


| Basic Information | |
|---|---|
| Family ID | F055511 |
| Family Type | Metagenome |
| Number of Sequences | 138 |
| Average Sequence Length | 53 residues |
| Representative Sequence | MTGMRAHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDA |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 24.64 % |
| % of genes near scaffold ends (potentially truncated) | 35.51 % |
| % of genes from short scaffolds (< 2000 bps) | 87.68 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.304 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.145 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.130 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.406 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.75% β-sheet: 0.00% Coil/Unstructured: 56.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF02627 | CMD | 27.54 |
| PF13343 | SBP_bac_6 | 19.57 |
| PF01547 | SBP_bac_1 | 8.70 |
| PF00378 | ECH_1 | 7.25 |
| PF04879 | Molybdop_Fe4S4 | 2.90 |
| PF00528 | BPD_transp_1 | 2.90 |
| PF13561 | adh_short_C2 | 2.17 |
| PF01661 | Macro | 2.17 |
| PF07883 | Cupin_2 | 0.72 |
| PF07690 | MFS_1 | 0.72 |
| PF02515 | CoA_transf_3 | 0.72 |
| PF13191 | AAA_16 | 0.72 |
| PF00196 | GerE | 0.72 |
| PF00696 | AA_kinase | 0.72 |
| PF01656 | CbiA | 0.72 |
| PF00005 | ABC_tran | 0.72 |
| PF00239 | Resolvase | 0.72 |
| PF00296 | Bac_luciferase | 0.72 |
| PF02738 | MoCoBD_1 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 27.54 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 27.54 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 2.17 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.72 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.72 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.72 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.65 % |
| Unclassified | root | N/A | 4.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105291022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1018 | Open in IMG/M |
| 3300000890|JGI11643J12802_12185717 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300003994|Ga0055435_10097466 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300003995|Ga0055438_10016843 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300003995|Ga0055438_10233947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 566 | Open in IMG/M |
| 3300004156|Ga0062589_100146121 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300004156|Ga0062589_101229712 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 719 | Open in IMG/M |
| 3300004281|Ga0066397_10079280 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300004463|Ga0063356_100891259 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300004480|Ga0062592_100505327 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300005093|Ga0062594_100202198 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300005093|Ga0062594_100535101 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300005093|Ga0062594_100706533 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300005213|Ga0068998_10162450 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005294|Ga0065705_10417545 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300005295|Ga0065707_10465483 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300005295|Ga0065707_10746089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 620 | Open in IMG/M |
| 3300005328|Ga0070676_10186907 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300005334|Ga0068869_101556274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300005336|Ga0070680_100681887 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300005338|Ga0068868_102320502 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005340|Ga0070689_102235628 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
| 3300005353|Ga0070669_101094925 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005438|Ga0070701_10561073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 751 | Open in IMG/M |
| 3300005441|Ga0070700_101199474 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 634 | Open in IMG/M |
| 3300005444|Ga0070694_101268297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 619 | Open in IMG/M |
| 3300005445|Ga0070708_101006055 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 782 | Open in IMG/M |
| 3300005468|Ga0070707_100497588 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300005526|Ga0073909_10479217 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 599 | Open in IMG/M |
| 3300005546|Ga0070696_100403789 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300005549|Ga0070704_100185755 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300005617|Ga0068859_101450351 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300005618|Ga0068864_101710370 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005713|Ga0066905_100077462 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300005718|Ga0068866_10161846 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300005718|Ga0068866_10609479 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005844|Ga0068862_100306937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1461 | Open in IMG/M |
| 3300005844|Ga0068862_101214233 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300006041|Ga0075023_100434253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 576 | Open in IMG/M |
| 3300006846|Ga0075430_100499410 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300006876|Ga0079217_11345468 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300007004|Ga0079218_11117504 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300007004|Ga0079218_11957201 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 667 | Open in IMG/M |
| 3300009038|Ga0099829_10005128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7934 | Open in IMG/M |
| 3300009087|Ga0105107_10545966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 807 | Open in IMG/M |
| 3300009092|Ga0105250_10413263 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 600 | Open in IMG/M |
| 3300009143|Ga0099792_10728857 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 644 | Open in IMG/M |
| 3300009148|Ga0105243_10611512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1051 | Open in IMG/M |
| 3300009148|Ga0105243_11732870 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
| 3300009153|Ga0105094_10479729 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 723 | Open in IMG/M |
| 3300009176|Ga0105242_10660517 | Not Available | 1018 | Open in IMG/M |
| 3300009553|Ga0105249_10172750 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2097 | Open in IMG/M |
| 3300009553|Ga0105249_10577634 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1177 | Open in IMG/M |
| 3300010373|Ga0134128_12440534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 576 | Open in IMG/M |
| 3300010391|Ga0136847_10780905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 593 | Open in IMG/M |
| 3300010391|Ga0136847_11234160 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300010391|Ga0136847_13188962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 585 | Open in IMG/M |
| 3300010396|Ga0134126_13087096 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300010397|Ga0134124_11045703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 830 | Open in IMG/M |
| 3300010400|Ga0134122_10704014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 950 | Open in IMG/M |
| 3300010400|Ga0134122_12245466 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 590 | Open in IMG/M |
| 3300011414|Ga0137442_1059772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 784 | Open in IMG/M |
| 3300012189|Ga0137388_11981241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 511 | Open in IMG/M |
| 3300012199|Ga0137383_11062625 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 588 | Open in IMG/M |
| 3300012353|Ga0137367_10010172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7514 | Open in IMG/M |
| 3300012906|Ga0157295_10256856 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 589 | Open in IMG/M |
| 3300012929|Ga0137404_11258697 | Not Available | 681 | Open in IMG/M |
| 3300012930|Ga0137407_10267083 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300012931|Ga0153915_11483809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Candidatus Phaeomarinobacter → Candidatus Phaeomarinobacter ectocarpi | 793 | Open in IMG/M |
| 3300012931|Ga0153915_11508371 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 786 | Open in IMG/M |
| 3300012944|Ga0137410_10572610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 930 | Open in IMG/M |
| 3300012944|Ga0137410_10619984 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300012957|Ga0164303_10615866 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300012986|Ga0164304_11306917 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300013297|Ga0157378_11956285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 636 | Open in IMG/M |
| 3300014885|Ga0180063_1011898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2326 | Open in IMG/M |
| 3300017927|Ga0187824_10015821 | All Organisms → cellular organisms → Bacteria | 2199 | Open in IMG/M |
| 3300017936|Ga0187821_10197473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 773 | Open in IMG/M |
| 3300017993|Ga0187823_10060808 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1059 | Open in IMG/M |
| 3300017997|Ga0184610_1071927 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1058 | Open in IMG/M |
| 3300018052|Ga0184638_1058694 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1405 | Open in IMG/M |
| 3300018075|Ga0184632_10017879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2987 | Open in IMG/M |
| 3300018076|Ga0184609_10185059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Candidatus Phaeomarinobacter → Candidatus Phaeomarinobacter ectocarpi | 968 | Open in IMG/M |
| 3300018082|Ga0184639_10023557 | All Organisms → cellular organisms → Bacteria | 3093 | Open in IMG/M |
| 3300018422|Ga0190265_10345481 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300018422|Ga0190265_10711810 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300018429|Ga0190272_10697052 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 913 | Open in IMG/M |
| 3300019362|Ga0173479_10638610 | Not Available | 564 | Open in IMG/M |
| 3300019879|Ga0193723_1005814 | All Organisms → cellular organisms → Bacteria | 4159 | Open in IMG/M |
| 3300019883|Ga0193725_1021044 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1783 | Open in IMG/M |
| 3300020004|Ga0193755_1004846 | All Organisms → cellular organisms → Bacteria | 4322 | Open in IMG/M |
| 3300021073|Ga0210378_10015325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3149 | Open in IMG/M |
| 3300021080|Ga0210382_10077067 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1359 | Open in IMG/M |
| 3300021344|Ga0193719_10079962 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1420 | Open in IMG/M |
| 3300022756|Ga0222622_10077448 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
| 3300025165|Ga0209108_10134713 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1311 | Open in IMG/M |
| 3300025312|Ga0209321_10357882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 697 | Open in IMG/M |
| 3300025521|Ga0210083_1047788 | Not Available | 647 | Open in IMG/M |
| 3300025535|Ga0207423_1009728 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1479 | Open in IMG/M |
| 3300025551|Ga0210131_1065238 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 606 | Open in IMG/M |
| 3300025558|Ga0210139_1044735 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 889 | Open in IMG/M |
| 3300025560|Ga0210108_1025855 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1080 | Open in IMG/M |
| 3300025580|Ga0210138_1002983 | All Organisms → cellular organisms → Bacteria | 3061 | Open in IMG/M |
| 3300025917|Ga0207660_10880749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 731 | Open in IMG/M |
| 3300025934|Ga0207686_10606868 | Not Available | 862 | Open in IMG/M |
| 3300025961|Ga0207712_10060999 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
| 3300025961|Ga0207712_10124082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1958 | Open in IMG/M |
| 3300025979|Ga0210078_1056980 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
| 3300026035|Ga0207703_11641032 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 618 | Open in IMG/M |
| 3300026089|Ga0207648_10050416 | All Organisms → cellular organisms → Bacteria | 3640 | Open in IMG/M |
| 3300026888|Ga0209900_1021253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 524 | Open in IMG/M |
| 3300027818|Ga0209706_10209652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 943 | Open in IMG/M |
| 3300027909|Ga0209382_11481974 | Not Available | 677 | Open in IMG/M |
| 3300028380|Ga0268265_10323327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 1398 | Open in IMG/M |
| 3300028380|Ga0268265_10568648 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300028381|Ga0268264_12428337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 530 | Open in IMG/M |
| 3300028590|Ga0247823_11532387 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
| 3300028592|Ga0247822_10841868 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 750 | Open in IMG/M |
| 3300028711|Ga0307293_10033868 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300028812|Ga0247825_11011922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 604 | Open in IMG/M |
| 3300028814|Ga0307302_10442571 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 644 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1012366 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1721 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1019261 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1087911 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 754 | Open in IMG/M |
| 3300031548|Ga0307408_100612490 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 969 | Open in IMG/M |
| 3300031548|Ga0307408_100687702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 918 | Open in IMG/M |
| 3300031720|Ga0307469_10421038 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1147 | Open in IMG/M |
| 3300031720|Ga0307469_11764305 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031740|Ga0307468_100054772 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300031740|Ga0307468_100366257 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1083 | Open in IMG/M |
| 3300031834|Ga0315290_11479162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 553 | Open in IMG/M |
| 3300032770|Ga0335085_10001596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 46800 | Open in IMG/M |
| 3300033407|Ga0214472_10021828 | All Organisms → cellular organisms → Bacteria | 6620 | Open in IMG/M |
| 3300033475|Ga0310811_11213933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 618 | Open in IMG/M |
| 3300033513|Ga0316628_103160761 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 600 | Open in IMG/M |
| 3300034074|Ga0373894_034862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 735 | Open in IMG/M |
| 3300034165|Ga0364942_0053267 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300034257|Ga0370495_0238773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 592 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.14% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 7.97% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.35% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 2.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.17% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.17% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 2.17% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.45% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.45% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.45% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.45% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.72% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.72% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.72% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
| 3300025521 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025979 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026888 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034074 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A4A4.1 | Engineered | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1052910222 | 3300000364 | Soil | MAAMRERFDDAELVELGLITAAFVMLGRLHRAFGVARMGPKSHAVLEDGAGTAAGKDT* |
| JGI11643J12802_121857171 | 3300000890 | Soil | TSMDDAFMAGMRERFTDPELVELGLITAAFVMLGRLHKTFGIAPMGPNSHAVLREG* |
| Ga0055435_100974661 | 3300003994 | Natural And Restored Wetlands | MSEMRAHFTDAELVELGLITGAFIVLGRLHRTFGVAPMGPRSHAVLERGYDP* |
| Ga0055438_100168433 | 3300003995 | Natural And Restored Wetlands | MSEMRAHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDP* |
| Ga0055438_102339472 | 3300003995 | Natural And Restored Wetlands | MTEMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMSPRSHAVLERGYSS* |
| Ga0062589_1001461213 | 3300004156 | Soil | VHFADDELVELGLLTGAFVMLGRLHRTFGVAPMTEASHAVLRPDGA* |
| Ga0062589_1012297121 | 3300004156 | Soil | FTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDS* |
| Ga0066397_100792801 | 3300004281 | Tropical Forest Soil | TAIDDAFMIDMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPCSYAVLEGGYGP* |
| Ga0063356_1008912591 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MARLRECFTDAEVVELGLITGAFIMLGRLHRTFGVTPMGPNSHRVLAGE* |
| Ga0062592_1005053271 | 3300004480 | Soil | AHAAIDDGFMASLRVHFADDELVELGLLTGAFVMLGRLHRTFGVAPMTEASHAVLRPDGA |
| Ga0062594_1002021981 | 3300005093 | Soil | MAGMRERFTDPELVELGLITAAFVMLGRLHKTFGIAPMGPNSHA |
| Ga0062594_1005351011 | 3300005093 | Soil | DHTSMDDAFMAGMRERFSDPELVELGLITAAFVMLGRLHKTFGVAPMGPNSHAVLREG* |
| Ga0062594_1007065332 | 3300005093 | Soil | DGFMASLRTHFAEDELVELGLITGAFVMLGRLHRTFGVAPMTEASHAVLRPDGP* |
| Ga0068998_101624501 | 3300005213 | Natural And Restored Wetlands | TTIDDAFMSEMRAHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDP* |
| Ga0065705_104175452 | 3300005294 | Switchgrass Rhizosphere | DDAFMTGMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRGHAVLERGYDA* |
| Ga0065707_104654832 | 3300005295 | Switchgrass Rhizosphere | VNHTTIDDAFMTGMRALFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDS* |
| Ga0065707_107460892 | 3300005295 | Switchgrass Rhizosphere | MDDAFMAGMRERFSDPELVELGLITAAFVMLGRLHKTFGVAPMGPNSHAVLREGRA |
| Ga0070676_101869073 | 3300005328 | Miscanthus Rhizosphere | MAGLRAHFADDELVELGLITGAFVMLGRLHRTFGVAPMTEASHAVLRPDGA* |
| Ga0068869_1015562742 | 3300005334 | Miscanthus Rhizosphere | MAGMRERFTDPELVELGLITAAFVMLGRLHKTFGIAPMGPNSHAVLREG* |
| Ga0070680_1006818872 | 3300005336 | Corn Rhizosphere | MAGMRERFSDPELVELGLITAAFVMLGRLHKTFGVAPMGPNSHAVLREGRAE* |
| Ga0068868_1023205022 | 3300005338 | Miscanthus Rhizosphere | DGFMASLRAHFADDELVELGLITGAFVMLGRLHRTFGVAPMTEASHAVLRPDGA* |
| Ga0070689_1022356282 | 3300005340 | Switchgrass Rhizosphere | MRTRFDDAELVELGLITGAFVMLGRLHRAFGVAPTGPQSHAVLADGAASGKDT* |
| Ga0070669_1010949252 | 3300005353 | Switchgrass Rhizosphere | MTIMRTRFDDAELVELGLITGAFVMLGRLHRAFGVAPTGPQSHAVLADGAASGKDT* |
| Ga0070701_105610731 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGMRERFSDPELVELGLITAAFVMLGRLHKTFGVAPMGPNSHAVLREG |
| Ga0070700_1011994741 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGMRERFSDPELVELGLITAAFVMLGRLHKTFGIAPMGPNSHAVLREG* |
| Ga0070694_1012682973 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MTALRAHFADDELVELGLVTGAFVMLGRLHRTFGVAPMTEASHAVLRPEGA* |
| Ga0070708_1010060551 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | FMAGMRERFSDPELVELGLITAAFVMLGRLHKTFGVAPMGPNSHAVLREG* |
| Ga0070707_1004975882 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GMRERFTDPELVELGLITAAFVMLGRLHKTFGIAPMGPNSHAVLREG* |
| Ga0073909_104792171 | 3300005526 | Surface Soil | RFSDPELVELGLITAAFVMLGRLHKAFDVAPMGPNSHAVLREG* |
| Ga0070696_1004037893 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VNHTTIDDAFMAGMRALFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDS* |
| Ga0070704_1001857552 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRGHAVLERGYDA* |
| Ga0068859_1014503512 | 3300005617 | Switchgrass Rhizosphere | LATEHTSIDDAFMTIMRTRFDDAELVELGLITGAFVMLGRLHRAFGVAPTGPQSHAVLADGAASGKDT* |
| Ga0068864_1017103701 | 3300005618 | Switchgrass Rhizosphere | AFMSGMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDA* |
| Ga0066905_1000774622 | 3300005713 | Tropical Forest Soil | MIDMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPCSYAVLEGGYGP* |
| Ga0068866_101618463 | 3300005718 | Miscanthus Rhizosphere | IDDGFMASLRAHFAEDELVELGLITGAFVMLGRLHRTFGVAPMTEASHAVLRPDGP* |
| Ga0068866_106094792 | 3300005718 | Miscanthus Rhizosphere | MAGMRERFSDPELVELGLITAAFVMLGRLHKAFGVAPMGPNSHAVLRER* |
| Ga0068862_1003069371 | 3300005844 | Switchgrass Rhizosphere | FTDAELVELGLITGAFIMLGRLHRTFGVAPMSPRSHAVLERGYDS* |
| Ga0068862_1012142332 | 3300005844 | Switchgrass Rhizosphere | MTIMRTRFDDAELVELGLITGAFVMLGRLHRAFGVAPMGPRSHAVLADGSGAASGKDT* |
| Ga0075023_1004342532 | 3300006041 | Watersheds | VNHTTIDDAFMTGMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLE |
| Ga0075430_1004994103 | 3300006846 | Populus Rhizosphere | LRRHLSDGEIVELGLVTAAFVMLGRLHRAFGIAEMPAASHAVLDGRS* |
| Ga0079217_113454682 | 3300006876 | Agricultural Soil | MARLRQVFSDAEVVELGLITAAFIMLGRLHRAFGVVPMGPHSHRVLAEG* |
| Ga0079218_111175042 | 3300007004 | Agricultural Soil | MAQLRQVFSDPEVVELGLITAAFIMLGRLHRAFGVVPMGPHSHRVLAEG* |
| Ga0079218_119572012 | 3300007004 | Agricultural Soil | DDVFIERMRRTLTDAELVELGLITGAFIVLGRLHRAFGVAPMGPRSHAVLAGTMPLPDTPDRKR* |
| Ga0099829_100051285 | 3300009038 | Vadose Zone Soil | MTEMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAILERGYNS* |
| Ga0105107_105459662 | 3300009087 | Freshwater Sediment | MIRMRTLFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDA* |
| Ga0105250_104132631 | 3300009092 | Switchgrass Rhizosphere | DDAFMAGMRALFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDA* |
| Ga0099792_107288571 | 3300009143 | Vadose Zone Soil | FMTEMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAILERGYNS* |
| Ga0105243_106115122 | 3300009148 | Miscanthus Rhizosphere | MDDAFMAGMRERFSDPELVELGLITAAFVMLGRLHKTFGIAPMGPNSHAVLREG* |
| Ga0105243_117328702 | 3300009148 | Miscanthus Rhizosphere | MTGMRAHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDS* |
| Ga0105094_104797292 | 3300009153 | Freshwater Sediment | DDAFMTEMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDP* |
| Ga0105242_106605172 | 3300009176 | Miscanthus Rhizosphere | MDDAFMAGMRERFTDPELVELGLITAAFVMLGRLHKTFGIAPMGPNSHAVLREG* |
| Ga0105249_101727502 | 3300009553 | Switchgrass Rhizosphere | MDDAFMAGMRERFSDPELVELGLITAAFVMLGRLHKTFGVAPMGPNSHAVLREGRAE* |
| Ga0105249_105776342 | 3300009553 | Switchgrass Rhizosphere | IDDAFMTGMRAHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDS* |
| Ga0134128_124405341 | 3300010373 | Terrestrial Soil | MDDAFMAGMRERFSDPELVELGLITAAFVMLGRLHKAFGVAPMGPNSHAVL |
| Ga0136847_107809052 | 3300010391 | Freshwater Sediment | MTGMRAHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDA* |
| Ga0136847_112341603 | 3300010391 | Freshwater Sediment | MTGMRQHFNDAELVELGLVTAAFTMLGRLHRTFGVAPMSPQSHAVLAGWPSSP* |
| Ga0136847_131889621 | 3300010391 | Freshwater Sediment | MAGMRERFSDPELVELGLITAAFVMLGRLHKTFGVAPIGPNSHAVPRKS* |
| Ga0134126_130870961 | 3300010396 | Terrestrial Soil | YKPKNLPELVELGLITAAFVMLGRLHKTFGVAPMGPNSHAVLREG* |
| Ga0134124_110457032 | 3300010397 | Terrestrial Soil | MDDAFMAGMRERFSDPELVELGLITAAFVMLGRLHKTFGVAPMGPNSHAVLREG* |
| Ga0134122_107040141 | 3300010400 | Terrestrial Soil | MDDAFMAGMRERFSDPELVELGLITAAFVMLGRLHKAFGVAPMGPNSHAVLREG* |
| Ga0134122_122454662 | 3300010400 | Terrestrial Soil | RERFSDPELVELGLITAAFVMLGRLHKTFGVAPMGPNSHAVLREG* |
| Ga0137442_10597722 | 3300011414 | Soil | MTGMRSHFSDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDA* |
| Ga0137388_119812412 | 3300012189 | Vadose Zone Soil | MRQQFTDAEVVELGLITGAFIMLGRLHRAFGVAPMGPRSHTVLEKG* |
| Ga0137383_110626251 | 3300012199 | Vadose Zone Soil | QQFTDAEVVELGLITGAFIMLGRLHRAFGVAPMGPRSHTVLEKG* |
| Ga0137367_100101726 | 3300012353 | Vadose Zone Soil | MDDAFMARMREVFDDAELIELGLVTGAFIVLGRLHRAFGVAPMDPRTHAALAERRMIG* |
| Ga0157295_102568561 | 3300012906 | Soil | MDDAFMAGMRERFSDPELVELGLITAAFVMLGRLHKTFGVAPMGPNSHTVLREG* |
| Ga0137404_112586972 | 3300012929 | Vadose Zone Soil | EMRRHFTDPELVELGLITGAFLMLGRLHLAFGVAAMPPATHDVLHPPGM* |
| Ga0137407_102670833 | 3300012930 | Vadose Zone Soil | VNHTTIDDAFMTGMRAHFTDAELVELGLITGAFIMLGRLHRTFGVPPMGPRSHAVLERGYDS* |
| Ga0153915_114838091 | 3300012931 | Freshwater Wetlands | MKRMREHFTDAEMVELGLIAGAFIMLGRLHRAFGVAPMGPRSHAVLEKGYGQ* |
| Ga0153915_115083712 | 3300012931 | Freshwater Wetlands | AGRLATSHTEIDDIFMQRMREHFTDAEMVELGLITGAFIMLGRLHRAFGVAPMGPRSHAVLEKGYGQ* |
| Ga0137410_105726102 | 3300012944 | Vadose Zone Soil | VNHTTIDDAFMTGMRAHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDS* |
| Ga0137410_106199842 | 3300012944 | Vadose Zone Soil | EKLAANHTTMDEAFMTGMRQHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDS* |
| Ga0164303_106158661 | 3300012957 | Soil | MASLRAHFAEDELVELGLITGAFVMLGRLHRTFGVAPMTEASHAVLRPDGP* |
| Ga0164304_113069172 | 3300012986 | Soil | AAIDDGFMASLRAHFAEDELVELGLITGAFVMLGRLHRTFGVAPMTEASHAVLRPDGP* |
| Ga0157378_119562852 | 3300013297 | Miscanthus Rhizosphere | MASLRAHFADDELVELGLITGAFVMLGRLHRTFGVAPMTEASHAVLRPDGA* |
| Ga0180063_10118983 | 3300014885 | Soil | EKLAAYQTTIDDAFMIRMRTLFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDS* |
| Ga0187824_100158212 | 3300017927 | Freshwater Sediment | MQRMREHFTDAEMVELGLIAGAFIMLGRLHRAFGVAPMGPRSHAVLEKGYGQ |
| Ga0187821_101974732 | 3300017936 | Freshwater Sediment | MQRMREHFTDAEMVELGLIAGAFIMLGRLHRAFAVAPMGPRSHAVLEKGYGQ |
| Ga0187823_100608083 | 3300017993 | Freshwater Sediment | MQRMREHFTDAEMVELGLIAGAFIMLGRLHRAFGVAPMGPRSHAVLEKEYGQ |
| Ga0184610_10719273 | 3300017997 | Groundwater Sediment | MTEMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPSCHAVLERGYDA |
| Ga0184638_10586943 | 3300018052 | Groundwater Sediment | MTGMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAILERGYNS |
| Ga0184632_100178793 | 3300018075 | Groundwater Sediment | MTGMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPSCHAVLERGYDA |
| Ga0184609_101850592 | 3300018076 | Groundwater Sediment | MTGMRSHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAILERGYNS |
| Ga0184639_100235576 | 3300018082 | Groundwater Sediment | MTGMRQHFNDAELVELGLVTAAFTMLGRLHRTFGVAPMSPQSHAVLAGWPSSP |
| Ga0190265_103454812 | 3300018422 | Soil | MRSHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGV |
| Ga0190265_107118103 | 3300018422 | Soil | MTRLRERFTDAEVVELGLITGAFIMLGRLHRTFGVEPMGPNSHRVLAGE |
| Ga0190272_106970522 | 3300018429 | Soil | MTGMRTHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYNA |
| Ga0173479_106386102 | 3300019362 | Soil | MAGMRERFTDPELVELGLITAAFVMLGRLHKTFGIAPMGPNSHAVLREG |
| Ga0193723_10058143 | 3300019879 | Soil | VNHTTIDDAFMTGMRALFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDS |
| Ga0193725_10210442 | 3300019883 | Soil | MTEMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAILERGYNS |
| Ga0193755_10048463 | 3300020004 | Soil | MTEMRRHFTDAELVELGLITGAFIMLGRLHRTFGGAPMGPRSHAILERGYNS |
| Ga0210378_100153253 | 3300021073 | Groundwater Sediment | MTGMRRHFTDAELVELGLITGAFIMLGRLHRTIGVAPMGPSCHAVLERGYDA |
| Ga0210382_100770672 | 3300021080 | Groundwater Sediment | MTGMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDA |
| Ga0193719_100799622 | 3300021344 | Soil | VNHTTIDDAFMTGMRALFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPSSHAVLERGYDA |
| Ga0222622_100774481 | 3300022756 | Groundwater Sediment | MSGMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDA |
| Ga0209108_101347133 | 3300025165 | Soil | MARMRESFSDAELVELGLVTAAFIMLGRLHRTFGVAPMGPKSHAVLAGP |
| Ga0209321_103578821 | 3300025312 | Soil | MARMRQSFSDAELVELGLITAAFIMLGRLHRTFGVAPMGPKSHTVLAGSPKEQSA |
| Ga0210083_10477883 | 3300025521 | Natural And Restored Wetlands | DDAFMIEMRAHFTDAELVELGLITGAFIVLGRLHRTFGVAPMGPGSHAVLERGYDP |
| Ga0207423_10097282 | 3300025535 | Natural And Restored Wetlands | MRNLRALFGDAEIVELGLVTGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDP |
| Ga0210131_10652382 | 3300025551 | Natural And Restored Wetlands | HFTDAELVELGLITGAFIVLGRLHRTFGVAPMGPRSHAVLERGYDP |
| Ga0210139_10447352 | 3300025558 | Natural And Restored Wetlands | RDRTGGPVRERFTDAELVELGLVSAAFIMLGRLHPTFGVAPMSSEGHRALRGEWSA |
| Ga0210108_10258552 | 3300025560 | Natural And Restored Wetlands | MSEMRAHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDP |
| Ga0210138_10029832 | 3300025580 | Natural And Restored Wetlands | MSEMRAHFTDAELVELGLITGAFIVLGRLHRTFGVAPMGPRSHAVLERGYDP |
| Ga0207660_108807492 | 3300025917 | Corn Rhizosphere | MAGMRERFSDPELVELGLITAAFVMLGRLHKTFGVAPMGPNSHAVLRED |
| Ga0207686_106068682 | 3300025934 | Miscanthus Rhizosphere | MAGMRERFSDPELVELGLITAAFVMLGRLHKTFGIAPMGPNSHAVLREG |
| Ga0207712_100609993 | 3300025961 | Switchgrass Rhizosphere | MAGMRERFSDPELVELGLITAAFVMLGRLHKTFGVAPMGPNSHAVLREGRAE |
| Ga0207712_101240821 | 3300025961 | Switchgrass Rhizosphere | IDDAFMTGMRAHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDS |
| Ga0210078_10569802 | 3300025979 | Natural And Restored Wetlands | TTIDDAFMSEMRAHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDP |
| Ga0207703_116410322 | 3300026035 | Switchgrass Rhizosphere | LATEHTSIDDAFMTIMRTRFDDAELVELGLITGAFVMLGRLHRAFGVAPTGPQSHAVLADGAASGKDT |
| Ga0207648_100504165 | 3300026089 | Miscanthus Rhizosphere | MAGLRAHFADDELVELGLITGAFVMLGRLHRTFGVAPMTEASHAVLRPDGA |
| Ga0209900_10212532 | 3300026888 | Groundwater Sand | MIQMRALFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDA |
| Ga0209706_102096523 | 3300027818 | Freshwater Sediment | MIRMRTLFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDA |
| Ga0209382_114819742 | 3300027909 | Populus Rhizosphere | MARLRRVFSDAEVVELGLITAAFIMLGRLHRAFGIVPMGPHSHRVLAEGV |
| Ga0268265_103233273 | 3300028380 | Switchgrass Rhizosphere | AGMRALFTDAELVELGLITGAFIMLGRLHRTFGVAPMSPRSHAVLERGYDS |
| Ga0268265_105686483 | 3300028380 | Switchgrass Rhizosphere | MTIMRTRFDDAELVELGLITGAFVMLGRLHRAFGVAPMGPRSHAVLADGSGAASGKDT |
| Ga0268264_124283372 | 3300028381 | Switchgrass Rhizosphere | MASLRAHFAEDELVELGLITGAFVMLGRLHRTFGVAPMTEASHAVLRPDGP |
| Ga0247823_115323872 | 3300028590 | Soil | DAFMTGMRAHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDS |
| Ga0247822_108418681 | 3300028592 | Soil | RALFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDA |
| Ga0307293_100338682 | 3300028711 | Soil | MSGMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPSSHAVLERGYDA |
| Ga0247825_110119222 | 3300028812 | Soil | VNHTAIDDAFMTGMRTHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDS |
| Ga0307302_104425711 | 3300028814 | Soil | AFMTGMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPSSHAVLERGYDA |
| (restricted) Ga0255311_10123662 | 3300031150 | Sandy Soil | VNHPAIDDAFMTGMRAHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDS |
| (restricted) Ga0255311_10192611 | 3300031150 | Sandy Soil | MTEMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYSS |
| (restricted) Ga0255312_10879112 | 3300031248 | Sandy Soil | MQRMREHFTDAEMVELGLIAGAFVMLGRLHRAFGVAPMGPRSHAVLEKGYGQ |
| Ga0307408_1006124902 | 3300031548 | Rhizosphere | MADLRSQFADDELIELGLVTAAFVMLGRLHRAFGVAPMTPGSHAVLRPEGA |
| Ga0307408_1006877023 | 3300031548 | Rhizosphere | MASLRAHFADDELVELGLITGAFVMLGRLHRTFGVAPMTEASHAVLRPDGA |
| Ga0307469_104210382 | 3300031720 | Hardwood Forest Soil | MIDMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLDGGYGP |
| Ga0307469_117643052 | 3300031720 | Hardwood Forest Soil | TDHAAIDDAFMAGLGAHFTDDELVELGLVTGAFVMLGRLHRTFGVAPMTEASHAVLRPEG |
| Ga0307468_1000547724 | 3300031740 | Hardwood Forest Soil | MAGLRAHFTDDELVELGLVTGAFVMLGRLHRTFGVAPMTEASHAVLRPEGA |
| Ga0307468_1003662572 | 3300031740 | Hardwood Forest Soil | MTGMRGHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGV |
| Ga0315290_114791621 | 3300031834 | Sediment | MAGMRERFSDPELVELGLITAAFVMLGRLHKAFGVAPMGPNSHAVLREG |
| Ga0335085_1000159631 | 3300032770 | Soil | MTGMRRHFSDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYGP |
| Ga0214472_100218285 | 3300033407 | Soil | MARMRRTFSDAELVELGLVTGAFIVLGRLHRAFGVAPMGPRSHAVLAGAMPAPDVAD |
| Ga0310811_112139331 | 3300033475 | Soil | MTDMRTRFDDAELVELGLISAAFVMLGRLHRAFGVAPMGPRSHAVLAAGAPTAPGKDT |
| Ga0316628_1031607612 | 3300033513 | Soil | MTEMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDP |
| Ga0373894_034862_389_577 | 3300034074 | Sediment Slurry | VNHTAIDDAFMIEMRRHFTDAELVELGLITGAFIMLGRLHRTFGVAPMGPRSHAVLERGYDP |
| Ga0364942_0053267_1129_1290 | 3300034165 | Sediment | MARMREAFSDAELVELGLITGAFIVLGRLHRAFGVAPMDPKTHAVLAERRMIE |
| Ga0370495_0238773_3_167 | 3300034257 | Untreated Peat Soil | MDDAFMAGMRERFSDPELVELGLITAAFVMLGRLHKTFGVAPMGPNSHAVLREG |
| ⦗Top⦘ |