


| Basic Information | |
|---|---|
| Family ID | F055284 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 40 residues |
| Representative Sequence | FSTYVIGRMMHRVLVENWEAEKAVEEAHKKVAEIYARHQEA |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.72 % |
| % of genes near scaffold ends (potentially truncated) | 93.53 % |
| % of genes from short scaffolds (< 2000 bps) | 93.53 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.086 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.583 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.338 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.446 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.07% β-sheet: 0.00% Coil/Unstructured: 44.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF01547 | SBP_bac_1 | 12.23 |
| PF00378 | ECH_1 | 5.04 |
| PF01494 | FAD_binding_3 | 4.32 |
| PF02182 | SAD_SRA | 3.60 |
| PF13416 | SBP_bac_8 | 3.60 |
| PF00296 | Bac_luciferase | 2.16 |
| PF03401 | TctC | 1.44 |
| PF05598 | DUF772 | 1.44 |
| PF05685 | Uma2 | 1.44 |
| PF07992 | Pyr_redox_2 | 1.44 |
| PF00528 | BPD_transp_1 | 1.44 |
| PF01594 | AI-2E_transport | 1.44 |
| PF07947 | YhhN | 1.44 |
| PF00691 | OmpA | 1.44 |
| PF01799 | Fer2_2 | 1.44 |
| PF02518 | HATPase_c | 1.44 |
| PF13378 | MR_MLE_C | 1.44 |
| PF00496 | SBP_bac_5 | 0.72 |
| PF13561 | adh_short_C2 | 0.72 |
| PF08028 | Acyl-CoA_dh_2 | 0.72 |
| PF09992 | NAGPA | 0.72 |
| PF03703 | bPH_2 | 0.72 |
| PF13592 | HTH_33 | 0.72 |
| PF12680 | SnoaL_2 | 0.72 |
| PF02775 | TPP_enzyme_C | 0.72 |
| PF00903 | Glyoxalase | 0.72 |
| PF02900 | LigB | 0.72 |
| PF00588 | SpoU_methylase | 0.72 |
| PF09754 | PAC2 | 0.72 |
| PF01740 | STAS | 0.72 |
| PF03404 | Mo-co_dimer | 0.72 |
| PF00144 | Beta-lactamase | 0.72 |
| PF13673 | Acetyltransf_10 | 0.72 |
| PF13450 | NAD_binding_8 | 0.72 |
| PF00753 | Lactamase_B | 0.72 |
| PF02738 | MoCoBD_1 | 0.72 |
| PF13676 | TIR_2 | 0.72 |
| PF12697 | Abhydrolase_6 | 0.72 |
| PF03400 | DDE_Tnp_IS1 | 0.72 |
| PF14863 | Alkyl_sulf_dimr | 0.72 |
| PF01989 | AcnX_swivel_put | 0.72 |
| PF06439 | 3keto-disac_hyd | 0.72 |
| PF02515 | CoA_transf_3 | 0.72 |
| PF07685 | GATase_3 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 8.63 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 4.32 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 4.32 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 4.32 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.16 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.44 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.44 |
| COG3714 | Uncharacterized membrane protein YhhN | Function unknown [S] | 1.44 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 1.44 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.72 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.72 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG1786 | Mevalonate 5-phosphate dehydratase subunit 2, swiveling domain (modified mevalonate pathway) | Lipid transport and metabolism [I] | 0.72 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.72 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.72 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.72 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.72 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.09 % |
| Unclassified | root | N/A | 7.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000443|F12B_10032727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18 | 1320 | Open in IMG/M |
| 3300001431|F14TB_100370762 | Not Available | 784 | Open in IMG/M |
| 3300004463|Ga0063356_103363271 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300005289|Ga0065704_10630629 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005332|Ga0066388_104758303 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005445|Ga0070708_100313120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1479 | Open in IMG/M |
| 3300005552|Ga0066701_10056510 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
| 3300005552|Ga0066701_10411160 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300005555|Ga0066692_10468941 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005559|Ga0066700_10917475 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300005569|Ga0066705_10013879 | All Organisms → cellular organisms → Bacteria | 3949 | Open in IMG/M |
| 3300005586|Ga0066691_10621732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300005598|Ga0066706_10337728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1192 | Open in IMG/M |
| 3300005713|Ga0066905_100851553 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300005843|Ga0068860_100131848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2398 | Open in IMG/M |
| 3300005937|Ga0081455_10590787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300006574|Ga0074056_11285216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 720 | Open in IMG/M |
| 3300006794|Ga0066658_10375999 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300006797|Ga0066659_11584628 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300006844|Ga0075428_100347438 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300006845|Ga0075421_100958397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 972 | Open in IMG/M |
| 3300006845|Ga0075421_101783580 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300006846|Ga0075430_100516148 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300006847|Ga0075431_100609143 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1075 | Open in IMG/M |
| 3300006853|Ga0075420_100861708 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300006871|Ga0075434_100763778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300006880|Ga0075429_100679543 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300006880|Ga0075429_101256854 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300006904|Ga0075424_101842566 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 640 | Open in IMG/M |
| 3300007255|Ga0099791_10667562 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300009012|Ga0066710_101858078 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300009012|Ga0066710_102531601 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 741 | Open in IMG/M |
| 3300009012|Ga0066710_103067664 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300009012|Ga0066710_104249293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300009012|Ga0066710_104858204 | Not Available | 503 | Open in IMG/M |
| 3300009089|Ga0099828_11705683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron | 554 | Open in IMG/M |
| 3300009090|Ga0099827_10354031 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1249 | Open in IMG/M |
| 3300009090|Ga0099827_10699853 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300009090|Ga0099827_10767402 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300009090|Ga0099827_11273030 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300009090|Ga0099827_11597769 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
| 3300009094|Ga0111539_10487483 | Not Available | 1436 | Open in IMG/M |
| 3300009100|Ga0075418_11972014 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300009100|Ga0075418_12467920 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300009137|Ga0066709_101548377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 953 | Open in IMG/M |
| 3300009137|Ga0066709_102174715 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300009147|Ga0114129_11886265 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300009162|Ga0075423_11600902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300009444|Ga0114945_10033129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2782 | Open in IMG/M |
| 3300009553|Ga0105249_10956106 | Not Available | 925 | Open in IMG/M |
| 3300009691|Ga0114944_1010132 | All Organisms → cellular organisms → Bacteria | 3099 | Open in IMG/M |
| 3300009691|Ga0114944_1063535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1369 | Open in IMG/M |
| 3300009792|Ga0126374_10356012 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300009792|Ga0126374_10577280 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300009795|Ga0105059_1028448 | Not Available | 654 | Open in IMG/M |
| 3300009807|Ga0105061_1080732 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
| 3300010043|Ga0126380_11924468 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300010047|Ga0126382_10132219 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300010047|Ga0126382_10314532 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300010047|Ga0126382_10994693 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300010047|Ga0126382_11185536 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300010047|Ga0126382_12215790 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300010114|Ga0127460_1054222 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300010166|Ga0126306_11385756 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010359|Ga0126376_12958324 | Not Available | 525 | Open in IMG/M |
| 3300010362|Ga0126377_11871277 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300010362|Ga0126377_12722489 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010362|Ga0126377_13459464 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300010391|Ga0136847_11942537 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300010398|Ga0126383_11439370 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300010399|Ga0134127_10568367 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300011270|Ga0137391_10195826 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300011271|Ga0137393_10815801 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300012199|Ga0137383_10145675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1733 | Open in IMG/M |
| 3300012205|Ga0137362_11423790 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012209|Ga0137379_11275721 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300012210|Ga0137378_10140437 | All Organisms → cellular organisms → Bacteria | 2235 | Open in IMG/M |
| 3300012211|Ga0137377_11322462 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300012349|Ga0137387_10907946 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Tautonia → Tautonia rosea | 636 | Open in IMG/M |
| 3300012349|Ga0137387_11297590 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012351|Ga0137386_10632927 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300012353|Ga0137367_10750173 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012355|Ga0137369_10217877 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300012363|Ga0137390_11611804 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 586 | Open in IMG/M |
| 3300012392|Ga0134043_1291387 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
| 3300012532|Ga0137373_10274006 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300012685|Ga0137397_10696882 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300012917|Ga0137395_10183042 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300012918|Ga0137396_11071953 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012922|Ga0137394_10724466 | Not Available | 836 | Open in IMG/M |
| 3300012922|Ga0137394_11251875 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012929|Ga0137404_11072248 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300012944|Ga0137410_11216126 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012948|Ga0126375_11744361 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012971|Ga0126369_12567237 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 594 | Open in IMG/M |
| 3300013306|Ga0163162_10573516 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300014154|Ga0134075_10016124 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2931 | Open in IMG/M |
| 3300015053|Ga0137405_1358787 | All Organisms → cellular organisms → Bacteria | 3039 | Open in IMG/M |
| 3300015248|Ga0180079_1026002 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300016445|Ga0182038_11385121 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300017792|Ga0163161_11284660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium | 636 | Open in IMG/M |
| 3300018078|Ga0184612_10409589 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 680 | Open in IMG/M |
| 3300018433|Ga0066667_10316915 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300018466|Ga0190268_11559395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Xenophilus → unclassified Xenophilus → Xenophilus sp. L33 | 578 | Open in IMG/M |
| 3300019233|Ga0184645_1002632 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300019248|Ga0180117_1403992 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300019259|Ga0184646_1182014 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300020197|Ga0194128_10155368 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300025149|Ga0209827_11082166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1859 | Open in IMG/M |
| 3300025910|Ga0207684_10345954 | Not Available | 1280 | Open in IMG/M |
| 3300025922|Ga0207646_10253667 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1589 | Open in IMG/M |
| 3300025922|Ga0207646_10264419 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300026524|Ga0209690_1246516 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300026535|Ga0256867_10246717 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300027675|Ga0209077_1165741 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300027873|Ga0209814_10150128 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300027874|Ga0209465_10098513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Vitiosangium → unclassified Vitiosangium → Vitiosangium sp. GDMCC 1.1324 | 1433 | Open in IMG/M |
| 3300027882|Ga0209590_10405831 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 880 | Open in IMG/M |
| 3300027909|Ga0209382_10571688 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300027957|Ga0209857_1060142 | Not Available | 659 | Open in IMG/M |
| 3300027961|Ga0209853_1025838 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300028673|Ga0257175_1015641 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1209 | Open in IMG/M |
| 3300030006|Ga0299907_11037224 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300030006|Ga0299907_11268895 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300030574|Ga0247648_1089998 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300030608|Ga0247651_10054388 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300030830|Ga0308205_1048054 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300030902|Ga0308202_1098894 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300031092|Ga0308204_10006111 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300031092|Ga0308204_10183664 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031572|Ga0318515_10710200 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031908|Ga0310900_10288235 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300031908|Ga0310900_10990205 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 691 | Open in IMG/M |
| 3300032180|Ga0307471_100356139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1576 | Open in IMG/M |
| 3300032180|Ga0307471_102286778 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300032205|Ga0307472_102408782 | Not Available | 534 | Open in IMG/M |
| 3300034659|Ga0314780_178834 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300034676|Ga0314801_178557 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.76% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.88% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.16% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.72% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.72% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015248 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10D | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300025149 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030574 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030608 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F12B_100327272 | 3300000443 | Soil | EVLATYVIGRMMHRVLVENWNVEKAVVEAHKKAQDIYARYQGA* |
| F14TB_1003707621 | 3300001431 | Soil | IGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQA* |
| Ga0063356_1033632712 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GEVYATTVLARMVHRVVVDNWEAEKAVKEAHNKIVEIYARWPEG* |
| Ga0065704_106306291 | 3300005289 | Switchgrass Rhizosphere | LATYTIGRMMHRVLVESWNVEKAVVEAHKKAQDIYNRYQGA* |
| Ga0066388_1047583031 | 3300005332 | Tropical Forest Soil | EVSSTYVIGRMMHRVLVDYWAAEKAVEEAHKKAVEIYARYQEG* |
| Ga0070708_1003131201 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EVLATFTIGRMMHRVLVESWNVEKAVAEAHKKVAEIYARHQRG* |
| Ga0066701_100565105 | 3300005552 | Soil | GEVLATFVIGRMMHRVLVESWNVEKAVVEAHQKVVEIYKRHQAG* |
| Ga0066701_104111601 | 3300005552 | Soil | ARMMHRVLVEHWEVEKAVEETHKQVAEIYARHAAG* |
| Ga0066692_104689413 | 3300005555 | Soil | ASGEVLATFVIGRMMHRVLVESWNVEKAVVEAHQKVVEIYKRHQAG* |
| Ga0066700_109174751 | 3300005559 | Soil | IGRMMHRVLVENWEAEKAVEEAHKKAVEIYARYQEA* |
| Ga0066705_100138795 | 3300005569 | Soil | RMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA* |
| Ga0066691_106217322 | 3300005586 | Soil | RMMHRVLVESWNVEKAVVEAHKKVAEIYKRHQAG* |
| Ga0066706_103377283 | 3300005598 | Soil | ATFVIGRMMHRVLVESWNVEKAVVEAHKKVAEIYKRHQAG* |
| Ga0066905_1008515533 | 3300005713 | Tropical Forest Soil | GEVSSTYVIGRMMHRVLVDYWAAEKAVEEAHKKAVEIYARYQEG* |
| Ga0068860_1001318483 | 3300005843 | Switchgrass Rhizosphere | VIGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQA* |
| Ga0081455_105907872 | 3300005937 | Tabebuia Heterophylla Rhizosphere | RMIQRVLVESWEAEKAVEEAHKKVVEIYARYPEG* |
| Ga0074056_112852161 | 3300006574 | Soil | AASGEVLATFVIGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQT* |
| Ga0066658_103759992 | 3300006794 | Soil | VGEVSSTYMIGRMMHRVLVENWEAEKAVEEAHKKVVEIYARHQEA* |
| Ga0066659_115846281 | 3300006797 | Soil | STYLIGRMMHRVLVENWEAEKAVEEAHKKVVEIYARHQEA* |
| Ga0075428_1003474384 | 3300006844 | Populus Rhizosphere | TIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA* |
| Ga0075421_1009583971 | 3300006845 | Populus Rhizosphere | VLATFTIGRMMHRVLVESWTAEKAVEEAHKKVAEIYARHHQGRA* |
| Ga0075421_1017835803 | 3300006845 | Populus Rhizosphere | LATYTIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA* |
| Ga0075430_1005161482 | 3300006846 | Populus Rhizosphere | ATYTISRMLHRVLAENWEAERAVKEAHKKVVEIYARHQEG* |
| Ga0075431_1006091432 | 3300006847 | Populus Rhizosphere | IGRMMHRVLVENWEAEKAVEEAHKKIVEIYARHQEA* |
| Ga0075420_1008617082 | 3300006853 | Populus Rhizosphere | AAGEVIATNVLARMMHRVLVEEWEAEKAVEEAHKKIVEIYTRAAQG* |
| Ga0075434_1007637782 | 3300006871 | Populus Rhizosphere | AAGEVLATYVIGRMMHRVLVESWNIEKAVVEAHKKVQDIYARYQGA* |
| Ga0075429_1006795431 | 3300006880 | Populus Rhizosphere | RMMHRVLVDNWEAEKAVEEAHNKVVEIYARYPEG* |
| Ga0075429_1012568541 | 3300006880 | Populus Rhizosphere | TSVLARMMHHVLVDGWEAEKAVEEAHKKVVEIYARYPEG* |
| Ga0075424_1018425661 | 3300006904 | Populus Rhizosphere | RMMHRVLVESWNVEKAVVEAHKKAQDIYNRYQGA* |
| Ga0099791_106675622 | 3300007255 | Vadose Zone Soil | ATFVIGRMMHRVLVESWNAEKAVGEAHKKVAEIYKRHQAG* |
| Ga0066710_1018580781 | 3300009012 | Grasslands Soil | STYLIGRMMHRVLVENWEAEKAVEEAHKKVAEIYARHQET |
| Ga0066710_1025316011 | 3300009012 | Grasslands Soil | YTIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA |
| Ga0066710_1030676642 | 3300009012 | Grasslands Soil | ATFTIGRMMHRVLVESWAVEKAVAEAHKKVAEIYARHQKA |
| Ga0066710_1042492931 | 3300009012 | Grasslands Soil | TYTIGRMMHRVLVENWNVEKAVVEAHKKVAEIYARYQGA |
| Ga0066710_1048582042 | 3300009012 | Grasslands Soil | GEVLATFTIGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQKG |
| Ga0099828_117056832 | 3300009089 | Vadose Zone Soil | MMHRALVENLEAEKAVEEAHKKVVEIYAHNQGES* |
| Ga0099827_103540312 | 3300009090 | Vadose Zone Soil | MMHRALVENLEAEKAVEEAHKKVVEIYAHNQEES* |
| Ga0099827_106998531 | 3300009090 | Vadose Zone Soil | TTYVIARMMHRVLVEHWEVEKAVEETHKQVAEIYARHAAG* |
| Ga0099827_107674022 | 3300009090 | Vadose Zone Soil | TIGRMMHRVLVENWNVEKAVVEAHKKVAEIYARHQKE* |
| Ga0099827_112730302 | 3300009090 | Vadose Zone Soil | ASGEVLATYTIGHMLHRVLVESWEVEKAVEETHKKVAEIYARHQEG* |
| Ga0099827_115977692 | 3300009090 | Vadose Zone Soil | GRMMHRVLVENWEAEKAVEEAHKKTVEIYARHQEG* |
| Ga0111539_104874831 | 3300009094 | Populus Rhizosphere | VLGHMIQRVLVEGWEAEKAVEEAHTKVAAIYARHQEA* |
| Ga0075418_119720142 | 3300009100 | Populus Rhizosphere | LARMMHHVLVDNWEPEKAVEEAHNKVVEIYARYPEG* |
| Ga0075418_124679201 | 3300009100 | Populus Rhizosphere | RMVHRVLVDHWEAEKAVEDAHRQAVEIYARYPEG* |
| Ga0066709_1015483772 | 3300009137 | Grasslands Soil | YTIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA* |
| Ga0066709_1021747152 | 3300009137 | Grasslands Soil | VLATFVIGRMMHRVLVESWNAEKAVEEAHKKVATIYARHQAA* |
| Ga0114129_118862651 | 3300009147 | Populus Rhizosphere | IGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA* |
| Ga0075423_116009021 | 3300009162 | Populus Rhizosphere | EVLATFTIGRMMHRVLVENWPVEKSVEEAHKKVAEIYARHNKG* |
| Ga0114945_100331296 | 3300009444 | Thermal Springs | EVLGTYVIGRMMHRVLVESWAAENAVEEAHKKVVEIYARHQEA* |
| Ga0105249_109561062 | 3300009553 | Switchgrass Rhizosphere | GHMIQRVLVEGWEAEKAVAEAHTKVAAIYARHQDA* |
| Ga0114944_10101323 | 3300009691 | Thermal Springs | MMHRVLVENWEAEKAVEEAHKKVAEIYARHQQES* |
| Ga0114944_10635352 | 3300009691 | Thermal Springs | VFATSVISRIMHRVLVENWAAEKAVEEAHKKVVEIYARQQQES* |
| Ga0126374_103560123 | 3300009792 | Tropical Forest Soil | HTYVLGRMMHRVLVENWEAEKAVEEAHKKTVEIYARHQEA* |
| Ga0126374_105772801 | 3300009792 | Tropical Forest Soil | HMMHRVLVEAWEVEKAVAEAHKKVAEIYARHQEEG* |
| Ga0105059_10284482 | 3300009795 | Groundwater Sand | RMMHRVLVESWEAEKAVEEAHKKVAEIYARHQES* |
| Ga0105061_10807321 | 3300009807 | Groundwater Sand | GEVLATFVIGRMMHRVLVENWDVEKAVVEAHKKVAEIYARHQKG* |
| Ga0126380_119244681 | 3300010043 | Tropical Forest Soil | TYVIGHMMHRVLVEAWEVEKAVAEAHKKVAEIYARHQEEG* |
| Ga0126382_101322192 | 3300010047 | Tropical Forest Soil | TIGHMIQRVLVENWEAEKAVEEAHKKVVEIYARYQEA* |
| Ga0126382_103145321 | 3300010047 | Tropical Forest Soil | VSSTYVIGRMMHRVLVDYWAAEKAVEEAHKKAVEIYARYQEG* |
| Ga0126382_109946931 | 3300010047 | Tropical Forest Soil | LATFVIGRMMHRVLVENWNAEKAVEEAHKRVAEIYARYQGT* |
| Ga0126382_111855362 | 3300010047 | Tropical Forest Soil | YTIGHMIQRVLVENWEAEKAVEEAHKKVVEIYARY* |
| Ga0126382_122157901 | 3300010047 | Tropical Forest Soil | IGRMMHRVLVENWNVEKAVVEAHKKVADIYARHNKG* |
| Ga0127460_10542221 | 3300010114 | Grasslands Soil | RVMHRVLVEHWEVEKAVEETHKQVAEIYARHAAG* |
| Ga0126306_113857562 | 3300010166 | Serpentine Soil | ISRMVHWVLVENWEVEKAVEEAHKKVVEIYARYGEG* |
| Ga0126376_129583242 | 3300010359 | Tropical Forest Soil | MMHRVLVENWEAEKAAEEAHKKVAEIYARQGEEG* |
| Ga0126377_118712771 | 3300010362 | Tropical Forest Soil | TFTIGHMIQRVLVENWEAEKAVEEAHKKVVEIYARYQEG* |
| Ga0126377_127224891 | 3300010362 | Tropical Forest Soil | ATYVIGHMLHRVLVESWEVEKAVEEAHKKVAEIYARHQEEG* |
| Ga0126377_134594642 | 3300010362 | Tropical Forest Soil | VIGRMLHRVLVENWEAEKAVEEAHKKVVEIYARYPQG* |
| Ga0136847_119425371 | 3300010391 | Freshwater Sediment | TFVIGRMMHRVLVENWNVEKAVVEAHKKVAEIYARHQAASGR* |
| Ga0126383_114393701 | 3300010398 | Tropical Forest Soil | LGTYTIGHMIQRVLVENWEAEKAVEEAHKKVAEIYARYQEA* |
| Ga0134127_105683671 | 3300010399 | Terrestrial Soil | SGEVLATYTIGRMMHRVLVESWNVEKAVVEAHKKAQDIYSRYQGA* |
| Ga0137391_101958261 | 3300011270 | Vadose Zone Soil | TFVIGHMMHRVLVESWEAEKAVEEAHKKVVEIYARYQEG* |
| Ga0137393_108158011 | 3300011271 | Vadose Zone Soil | IGHMMHRVLVESWEAEKAVVEAHKKVVEIYARYQEG* |
| Ga0137383_101456751 | 3300012199 | Vadose Zone Soil | TYVIGHMLHRVLVDTWEAEKAVEEAHKKVAAIYARYQEE* |
| Ga0137362_114237901 | 3300012205 | Vadose Zone Soil | SGEVLATYVIGHMMHRVLVENWEAEKAVEEAHKKAVEIYARYAEG* |
| Ga0137379_112757212 | 3300012209 | Vadose Zone Soil | ATYVIGHMIQRVLVESWEAEKAVAEAHKKVAEIYARYQEE* |
| Ga0137378_101404372 | 3300012210 | Vadose Zone Soil | GEVMHTYVLGRMMHRVLVENWAAEKAVEEAHKKIVEIYARYQEA* |
| Ga0137377_113224622 | 3300012211 | Vadose Zone Soil | FSTYVIGRMMHRVLVENWEAEKAVEEAHKKVAEIYARHQEA* |
| Ga0137387_109079462 | 3300012349 | Vadose Zone Soil | LGTYTIGHMIQRVLVEHWEAEKAVEETHKQVAEIYARHAAG* |
| Ga0137387_112975903 | 3300012349 | Vadose Zone Soil | VGEVMHTYVIGRMMHRVLVENWESEKAVEEAHKKSVEIYARHQEV* |
| Ga0137386_106329272 | 3300012351 | Vadose Zone Soil | ATYTIGHMLHRVLVENWEAEKAVEEAHKKVVEIYARYQEA* |
| Ga0137367_107501733 | 3300012353 | Vadose Zone Soil | VMHTYVLGRMMHRVLVENWEAEKAVEEAHKKTVEIYARHQEV* |
| Ga0137369_102178771 | 3300012355 | Vadose Zone Soil | STYVMGRMMHRVLVENWEAEKAVEEAHKKVAEIYARHQEA* |
| Ga0137390_116118042 | 3300012363 | Vadose Zone Soil | VLATFVIGRMMHRVLVESWNVEKAVVEAHKKAAEIYARHQAG* |
| Ga0134043_12913871 | 3300012392 | Grasslands Soil | RMMHRVLVENWEAEKAVEEAHKQVAEIYARHQEA* |
| Ga0137373_102740061 | 3300012532 | Vadose Zone Soil | MARMMHRVLVEHWEVEKAVEETHKQVAEIYARHAAG* |
| Ga0137397_106968823 | 3300012685 | Vadose Zone Soil | VLATYVIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA* |
| Ga0137395_101830423 | 3300012917 | Vadose Zone Soil | EVMHTYVRGRMMHRVLVESWEAEKAVEEAHKKIAEIYARHQEA* |
| Ga0137396_110719531 | 3300012918 | Vadose Zone Soil | IGRMMHRVLVESWNVEKAVVEAHRKVAEIYARYQGA* |
| Ga0137394_107244663 | 3300012922 | Vadose Zone Soil | AGEVLATYVIGRMMHRVLVESWNVEKAVEEAHKKVVEIYKRHQVG* |
| Ga0137394_112518752 | 3300012922 | Vadose Zone Soil | EVLATYVLGRMMHRVLVESWNAEKAVVEAHKKVAEIYARHQAA* |
| Ga0137404_110722481 | 3300012929 | Vadose Zone Soil | EVTGTYVMGRMIQRVLVEHWEAEKAVEEAHKKVVAMYARYPEG* |
| Ga0137410_112161261 | 3300012944 | Vadose Zone Soil | LGHMIQRVLVDNWEAEKAVEEAHKKVVEIYARYPEG* |
| Ga0126375_117443612 | 3300012948 | Tropical Forest Soil | TIGHMIQRVLVENWEAEKAVEEAHKKVVEIYARYPEA* |
| Ga0126369_125672371 | 3300012971 | Tropical Forest Soil | VLQRAVVLPHTLHRVLVENWEAAQAVEEAHKKAVEIYAHHQ |
| Ga0163162_105735161 | 3300013306 | Switchgrass Rhizosphere | GEVLTTYVIGRMIQRVLVESWEVEKAVEEAHKQIAEIYARYQEA* |
| Ga0134075_100161245 | 3300014154 | Grasslands Soil | GEVLATYVIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARHQAG* |
| Ga0137405_13587876 | 3300015053 | Vadose Zone Soil | VLATFVIGRMMHRVLVESWNAEKAVVEAHKKVAEIYKRHQAG* |
| Ga0180079_10260021 | 3300015248 | Soil | VLATYTIGRMMHRVLVESWPAEKAVEEAHKKAAEIYARYQKG* |
| Ga0182038_113851211 | 3300016445 | Soil | VGTTYVIARMMHRVLVEYWEAEKAVEETHKQVAEIYARHAAG |
| Ga0163161_112846602 | 3300017792 | Switchgrass Rhizosphere | TFVIGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQA |
| Ga0184612_104095891 | 3300018078 | Groundwater Sediment | SHNPASGEVLATFVLGRMMHRVLVESWNVEKAVVEAHKKVAEIYARHQAG |
| Ga0066667_103169151 | 3300018433 | Grasslands Soil | EVLATYTIGHMLHRVLVENWEAEKAVEEAHKKVAEIYARYQEA |
| Ga0190268_115593951 | 3300018466 | Soil | AAGEVLATFTIGRMMHRVLVESWPAEKAVEEAHKKVATIYARYQGG |
| Ga0184645_10026322 | 3300019233 | Groundwater Sediment | VGEVGTTYVMARMMHRVLVEHWEAEKAVEETHKQVAEIYARHAAG |
| Ga0180117_14039921 | 3300019248 | Groundwater Sediment | MHTYVLGRMMHRVLVENWEVEKAVEEAHKKTVEIYARHQEA |
| Ga0184646_11820141 | 3300019259 | Groundwater Sediment | VTNVISRMVHWVLVENWEAEKAVEEAHKKVVEIYARYAEG |
| Ga0194128_101553682 | 3300020197 | Freshwater Lake | VVATNVLARMMHRVLIENWEVEKAVEEAHKKVVEIYARAAQAG |
| Ga0209827_110821661 | 3300025149 | Thermal Springs | VFATSVISRIMHRVLVENWAAEKAVEEAHKKVVEIYARQQQES |
| Ga0207684_103459542 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ATQVISRTMHRVLVENWEAEKAVEEAHKKAAEIYARHQVGSY |
| Ga0207646_102536673 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TQVISRTMHRVLVENWEAEKAVEEAHKKAAEIYARHQVGS |
| Ga0207646_102644194 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VFSTYVIGRMMHRVLVETWEAEKAVEEAHKKTAEIYARHQEG |
| Ga0209690_12465161 | 3300026524 | Soil | LATFVIGRMMHRVLVESWNVEKAVVEAHQKVVEIYKRHQAG |
| Ga0256867_102467172 | 3300026535 | Soil | AGEIYATGVLARMMHRVLVDNVEAEKAVEEAHKNVVEIYARWPEG |
| Ga0209077_11657412 | 3300027675 | Freshwater Sediment | VTTTMARMMHRVLVENWEAEKAVEDAHKKVVDIYARYPEG |
| Ga0209814_101501281 | 3300027873 | Populus Rhizosphere | AGEVLATYVIGRMMHRVLVESWNVEKAVVEAHKKAQDIYNRYQGA |
| Ga0209465_100985131 | 3300027874 | Tropical Forest Soil | VIGRMIHRVLVEHWEAEKAVEEAHKKVVEIYARYQEA |
| Ga0209590_104058312 | 3300027882 | Vadose Zone Soil | MPRMMHRALVENLEAEKAVEEAHKKVVEIYAHNQEES |
| Ga0209382_105716882 | 3300027909 | Populus Rhizosphere | AGEVLATSVLARMMHRVLVESWEAEPAVEEAHKKVVEIYARYPEG |
| Ga0209857_10601421 | 3300027957 | Groundwater Sand | SVMSRIMHRVLVENWEAEKAVEEAHKKAAEIYARHQKG |
| Ga0209853_10258381 | 3300027961 | Groundwater Sand | ATFVIGRMMHRVLVESWDVEKAVVEAHKKVAEIYARHQKG |
| Ga0257175_10156411 | 3300028673 | Soil | VLATFVIGRMMHRVLVESWNVEKAVVEAHKKAAEIYARHQAG |
| Ga0299907_110372242 | 3300030006 | Soil | EIYATGVLARMMHRVLVDNVEAEKAVEDAHKNVVEIYARWPEG |
| Ga0299907_112688952 | 3300030006 | Soil | LARMVQQVLVENREPEKAVEEAHKRVVEIYARYQEG |
| Ga0247648_10899982 | 3300030574 | Soil | GNVLARMMQRVLVESWEAEKAVEEAHKKVVEIYARSDG |
| Ga0247651_100543881 | 3300030608 | Soil | TNVIARMMHHVLVENWEAEKAVEEAHKKAVEIYARHAAGG |
| Ga0308205_10480541 | 3300030830 | Soil | LIGRMMHRVLVENWEAEKAVEEAHKKTVEIYARHQEA |
| Ga0308202_10988942 | 3300030902 | Soil | YMLGRMMHRVLVENWEAEKAVEEAHKKTAEIYARHQEG |
| Ga0308204_100061112 | 3300031092 | Soil | ASGEVLATYTIGRMLHRVLVENWEAERAVEEAHKKVVEIYARYQEA |
| Ga0308204_100252572 | 3300031092 | Soil | ATNVLSHMVQRVLVENVAAEKAVEEAHKQVVEIYARFQG |
| Ga0308204_101836642 | 3300031092 | Soil | EVYATNVLARMTQRVLIENLEAEKAVEEAHKKVAEIYARYQEV |
| Ga0318515_107102002 | 3300031572 | Soil | VIGRMMHRVLVESWNVEKAVVEAHKKVADIYARYQGA |
| Ga0310900_102882351 | 3300031908 | Soil | VLATFTLGHMMHRVLVENWEAEKAVEEAHKKVVDIYARYQEA |
| Ga0310900_109902051 | 3300031908 | Soil | SSTYVIGRMMHRVLVENWEAEKAVEEAHKKIVEIYARHQEA |
| Ga0307471_1003561393 | 3300032180 | Hardwood Forest Soil | GRMMHRVLVENWNVEKAVVEAHQKVAQVYARHAKG |
| Ga0307471_1022867783 | 3300032180 | Hardwood Forest Soil | TYTIGRMMHRVLVESWNAEKAVVEAHKKVAEIYARHQKG |
| Ga0307472_1024087822 | 3300032205 | Hardwood Forest Soil | TDVLAHMMHRVLVENWEAEKAVEEAHHQVVAIYARYPEG |
| Ga0314780_178834_408_536 | 3300034659 | Soil | VLATYTIGRMLHHVLVENWEAEKAVEEAHKKVVEIYARYPEG |
| Ga0314801_178557_21_149 | 3300034676 | Soil | VLATYTIGRMLQRVLVENWEAEKAVEEAHKKVVEIYARYPEG |
| ⦗Top⦘ |