015371|Ga0132258_13421570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1089 | Open in IMG/M |
| 3300015372|Ga0132256_100510420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp. | 1313 | Open in IMG/M |
| 3300015374|Ga0132255_101362913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1071 | Open in IMG/M |
| 3300017792|Ga0163161_12055325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 508 | Open in IMG/M |
| 3300018060|Ga0187765_10446123 | Not Available | 808 | Open in IMG/M |
| 3300018083|Ga0184628_10056717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1982 | Open in IMG/M |
| 3300018476|Ga0190274_13184643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 552 | Open in IMG/M |
| 3300025315|Ga0207697_10031687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2162 | Open in IMG/M |
| 3300025893|Ga0207682_10108166 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300025903|Ga0207680_10302245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 1116 | Open in IMG/M |
| 3300025908|Ga0207643_10011476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4785 | Open in IMG/M |
| 3300025908|Ga0207643_10849590 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300025925|Ga0207650_10002086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 13981 | Open in IMG/M |
| 3300025925|Ga0207650_10008787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 6904 | Open in IMG/M |
| 3300025925|Ga0207650_10060704 | All Organisms → cellular organisms → Bacteria | 2821 | Open in IMG/M |
| 3300025926|Ga0207659_11160793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 664 | Open in IMG/M |
| 3300025930|Ga0207701_10190093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1808 | Open in IMG/M |
| 3300025934|Ga0207686_10613195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 858 | Open in IMG/M |
| 3300025941|Ga0207711_10067450 | Not Available | 3097 | Open in IMG/M |
| 3300025957|Ga0210089_1006706 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300025960|Ga0207651_11538065 | Not Available | 599 | Open in IMG/M |
| 3300026075|Ga0207708_10325713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1255 | Open in IMG/M |
| 3300026118|Ga0207675_100264619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1667 | Open in IMG/M |
| 3300027831|Ga0209797_10023567 | Not Available | 2812 | Open in IMG/M |
| 3300027831|Ga0209797_10062422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 1649 | Open in IMG/M |
| 3300027840|Ga0209683_10003798 | All Organisms → cellular organisms → Bacteria | 5799 | Open in IMG/M |
| 3300027897|Ga0209254_10132315 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
| 3300027897|Ga0209254_10158420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1847 | Open in IMG/M |
| 3300027899|Ga0209668_10067030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1991 | Open in IMG/M |
| 3300027900|Ga0209253_10005452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11033 | Open in IMG/M |
| 3300027900|Ga0209253_10033499 | All Organisms → cellular organisms → Bacteria | 4300 | Open in IMG/M |
| 3300027902|Ga0209048_10000240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 60246 | Open in IMG/M |
| 3300027902|Ga0209048_10016329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6520 | Open in IMG/M |
| 3300028380|Ga0268265_10476355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1171 | Open in IMG/M |
| 3300028380|Ga0268265_10854991 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300028380|Ga0268265_12323750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 543 | Open in IMG/M |
| 3300028802|Ga0307503_10567120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 622 | Open in IMG/M |
| 3300031543|Ga0318516_10507649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 692 | Open in IMG/M |
| 3300031720|Ga0307469_10383284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 1193 | Open in IMG/M |
| 3300031720|Ga0307469_10962126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 795 | Open in IMG/M |
| 3300031726|Ga0302321_102006771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 672 | Open in IMG/M |
| 3300031740|Ga0307468_100453634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 999 | Open in IMG/M |
| 3300031740|Ga0307468_100789783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 808 | Open in IMG/M |
| 3300031740|Ga0307468_102172947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 536 | Open in IMG/M |
| 3300031747|Ga0318502_10818042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 565 | Open in IMG/M |
| 3300031820|Ga0307473_10070264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp. | 1753 | Open in IMG/M |
| 3300031831|Ga0318564_10428399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 578 | Open in IMG/M |
| 3300031834|Ga0315290_10102763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp. | 2412 | Open in IMG/M |
| 3300031834|Ga0315290_10232549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp. | 1606 | Open in IMG/M |
| 3300031834|Ga0315290_10535405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 1021 | Open in IMG/M |
| 3300031834|Ga0315290_11143093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300031834|Ga0315290_11219181 | Not Available | 624 | Open in IMG/M |
| 3300031834|Ga0315290_11270426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 608 | Open in IMG/M |
| 3300031873|Ga0315297_10639692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
| 3300031879|Ga0306919_11135360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 595 | Open in IMG/M |
| 3300031902|Ga0302322_100917807 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300031910|Ga0306923_10866302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 992 | Open in IMG/M |
| 3300031910|Ga0306923_11735429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 644 | Open in IMG/M |
| 3300031918|Ga0311367_11358405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 701 | Open in IMG/M |
| 3300031959|Ga0318530_10464552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 525 | Open in IMG/M |
| 3300031997|Ga0315278_10032439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5035 | Open in IMG/M |
| 3300031997|Ga0315278_10098258 | All Organisms → cellular organisms → Bacteria | 2945 | Open in IMG/M |
| 3300032009|Ga0318563_10132473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 1332 | Open in IMG/M |
| 3300032118|Ga0315277_10062577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4284 | Open in IMG/M |
| 3300032118|Ga0315277_10640755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1035 | Open in IMG/M |
| 3300032143|Ga0315292_11731693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 501 | Open in IMG/M |
| 3300032156|Ga0315295_11171298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 755 | Open in IMG/M |
| 3300032164|Ga0315283_10003442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 13499 | Open in IMG/M |
| 3300032164|Ga0315283_10760247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1040 | Open in IMG/M |
| 3300032164|Ga0315283_11219892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 784 | Open in IMG/M |
| 3300032164|Ga0315283_11871135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 601 | Open in IMG/M |
| 3300032256|Ga0315271_10018197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4756 | Open in IMG/M |
| 3300032256|Ga0315271_10062038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2739 | Open in IMG/M |
| 3300032256|Ga0315271_10147495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp. | 1841 | Open in IMG/M |
| 3300032256|Ga0315271_10673891 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → unclassified Chitinophagales → Chitinophagales bacterium | 887 | Open in IMG/M |
| 3300032256|Ga0315271_11042725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 706 | Open in IMG/M |
| 3300032256|Ga0315271_11522453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 576 | Open in IMG/M |
| 3300032342|Ga0315286_11354538 | Not Available | 688 | Open in IMG/M |
| 3300032397|Ga0315287_12099675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 619 | Open in IMG/M |
| 3300032397|Ga0315287_12814321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 514 | Open in IMG/M |
| 3300032782|Ga0335082_10535307 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1033 | Open in IMG/M |
| 3300032828|Ga0335080_10738438 | Not Available | 1023 | Open in IMG/M |
| 3300033004|Ga0335084_10040706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4778 | Open in IMG/M |
| 3300033004|Ga0335084_11244780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → unclassified Rhodoblastus → Rhodoblastus sp. | 742 | Open in IMG/M |
| 3300033419|Ga0316601_100296765 | Not Available | 1477 | Open in IMG/M |
| 3300033419|Ga0316601_101235709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 750 | Open in IMG/M |
| 3300033487|Ga0316630_10802375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 808 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 18.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 10.87% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 5.07% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.07% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 4.35% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.90% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.17% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.17% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.45% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.72% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.72% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.72% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.72% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.72% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.72% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004048 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005956 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_23-Sept-14 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1082798641 | 3300001213 | Wetland | ADEGETTMAKGKGGGSYPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR* |
| Ga0055433_101149191 | 3300004025 | Natural And Restored Wetlands | MAKGKGGGSFPNPKGHTGPKTQFPQARRPPAAVVPRVIPRTKASA |
| Ga0055494_100255132 | 3300004048 | Natural And Restored Wetlands | MAKGKSGSSYPNPKGHTGPKTQFPQARRPPAAVVPRVAARTKASPKGR* |
| Ga0062589_1003011873 | 3300004156 | Soil | MAKAKGGSAGFPNPKGHTGPKMQFPQAKRPPSAVAPRVAPRTKASPKGR* |
| Ga0063356_1016923553 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAKAKGGSAGFPNPKGHTGPKMQFPQAKRPPSAVAPRVAPR |
| Ga0062595_1003143751 | 3300004479 | Soil | MAKTKGGSGGYPNPKGHTGPKTQSPQAKRPPSGFVPRVAPRTKASPKGR* |
| Ga0062595_1025747622 | 3300004479 | Soil | MGAKRESRAGPETNMAKSKSGSSYPNPKGHTGPKTQFPQGKRPVGGHPAPRVLPRTRASPKGR* |
| Ga0062383_100609822 | 3300004778 | Wetland Sediment | MTKGKGGTPYPNPKGHTGPKTQFPQARRPPQAVVPRVVARTKASPKGR* |
| Ga0062383_105004372 | 3300004778 | Wetland Sediment | MAKGKGGGSYPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR* |
| Ga0062380_101520312 | 3300004779 | Wetland Sediment | MAKAKGGGSYPNPKGHTGPKTQFPQARRPPATTVPRVMPRTKASAKGR* |
| Ga0066809_101361932 | 3300005168 | Soil | MTKGKGGGGGYPNPKGHTGPRTQFPQARRPPSAVVPRVAPRTKASPKGR* |
| Ga0070676_101876133 | 3300005328 | Miscanthus Rhizosphere | SGGYPNPKGHTGPKTQFPQAKRPPSAGVPRVMPRTKASPKGR* |
| Ga0070676_103883272 | 3300005328 | Miscanthus Rhizosphere | MAKGKSGGSYPNPKGHTGPKTQFPQAKRPPSAVVPRVVPRTKASPKGR* |
| Ga0070670_1000024193 | 3300005331 | Switchgrass Rhizosphere | MAKSKSGSGYPNPKGHTGPKTQFPQAKRPVGGHPAPRVLPRTRASPKGR* |
| Ga0070670_1001266303 | 3300005331 | Switchgrass Rhizosphere | MAKSKSGSSYPNPKGHTGPKTQFPQGKRPVGGHPAPRVLPRTRASPKGR* |
| Ga0070670_1007324871 | 3300005331 | Switchgrass Rhizosphere | RRSASATDQETRMAKAKGSGGYPNPKGHTGPKTQFPQAKRPPSAAVPRAMPRTKASPKGR |
| Ga0066388_1018483702 | 3300005332 | Tropical Forest Soil | MTKGKESGYPNPKGHTGPKTQFPQAKRPPATVPRVAPRTKASPKGR* |
| Ga0066388_1026231192 | 3300005332 | Tropical Forest Soil | MKPVAWVSSEREATMTKGKGGSGYPNPKGHTGPKTQFPQAKRPPSAVVPRVMPRTKASPKGR* |
| Ga0070677_101568612 | 3300005333 | Miscanthus Rhizosphere | MSADDQETRMAKAKGSGGYPNPKGHTGPKTQFPQAKRPPSAGVPRVMPRTKASPKGR* |
| Ga0070669_1003920202 | 3300005353 | Switchgrass Rhizosphere | MAKVKGSGSYPNPKGHTGPKMQFPQAKKPGGGNTAPRILPRTRASPKGR* |
| Ga0070669_1010710263 | 3300005353 | Switchgrass Rhizosphere | MAKAKGSGGYPNPKGHTGPKTQFPQAKRPPSAGVPRVMPRTKASPKGR* |
| Ga0070669_1018983072 | 3300005353 | Switchgrass Rhizosphere | MAKSKSGGSYPNPKGHTGPKTQFPQAKRPPSATVPRVVPRTKASPKGR* |
| Ga0070675_1000581314 | 3300005354 | Miscanthus Rhizosphere | MTKGKGGGSYPNPKGHTGPRNQFPQARRPPSAVVPRVAPRTKASPKGR* |
| Ga0070673_1013444781 | 3300005364 | Switchgrass Rhizosphere | EVSMAKVKGSGSYPNPKGHTGPKMQFPQAKKPGGGNTAPRILPRTRASPKGR* |
| Ga0070667_1000470134 | 3300005367 | Switchgrass Rhizosphere | MAKSKTGSSYPNPKGHTGPKTQFPQGKRPVGGHPAPRVLPRTRASPKGR* |
| Ga0070667_1003918933 | 3300005367 | Switchgrass Rhizosphere | MAKAKGSGGYPNPKGHTGPKTQFPQAKRPPSAAVPRAMPRTKASPKGR* |
| Ga0070708_1001301012 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKGKGGGGYPNPKGHTGPKTQFPQAKRPPSATVPRVVPRTKASPKGR* |
| Ga0068867_1016214762 | 3300005459 | Miscanthus Rhizosphere | MAKAKGSGGYPNPKGHTGPKTQFPQAKRPPSAVVPRAMPRTKASPKGR* |
| Ga0070686_1001739392 | 3300005544 | Switchgrass Rhizosphere | MTKGKGGGSYPNPKGHTGPRNQFPQARRPPSAVVPRVAPRTKA |
| Ga0070665_1004686083 | 3300005548 | Switchgrass Rhizosphere | SNFPTPKGHTGPKTQFPQARRPPSAVVPRVPTRTKASTKGR* |
| Ga0074479_103798281 | 3300005829 | Sediment (Intertidal) | MAKGKGGGSYPNPKGHTGPKTQFPQARRPPSAVVPRVVARTKASPKGR* |
| Ga0068863_1001125234 | 3300005841 | Switchgrass Rhizosphere | PEVSMAKGKSGGSYPNPKGHTGPKTQFPQAKRPPSAVVPRVVPRTKASPKGR* |
| Ga0068860_1001982362 | 3300005843 | Switchgrass Rhizosphere | MAKVKGSGSYPNPKGHTGPKMQFPQAKKPGGGNPAPRVLPRTRASPKGR* |
| Ga0068862_1002935832 | 3300005844 | Switchgrass Rhizosphere | MAKVKGSGSYPNPKGHTGPKMQFPQAKKPGGGNTAPRVLPRTRASPKGR* |
| Ga0073920_10291152 | 3300005956 | Sand | MAKSKSGGSFPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR* |
| Ga0075428_1008065793 | 3300006844 | Populus Rhizosphere | VKRPKGEEADMAKGKSGSSYPNPKGHTGPKTQFPQARRPPSAVVPRVAPRTKASPKGR* |
| Ga0068865_1002456031 | 3300006881 | Miscanthus Rhizosphere | RSMGAKRESRAGPETNMAKSKSGSSYPNPKGHTGPKTQFPQGKRPVGGHPAPRVLPRTRASPKGR* |
| Ga0105090_100251562 | 3300009075 | Freshwater Sediment | MAKGKGGGSYPNPKGHTGPKTQFPQARRPPAAVVPRVAARTKASPKGR* |
| Ga0102851_118580381 | 3300009091 | Freshwater Wetlands | MAKGKSGSSYPNPKGHTGPKTQFPQARRPPSKIVPRVVARTKASAKGR* |
| Ga0115027_114171511 | 3300009131 | Wetland | MAKGKGGGSFPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR* |
| Ga0105242_100631322 | 3300009176 | Miscanthus Rhizosphere | LDTAGFSVDDKEATMAKAKGAAGGFPNPKGHTGPKMQFPQAKRPPSAVVPRVVARTKASPKGR* |
| Ga0105248_111908832 | 3300009177 | Switchgrass Rhizosphere | DLNADFALIPEVSMAKVKGSGSYPNPKGHTGPKMQFPQAKKPGGGNTAPRILPRTRASPKGR* |
| Ga0105340_12011892 | 3300009610 | Soil | MAKSKSGGSYPNPKGHTGPKTQFPQAKRPPSAVVPRVVPRTKASP |
| Ga0126370_115727832 | 3300010358 | Tropical Forest Soil | MTKGKGGGGYPNPKGHTGPKTQFPQAKRPPSAVVPRVMPRTKASPKGR* |
| Ga0075345_11860902 | 3300014312 | Natural And Restored Wetlands | PKGHTGPKTQFPQARRPPAAVVPRVAARTKASPKGR* |
| Ga0075339_12400231 | 3300014316 | Natural And Restored Wetlands | TADEGETTMAKGKSGSSYPNPKGHTGPKTQFPQARRPPAAVVPRVAARTKASPKGR* |
| Ga0163163_104431662 | 3300014325 | Switchgrass Rhizosphere | MAKGKSGGSYPNPKGHTGPKTQFPQAKRPPAGMAPRVVPRTKASPKGR* |
| Ga0167658_10992282 | 3300015195 | Glacier Forefield Soil | MAKDKGSGGYPNPKGHTGPKTQFPQGKKPPSTFVPRVMPRTKASPKGR* |
| Ga0180093_11470181 | 3300015258 | Soil | MAKGKGGGSYPNPKGHTGPKMQFPQAKRPPSAVVPRVAPRTKASPKGR* |
| Ga0132258_122034552 | 3300015371 | Arabidopsis Rhizosphere | MTKGKGGSGGYPNPKGHTGPKTQFPQARRPPSAVVPRVAPRTKASPKGR* |
| Ga0132258_122321871 | 3300015371 | Arabidopsis Rhizosphere | MTKGKGSGGYPNPKGHTGPKTQFPQAKKPPSATVPRVMPRTKASPKGR* |
| Ga0132258_134215701 | 3300015371 | Arabidopsis Rhizosphere | MTKGKGSGGYPNPKGHTGPKTQFPQAKRPPAAAVPRAMPRTKASPKGR* |
| Ga0132256_1005104202 | 3300015372 | Arabidopsis Rhizosphere | MTKGKGGGGYPNPKGHTGPKTQFPQAKRPPAAAVPRAMPRTKASPKGR* |
| Ga0132255_1013629133 | 3300015374 | Arabidopsis Rhizosphere | MTKGKGSGGYPNPKGHTGPKTQFPQAKKPPSATVPRVMPRTKASPKGS* |
| Ga0163161_120553251 | 3300017792 | Switchgrass Rhizosphere | RSMGAKRDSRAGTETNMAKSKTGSSYPNPKGHTGPKTQFPQGKRPVGGHPAPRVLPRTRASPKGR |
| Ga0187765_104461231 | 3300018060 | Tropical Peatland | MTKGKGSGGYPNPKGHTGPKMQYPQAKRPPAAVVPRVMPRTKASPKGR |
| Ga0184628_100567173 | 3300018083 | Groundwater Sediment | MAKSKSGGSYPNPKGHTGPKTQFPQAKRPPSAVVPRVVPRTKASPKGR |
| Ga0190274_131846432 | 3300018476 | Soil | MTKGKGGSSSYPNPKGHTGPKTQFPQAKRPPSAVVPRVVPRTKASPKGR |
| Ga0207697_100316873 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAKRESRAGPETNMAKSKSGSSYPNPKGHTGPKTQFPQGKRPVGGHPAPRVLPRTRASPKGR |
| Ga0207682_101081662 | 3300025893 | Miscanthus Rhizosphere | MSADDQETRMAKAKGSGGYPNPKGHTGPKTQFPQAKRPPSAGVPRVMPRTKASPKGR |
| Ga0207680_103022452 | 3300025903 | Switchgrass Rhizosphere | MAKTKGGSGGYPNPKGHTGPKTQSPQAKRPPSGFVPRVAPRTKASPKGR |
| Ga0207643_100114763 | 3300025908 | Miscanthus Rhizosphere | MTKGKGGGSYPNPKGHTGPRNQFPQARRPPSAVVPRVAPRTKASPKGR |
| Ga0207643_108495902 | 3300025908 | Miscanthus Rhizosphere | MAKVKGSGSYPNPKGHTGPKMQFPQAKKPGGGNTAPRILPRTRASPKGR |
| Ga0207650_1000208614 | 3300025925 | Switchgrass Rhizosphere | MAKSKSGSGYPNPKGHTGPKTQFPQAKRPVGGHPAPRVLPRTRASPKGR |
| Ga0207650_100087873 | 3300025925 | Switchgrass Rhizosphere | MAKSKSGSSYPNPKGHTGPKTQFPQGKRPVGGHPAPRVLPRTRASPKGR |
| Ga0207650_100607043 | 3300025925 | Switchgrass Rhizosphere | MAKVKGSGSYPNPKGHTGPKMQFPQAKKPGGGNTAPRVLPRTRASPKGR |
| Ga0207659_111607932 | 3300025926 | Miscanthus Rhizosphere | MAKVKGSGSYPNPKGHTGPKMQFPQAKKPGGGNPAPRVLPRTRASPKGR |
| Ga0207701_101900934 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKAKGSGGYPNPKGHTGPKTQFPQAKRPPSAGVPRVMPRTKASPKGR |
| Ga0207686_106131952 | 3300025934 | Miscanthus Rhizosphere | LDTAGFSVDDKEATMAKAKGAAGGFPNPKGHTGPKMQFPQAKRPPSAVVPRVVARTKASPKGR |
| Ga0207711_100674502 | 3300025941 | Switchgrass Rhizosphere | MAKGKSGGSYPNPKGHTGPKTQFPQAKRPPSAVVPRVVPRTKASPKGR |
| Ga0210089_10067062 | 3300025957 | Natural And Restored Wetlands | MAKGKSGSSYPNPKGHTGPKTQFPQAKRPVGGHPAPRVLPRTRASPKGR |
| Ga0207651_115380651 | 3300025960 | Switchgrass Rhizosphere | MTKGKGGGSYPNPKGHTGPRNQFPQARRPPSAVVPRVAP |
| Ga0207708_103257131 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | AAPADDQETRMAKAKGSGGYPNPKGYTGPKTQFPQAKRPPSAGVPRVMPRTKASPKGR |
| Ga0207675_1002646193 | 3300026118 | Switchgrass Rhizosphere | MAKSKSGSSYPNPKGHTGPKTQFPQGKRPVGGHPAPRVLPRTRAS |
| Ga0209797_100235672 | 3300027831 | Wetland Sediment | MAKAKGGGSYPNPKGHTGPKTQFPQARRPPATTVPRVMPRTKASAKGR |
| Ga0209797_100624222 | 3300027831 | Wetland Sediment | MAKGKGGGSYPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR |
| Ga0209683_100037983 | 3300027840 | Wetland Sediment | MTKGKGGTPYPNPKGHTGPKTQFPQARRPPQAVVPRVVARTKASPKGR |
| Ga0209254_101323152 | 3300027897 | Freshwater Lake Sediment | MAKSKGRGSYPNPKGHTGPRTQFPQATRPPSAVVPRVAPRTKASPKGR |
| Ga0209254_101584202 | 3300027897 | Freshwater Lake Sediment | MAKGKGGGSYPNPKGHTGPKTQFPQARRPPSKIVPRVVARTKASAKGR |
| Ga0209668_100670303 | 3300027899 | Freshwater Lake Sediment | MAKGKGGGSYPNPKGHTGPKTQFPQARRPPAAVVPRVVAR |
| Ga0209253_100054523 | 3300027900 | Freshwater Lake Sediment | MAKGKGRGSYPNPKGHTGPRMQAPQAGRPPAAVVPRVAPRTKASPKGR |
| Ga0209253_100334992 | 3300027900 | Freshwater Lake Sediment | MAKGKGGGSYPNPKGHTGPRTQSPQARRPPSTKVPRIVPRTKASAKGR |
| Ga0209048_1000024029 | 3300027902 | Freshwater Lake Sediment | MGKGKGKGSGGYPNPKGHTGPRTQFPHAGRPPSAVVPRVAPRTKASPKGR |
| Ga0209048_100163295 | 3300027902 | Freshwater Lake Sediment | MAKGKGRGSYPNPKGHTGPRTQFPQAGRPPSAGVPRVAPRTKASPKGR |
| Ga0268265_104763551 | 3300028380 | Switchgrass Rhizosphere | MAKVKGSGSYPNPKGHTGPKMQFPQAKKPGGGNTAPR |
| Ga0268265_108549912 | 3300028380 | Switchgrass Rhizosphere | FLADTGGGYMAKGKGSGSYPNPKGHTGPKMQFPQAKKPGGGNTAPRVLPRTRASPKGR |
| Ga0268265_123237501 | 3300028380 | Switchgrass Rhizosphere | VSADDQETRMAKAKGSGGYPNPKGYTGPKTQFPQAKRPPSAGVPRVMPRTKASPKGR |
| Ga0307503_105671201 | 3300028802 | Soil | MAKSKSGSGYPNPKGHTGPKTQFPQAKRPPSAVVPRVVARTKASPKGR |
| Ga0318516_105076492 | 3300031543 | Soil | MDNPGGMMTKGKGGGGYPNPKGHTGPKTQFPQAKRPPSAAVPRVMPRTKASPKGR |
| Ga0307469_103832842 | 3300031720 | Hardwood Forest Soil | MTKGKGGGGYPNPKGHTGPKMQFPQAKRPPSAVVPRVMPRTKASPKGR |
| Ga0307469_109621262 | 3300031720 | Hardwood Forest Soil | MTKGKGGGGYPNPKGHTGPRTQFPQAKRPPSAAVPRVMPRTKASPKGR |
| Ga0302321_1020067712 | 3300031726 | Fen | AAGSTAAVTEASMAKGKDTSHYPTPKGHTGPKTQFPQARRPPAAVAPRVVARTKASPKGR |
| Ga0307468_1004536342 | 3300031740 | Hardwood Forest Soil | MTKNKGGGGYPNPKGHTGPKTQFPQARRPPSAVVPRVAPRT |
| Ga0307468_1007897832 | 3300031740 | Hardwood Forest Soil | MAKGKSGGSYPNPKGHTGPKTQFPQAKRPPSAVVPRV |
| Ga0307468_1021729472 | 3300031740 | Hardwood Forest Soil | HRVREVRKRFREATMTKGKGQGGYPNPKGHTGPKTQFPQAKRPPAAMVPRVAPRTKASPKGR |
| Ga0318502_108180422 | 3300031747 | Soil | SQGGRAWADNDQEATMTKGKGGGGYPNPKGHTGPKMQFPQAKRPPSAVVPRAMPRTKASPKGR |
| Ga0307473_100702642 | 3300031820 | Hardwood Forest Soil | MTKGKGQGGYPNPKGHTGPKTQFPQAKRPPAAMVPRVAPRTKASPKGR |
| Ga0318564_104283992 | 3300031831 | Soil | DNDQEATMTKGKGGGGYPNPKGHTGPKMQFPQAKRPPSAVVPRAMPRTKASPKGR |
| Ga0315290_101027632 | 3300031834 | Sediment | MAKSKSGGSFPNPKGHTGPKTQFPQARRPPTAVVPRVVARTKASPKGR |
| Ga0315290_102325492 | 3300031834 | Sediment | EGEMTMAKGKGGGSYPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR |
| Ga0315290_105354052 | 3300031834 | Sediment | TMAKGKGGGSYPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR |
| Ga0315290_111430931 | 3300031834 | Sediment | MAKGKGGGSYPNPKGHTGPKTQFPQARRPPSAVVPRVVARTKASPKGR |
| Ga0315290_112191811 | 3300031834 | Sediment | MAKSKSRGNYPNPKGHTGPRTQFPQATRPPSAVVPRVAPRTKASPKGR |
| Ga0315290_112704262 | 3300031834 | Sediment | MAKGKGGGSFPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR |
| Ga0315297_106396922 | 3300031873 | Sediment | MAKGKGGGSYPNPKGHTGPKTQFPQARRPPSAVVPRVVARTKASPK |
| Ga0306919_111353601 | 3300031879 | Soil | MMTKGKGSGGYPNPKGHTGPKTQFPQAKRPPSAAVPRVMPRTKASPKGR |
| Ga0302322_1009178071 | 3300031902 | Fen | MTKGKGGTPFPNPKGHTGPKTQFPQAKRPPQVVAP |
| Ga0306923_108663022 | 3300031910 | Soil | ASTSQGGRAWADNDQEATMTKGKGGGGYPNPKGHTGPKMQFPQAKRPPSAVVPRAMPRTKASPKGR |
| Ga0306923_117354292 | 3300031910 | Soil | MTKGKGGGGYPNPKGHTGPKTQFPQAKRPPSAAVPRVMPRTKASPKGR |
| Ga0311367_113584051 | 3300031918 | Fen | MAKGKDTSHYPTPKGHTGPKTQFPQARRPPAAVAPRVVARTKASPKGR |
| Ga0318530_104645521 | 3300031959 | Soil | MTKGKGGGGYPNPKGHTGPKMQFPQAKRPPSAVVPRAMPRTKASPKGR |
| Ga0315278_100324393 | 3300031997 | Sediment | MAKGKGGGSFPNPKGHTGPKTQFPQARRPPSAVVPRVVPRTKASPKGR |
| Ga0315278_100982584 | 3300031997 | Sediment | EGETTMAKGKGGGSYPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR |
| Ga0318563_101324732 | 3300032009 | Soil | MDNPGGMMTKGKGSGGYPNPKGHTGPKTQFPQAKRPPSAAVPRVMPRTKASPKGR |
| Ga0315277_100625772 | 3300032118 | Sediment | MAKGKGGGSFPNPKGHTGPKTQFPQARRPPASVVPRVVARTKASPKGR |
| Ga0315277_106407551 | 3300032118 | Sediment | MAKGKGGGGFPNPKGHTGPKTQFPQARRPPTAVVPRVVARTKASPKGR |
| Ga0315292_117316932 | 3300032143 | Sediment | GKGGGSYPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR |
| Ga0315295_111712982 | 3300032156 | Sediment | GSYPNPKGHTGPKTQFPQARRPPTAVVPRVVARTKASPKGR |
| Ga0315283_1000344212 | 3300032164 | Sediment | MAKGKGGGSYPNPKGHTGPKTQFPQARRPPSTTVPRVMPRTKASAKGR |
| Ga0315283_107602472 | 3300032164 | Sediment | MAKSKSGGSFPNPKGHTGPKTQFPQARRPPTAVVPRVVAR |
| Ga0315283_112198922 | 3300032164 | Sediment | YPNPKGHTGPKTQFPQARRPPATVVPRVVARTKASPKGR |
| Ga0315283_118711352 | 3300032164 | Sediment | KGKGGGSYPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR |
| Ga0315271_100181972 | 3300032256 | Sediment | MTKGKGGGSFPNPKGHTGPKTQFPQARRPPAAVVPRVVPRTKASPKGR |
| Ga0315271_100620381 | 3300032256 | Sediment | MSKGKGGTPYPNPKGHTGPKTQFPQAKRPPQAVVPRVVARTKASPKGR |
| Ga0315271_101474952 | 3300032256 | Sediment | MAKGKSGGSYPNPKGHTGPKTQFPQARRPPSAVVPRVVPRTKASPKGR |
| Ga0315271_106738912 | 3300032256 | Sediment | MAKSKSGGSFPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR |
| Ga0315271_110427251 | 3300032256 | Sediment | KGKGGGSFPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR |
| Ga0315271_115224532 | 3300032256 | Sediment | MSKRKGDTPYPNPKGHTGPKTQFPQAKRPPQAVVPRVVARTKASPKGR |
| Ga0315286_113545381 | 3300032342 | Sediment | MAKGKGGGSFPNPKGHTGPKTQFPQARRPPASVVPRVVART |
| Ga0315287_120996752 | 3300032397 | Sediment | SADEGETTMAKGKGGGSYPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR |
| Ga0315287_128143212 | 3300032397 | Sediment | ADEGETTMAKGKGGGSYPNPKGHTGPKTQFPQARRPPAAVVPRVVARTKASPKGR |
| Ga0335082_105353072 | 3300032782 | Soil | MGKGKGGGGYPNPKGHTGPKTQFPQARRPPAAIVPRAMPRTKASPKGR |
| Ga0335080_107384382 | 3300032828 | Soil | MTKGKGGGGYPNPKGHTGPKMQFPQAKRRPATVVPRVMPRTKASPKGR |
| Ga0335084_100407061 | 3300033004 | Soil | MSKGKGGGGYPNPKGHTGPKMQFPQAKRPPSAAVPRVMPRTKASPKGR |
| Ga0335084_112447801 | 3300033004 | Soil | MAKGKGGSYPNPKGHTGPKLQFPQARRPPSAPVARVMPRTKASAKGR |
| Ga0316601_1002967653 | 3300033419 | Soil | TPYPNPKGHTGPKTQAPQARRPPQAVVPRVVTRTKASPKGR |
| Ga0316601_1012357092 | 3300033419 | Soil | MAKGKSGSSYPNPKGHTGPKTQFPQARRPPSKIVPRVVARTKASAKGR |
| Ga0316630_108023751 | 3300033487 | Soil | MAKGKSGSSYPNPKGHTGPKTQFPQARRPPSKIVPR |
| ⦗Top⦘ |