


| Basic Information | |
|---|---|
| Family ID | F055268 |
| Family Type | Metagenome |
| Number of Sequences | 139 |
| Average Sequence Length | 40 residues |
| Representative Sequence | SREWVSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNA |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 99.28 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.043 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (41.727 % of family members) |
| Environment Ontology (ENVO) | Unclassified (83.453 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.647 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 50.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF12957 | DUF3846 | 24.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.96 % |
| Unclassified | root | N/A | 46.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10206062 | Not Available | 655 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10282596 | Not Available | 505 | Open in IMG/M |
| 3300001353|JGI20159J14440_10144511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 696 | Open in IMG/M |
| 3300001450|JGI24006J15134_10191136 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 633 | Open in IMG/M |
| 3300001450|JGI24006J15134_10214573 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 576 | Open in IMG/M |
| 3300001460|JGI24003J15210_10146300 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp. | 610 | Open in IMG/M |
| 3300001460|JGI24003J15210_10156073 | Not Available | 578 | Open in IMG/M |
| 3300001589|JGI24005J15628_10092501 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
| 3300001720|JGI24513J20088_1029439 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 560 | Open in IMG/M |
| 3300002242|KVWGV2_10017649 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
| 3300002242|KVWGV2_10491011 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300002482|JGI25127J35165_1044597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 977 | Open in IMG/M |
| 3300002484|JGI25129J35166_1025788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1291 | Open in IMG/M |
| 3300002488|JGI25128J35275_1045342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 970 | Open in IMG/M |
| 3300005430|Ga0066849_10106460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1113 | Open in IMG/M |
| 3300005601|Ga0070722_10557320 | Not Available | 519 | Open in IMG/M |
| 3300006735|Ga0098038_1124189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 875 | Open in IMG/M |
| 3300006735|Ga0098038_1129545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 852 | Open in IMG/M |
| 3300006735|Ga0098038_1228193 | Not Available | 594 | Open in IMG/M |
| 3300006735|Ga0098038_1228790 | Not Available | 593 | Open in IMG/M |
| 3300006735|Ga0098038_1257067 | Not Available | 550 | Open in IMG/M |
| 3300006737|Ga0098037_1065167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1295 | Open in IMG/M |
| 3300006749|Ga0098042_1155444 | Not Available | 559 | Open in IMG/M |
| 3300006793|Ga0098055_1137450 | Not Available | 944 | Open in IMG/M |
| 3300006803|Ga0075467_10174094 | All Organisms → Viruses → environmental samples → uncultured virus | 1216 | Open in IMG/M |
| 3300006916|Ga0070750_10364160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 608 | Open in IMG/M |
| 3300006919|Ga0070746_10501041 | Not Available | 533 | Open in IMG/M |
| 3300006921|Ga0098060_1128084 | All Organisms → Viruses → environmental samples → uncultured virus | 710 | Open in IMG/M |
| 3300006928|Ga0098041_1162546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 717 | Open in IMG/M |
| 3300006928|Ga0098041_1240181 | Not Available | 578 | Open in IMG/M |
| 3300006929|Ga0098036_1104714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 869 | Open in IMG/M |
| 3300007229|Ga0075468_10215730 | Not Available | 554 | Open in IMG/M |
| 3300007538|Ga0099851_1075359 | Not Available | 1303 | Open in IMG/M |
| 3300007538|Ga0099851_1297595 | Not Available | 570 | Open in IMG/M |
| 3300007541|Ga0099848_1287381 | Not Available | 567 | Open in IMG/M |
| 3300007543|Ga0102853_1072687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 622 | Open in IMG/M |
| 3300008216|Ga0114898_1187611 | Not Available | 580 | Open in IMG/M |
| 3300009001|Ga0102963_1118233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1076 | Open in IMG/M |
| 3300009433|Ga0115545_1117662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 949 | Open in IMG/M |
| 3300009435|Ga0115546_1333677 | Not Available | 516 | Open in IMG/M |
| 3300009476|Ga0115555_1343631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 597 | Open in IMG/M |
| 3300009481|Ga0114932_10278482 | Not Available | 1005 | Open in IMG/M |
| 3300009481|Ga0114932_10710270 | Not Available | 585 | Open in IMG/M |
| 3300009488|Ga0114925_11289710 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 538 | Open in IMG/M |
| 3300009507|Ga0115572_10336988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 851 | Open in IMG/M |
| 3300009507|Ga0115572_10710970 | Not Available | 546 | Open in IMG/M |
| 3300009602|Ga0114900_1160473 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 575 | Open in IMG/M |
| 3300009703|Ga0114933_10380440 | Not Available | 927 | Open in IMG/M |
| 3300009790|Ga0115012_11018002 | Not Available | 685 | Open in IMG/M |
| 3300010148|Ga0098043_1079815 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300010148|Ga0098043_1089868 | Not Available | 904 | Open in IMG/M |
| 3300010148|Ga0098043_1162425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 628 | Open in IMG/M |
| 3300010148|Ga0098043_1230307 | Not Available | 507 | Open in IMG/M |
| 3300010153|Ga0098059_1352811 | Not Available | 558 | Open in IMG/M |
| 3300010153|Ga0098059_1398059 | Not Available | 520 | Open in IMG/M |
| 3300011013|Ga0114934_10337240 | Not Available | 676 | Open in IMG/M |
| 3300012928|Ga0163110_10196225 | Not Available | 1428 | Open in IMG/M |
| 3300012953|Ga0163179_11814474 | Not Available | 557 | Open in IMG/M |
| 3300017706|Ga0181377_1094986 | Not Available | 518 | Open in IMG/M |
| 3300017708|Ga0181369_1110765 | Not Available | 564 | Open in IMG/M |
| 3300017714|Ga0181412_1049290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1073 | Open in IMG/M |
| 3300017717|Ga0181404_1027893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1451 | Open in IMG/M |
| 3300017717|Ga0181404_1036339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1256 | Open in IMG/M |
| 3300017717|Ga0181404_1143779 | Not Available | 576 | Open in IMG/M |
| 3300017726|Ga0181381_1075614 | Not Available | 722 | Open in IMG/M |
| 3300017729|Ga0181396_1102655 | Not Available | 585 | Open in IMG/M |
| 3300017732|Ga0181415_1118501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 596 | Open in IMG/M |
| 3300017737|Ga0187218_1072323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 842 | Open in IMG/M |
| 3300017744|Ga0181397_1071016 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 938 | Open in IMG/M |
| 3300017744|Ga0181397_1072531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 927 | Open in IMG/M |
| 3300017745|Ga0181427_1090318 | Not Available | 749 | Open in IMG/M |
| 3300017753|Ga0181407_1155534 | Not Available | 563 | Open in IMG/M |
| 3300017755|Ga0181411_1215827 | Not Available | 535 | Open in IMG/M |
| 3300017756|Ga0181382_1056168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1125 | Open in IMG/M |
| 3300017759|Ga0181414_1019628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1843 | Open in IMG/M |
| 3300017762|Ga0181422_1179337 | Not Available | 644 | Open in IMG/M |
| 3300017765|Ga0181413_1075444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1033 | Open in IMG/M |
| 3300017765|Ga0181413_1216594 | Not Available | 569 | Open in IMG/M |
| 3300017772|Ga0181430_1094524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 893 | Open in IMG/M |
| 3300017772|Ga0181430_1204308 | Not Available | 563 | Open in IMG/M |
| 3300017773|Ga0181386_1078819 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
| 3300017776|Ga0181394_1130643 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 789 | Open in IMG/M |
| 3300017776|Ga0181394_1225488 | Not Available | 565 | Open in IMG/M |
| 3300017781|Ga0181423_1339176 | Not Available | 549 | Open in IMG/M |
| 3300017786|Ga0181424_10404139 | Not Available | 555 | Open in IMG/M |
| 3300017824|Ga0181552_10251877 | Not Available | 889 | Open in IMG/M |
| 3300017951|Ga0181577_10297142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1049 | Open in IMG/M |
| 3300017956|Ga0181580_11025928 | Not Available | 509 | Open in IMG/M |
| 3300018417|Ga0181558_10549941 | Not Available | 597 | Open in IMG/M |
| 3300020051|Ga0181555_1018544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 4199 | Open in IMG/M |
| 3300020421|Ga0211653_10167736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 968 | Open in IMG/M |
| 3300020601|Ga0181557_1164299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 884 | Open in IMG/M |
| 3300021957|Ga0222717_10277365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 965 | Open in IMG/M |
| 3300021960|Ga0222715_10547179 | Not Available | 606 | Open in IMG/M |
| 3300022065|Ga0212024_1043398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 782 | Open in IMG/M |
| 3300022074|Ga0224906_1195392 | Not Available | 553 | Open in IMG/M |
| 3300022159|Ga0196893_1016802 | All Organisms → Viruses → environmental samples → uncultured virus | 663 | Open in IMG/M |
| 3300022178|Ga0196887_1064096 | Not Available | 900 | Open in IMG/M |
| 3300022178|Ga0196887_1111610 | Not Available | 598 | Open in IMG/M |
| 3300022200|Ga0196901_1158513 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 749 | Open in IMG/M |
| 3300025071|Ga0207896_1063504 | Not Available | 586 | Open in IMG/M |
| 3300025079|Ga0207890_1077057 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 522 | Open in IMG/M |
| 3300025083|Ga0208791_1034330 | Not Available | 944 | Open in IMG/M |
| 3300025086|Ga0208157_1066723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 926 | Open in IMG/M |
| 3300025086|Ga0208157_1108414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 659 | Open in IMG/M |
| 3300025086|Ga0208157_1152292 | Not Available | 508 | Open in IMG/M |
| 3300025098|Ga0208434_1049552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 924 | Open in IMG/M |
| 3300025102|Ga0208666_1075222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 881 | Open in IMG/M |
| 3300025108|Ga0208793_1123984 | Not Available | 703 | Open in IMG/M |
| 3300025110|Ga0208158_1098731 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300025112|Ga0209349_1200575 | Not Available | 509 | Open in IMG/M |
| 3300025120|Ga0209535_1122412 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 881 | Open in IMG/M |
| 3300025120|Ga0209535_1178540 | Not Available | 629 | Open in IMG/M |
| 3300025127|Ga0209348_1172152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 623 | Open in IMG/M |
| 3300025128|Ga0208919_1215036 | Not Available | 571 | Open in IMG/M |
| 3300025132|Ga0209232_1085210 | All Organisms → Viruses → Predicted Viral | 1087 | Open in IMG/M |
| 3300025132|Ga0209232_1092974 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
| 3300025132|Ga0209232_1114186 | Not Available | 897 | Open in IMG/M |
| 3300025132|Ga0209232_1243790 | Not Available | 522 | Open in IMG/M |
| 3300025137|Ga0209336_10102858 | All Organisms → Viruses → environmental samples → uncultured virus | 804 | Open in IMG/M |
| 3300025137|Ga0209336_10148221 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp. | 622 | Open in IMG/M |
| 3300025137|Ga0209336_10185890 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 522 | Open in IMG/M |
| 3300025137|Ga0209336_10191699 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 509 | Open in IMG/M |
| 3300025138|Ga0209634_1184247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 815 | Open in IMG/M |
| 3300025138|Ga0209634_1267907 | Not Available | 607 | Open in IMG/M |
| 3300025138|Ga0209634_1309481 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 539 | Open in IMG/M |
| 3300025168|Ga0209337_1301826 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 579 | Open in IMG/M |
| 3300025296|Ga0208316_1086973 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 576 | Open in IMG/M |
| 3300025769|Ga0208767_1273842 | Not Available | 511 | Open in IMG/M |
| 3300025803|Ga0208425_1113498 | Not Available | 624 | Open in IMG/M |
| 3300025816|Ga0209193_1067004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 955 | Open in IMG/M |
| 3300028022|Ga0256382_1110812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 659 | Open in IMG/M |
| 3300028448|Ga0256383_110892 | Not Available | 733 | Open in IMG/M |
| 3300029318|Ga0185543_1092873 | Not Available | 590 | Open in IMG/M |
| 3300029448|Ga0183755_1050840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1043 | Open in IMG/M |
| 3300031608|Ga0307999_1059031 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 904 | Open in IMG/M |
| 3300031669|Ga0307375_10621545 | All Organisms → Viruses → environmental samples → uncultured virus | 633 | Open in IMG/M |
| 3300032011|Ga0315316_10294081 | All Organisms → Viruses | 1361 | Open in IMG/M |
| 3300033742|Ga0314858_107096 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 711 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 41.73% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 18.70% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.07% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.32% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.32% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.88% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.16% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.16% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.44% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.44% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.44% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.44% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.72% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.72% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.72% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.72% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.72% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.72% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.72% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.72% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.72% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020601 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022159 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025296 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028448 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 300m | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031608 | Marine microbial communities from water near the shore, Antarctic Ocean - #1 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102060621 | 3300000101 | Marine | EWVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSE* |
| DelMOSum2010_102825963 | 3300000101 | Marine | SKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSE* |
| JGI20159J14440_101445111 | 3300001353 | Pelagic Marine | ELSREWVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSE* |
| JGI24006J15134_101911361 | 3300001450 | Marine | WVSKGGDKLLTYYDIANEGYRTAKGKYTLIAVGGNQ* |
| JGI24006J15134_102145733 | 3300001450 | Marine | SKGGDKLLTYYDIANEGYRTAKGKYTLIAVGGNQ* |
| JGI24003J15210_101463001 | 3300001460 | Marine | SREWVSKGGEKLFTYYDLTNEGYRTAKGQYTLIAVGGSQ* |
| JGI24003J15210_101560731 | 3300001460 | Marine | LSREWVSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNA* |
| JGI24005J15628_100925011 | 3300001589 | Marine | SKQGDKLLTYYDTANEGYRTAKGKYTLIAVGGNDE* |
| JGI24513J20088_10294392 | 3300001720 | Marine | HTSKKGDNLFTYYDTQGEGYRTAKGKYTLIAVGGNDE* |
| KVWGV2_100176491 | 3300002242 | Marine Sediment | WTELSREWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGSQ* |
| KVWGV2_104910113 | 3300002242 | Marine Sediment | WVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGSNG* |
| JGI25127J35165_10445971 | 3300002482 | Marine | REWVSKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGNNA* |
| JGI25129J35166_10257884 | 3300002484 | Marine | LSREWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGSNA* |
| JGI25128J35275_10453424 | 3300002488 | Marine | ELSREWVSKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGSQ* |
| Ga0066849_101064601 | 3300005430 | Marine | KWTELSREWISKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGDYAK* |
| Ga0070722_105573202 | 3300005601 | Marine Sediment | EWVSKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGDYAQ* |
| Ga0098038_11241893 | 3300006735 | Marine | KWTELSREWVSKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGSNV* |
| Ga0098038_11295454 | 3300006735 | Marine | KWTELSREWVSKSGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA* |
| Ga0098038_12281933 | 3300006735 | Marine | TELSREWVSKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGSNG* |
| Ga0098038_12287903 | 3300006735 | Marine | TELSREWVSKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGNNA* |
| Ga0098038_12570672 | 3300006735 | Marine | SREWVSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGNNAQ* |
| Ga0098037_10651674 | 3300006737 | Marine | WTELSREWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA* |
| Ga0098042_11554441 | 3300006749 | Marine | EWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNAQ* |
| Ga0098055_11374501 | 3300006793 | Marine | KWTELSREWVSKKGEKLFTYYDLVNEGYRTAKGQYTLIAVGGSQ* |
| Ga0075467_101740945 | 3300006803 | Aqueous | EWVSKQGDKLLTYFDLDANGYRTAKGKYTIIATKGDEQ* |
| Ga0070750_103641601 | 3300006916 | Aqueous | SGDKLLTYYDIANEGYRTAKGKYTLIAVGGDYAQ* |
| Ga0070746_105010412 | 3300006919 | Aqueous | REWVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSE* |
| Ga0098060_11280843 | 3300006921 | Marine | REWVSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNA* |
| Ga0098041_11625461 | 3300006928 | Marine | KSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNA* |
| Ga0098041_12401811 | 3300006928 | Marine | ELSREWVSKSGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA* |
| Ga0098036_11047141 | 3300006929 | Marine | REWVSKSGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA* |
| Ga0075468_102157301 | 3300007229 | Aqueous | WVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSE* |
| Ga0099851_10753594 | 3300007538 | Aqueous | WTELSREWVSKSGDKLLTYYDLVNEGYRTAKGQYTIIAVGGNNG* |
| Ga0099851_12975951 | 3300007538 | Aqueous | WTELSREWVSKSGDKLLTYYDLVNEGYRTAKGQYTIIAVGGNNAQ* |
| Ga0099848_12873812 | 3300007541 | Aqueous | SREWVSKSGDKLLTYYDLVNEGYRTAKGQYTIIAVGGNNG* |
| Ga0102853_10726873 | 3300007543 | Estuarine | SKSGEKLFTYYDLTNEGYRTAKGQYTLIAVGGSE* |
| Ga0114898_11876111 | 3300008216 | Deep Ocean | EWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA* |
| Ga0102963_11182331 | 3300009001 | Pond Water | LSREWVSKSGDKLLTYYDLVNEGYRTAKGQYTIIAVGGNNAQ* |
| Ga0115545_11176623 | 3300009433 | Pelagic Marine | KWTELSREWVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSE* |
| Ga0115546_13336772 | 3300009435 | Pelagic Marine | SKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGSNA* |
| Ga0115555_13436313 | 3300009476 | Pelagic Marine | EWVSKGGEKLFTYYDITNEGYRTAKGQYTLIAVGGNNA* |
| Ga0114932_102784821 | 3300009481 | Deep Subsurface | TDLSREWMSKSGDKLLTYYDLDNQGYRTAKGKYTLIAVGGQNE* |
| Ga0114932_107102702 | 3300009481 | Deep Subsurface | SREWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA* |
| Ga0114925_112897102 | 3300009488 | Deep Subsurface | VSKKGDKLFTYYDLTNQGYRTAKGKYTLIAVGGSDE* |
| Ga0115572_103369883 | 3300009507 | Pelagic Marine | SKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNA* |
| Ga0115572_107109702 | 3300009507 | Pelagic Marine | SREWVSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNG* |
| Ga0114900_11604731 | 3300009602 | Deep Ocean | LSREWVSKGGDKLLTYYDIANEGYRTAKGKYTLIAVGGN* |
| Ga0114933_103804403 | 3300009703 | Deep Subsurface | VSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA* |
| Ga0115012_110180023 | 3300009790 | Marine | SREWVSKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGSQ* |
| Ga0098043_10798151 | 3300010148 | Marine | LSREWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA* |
| Ga0098043_10898683 | 3300010148 | Marine | VSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNA* |
| Ga0098043_11624251 | 3300010148 | Marine | SGDKLLTYYDLVNEGYRTAKGQYTIIAVGGNNAQ* |
| Ga0098043_12303072 | 3300010148 | Marine | SREWVSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNA* |
| Ga0098059_13528111 | 3300010153 | Marine | TELSREWISKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGDYAK* |
| Ga0098059_13980591 | 3300010153 | Marine | TELSREWVSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGNNAQ* |
| Ga0114934_103372401 | 3300011013 | Deep Subsurface | REWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA* |
| Ga0163110_101962253 | 3300012928 | Surface Seawater | REWKSKKGDKLFTYYDITDPTNQGYRTAKGQYTLIAVGGNNE* |
| Ga0163179_118144741 | 3300012953 | Seawater | TELSREWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA* |
| Ga0181377_10949862 | 3300017706 | Marine | WTELSREWISKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNA |
| Ga0181369_11107651 | 3300017708 | Marine | LSREWVSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNA |
| Ga0181412_10492901 | 3300017714 | Seawater | VSKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGNNA |
| Ga0181404_10278934 | 3300017717 | Seawater | GKWTELSREWVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSE |
| Ga0181404_10363394 | 3300017717 | Seawater | TELSREWVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSE |
| Ga0181404_11437791 | 3300017717 | Seawater | ELSREWVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSE |
| Ga0181381_10756141 | 3300017726 | Seawater | DLLCREWKSQNGDKLFTYFDLDSQGYRTARGQYTLIAVGGNNA |
| Ga0181396_11026551 | 3300017729 | Seawater | ELSREWVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSNA |
| Ga0181415_11185013 | 3300017732 | Seawater | TELSREWVSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNA |
| Ga0187218_10723231 | 3300017737 | Seawater | EWVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSNA |
| Ga0181397_10710161 | 3300017744 | Seawater | WVSKGGDKLLTYYDIANEGYRTAKGKYTLIAVGGNQ |
| Ga0181397_10725313 | 3300017744 | Seawater | SREWVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSE |
| Ga0181427_10903181 | 3300017745 | Seawater | VSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGSQ |
| Ga0181407_11555342 | 3300017753 | Seawater | VSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSE |
| Ga0181411_12158271 | 3300017755 | Seawater | TELSREWVSKGGEKLFTYYDITNEGYRTAKGQYTLIAVGGSNA |
| Ga0181382_10561681 | 3300017756 | Seawater | LSREWVSKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGSNA |
| Ga0181414_10196281 | 3300017759 | Seawater | KWTELSREWVSKGGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA |
| Ga0181422_11793373 | 3300017762 | Seawater | EWVSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSE |
| Ga0181413_10754441 | 3300017765 | Seawater | RELSREWVSKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGNNA |
| Ga0181413_12165941 | 3300017765 | Seawater | KWTDISSEWVSKGDERLLTYYAIANEGYRTAKGQYTLIAVGGSNA |
| Ga0181430_10945243 | 3300017772 | Seawater | EWVSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNA |
| Ga0181430_12043083 | 3300017772 | Seawater | VSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNA |
| Ga0181386_10788194 | 3300017773 | Seawater | SREWVSKGGDKLLTYYDIANEGYRTAKGKYTLIAVGGNQ |
| Ga0181394_11306434 | 3300017776 | Seawater | VSKGGDKLLTYYDIANEGYRTAKGKYTLIAVGGNQ |
| Ga0181394_12254883 | 3300017776 | Seawater | VSKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGSNA |
| Ga0181423_13391761 | 3300017781 | Seawater | SKSGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA |
| Ga0181424_104041392 | 3300017786 | Seawater | ELSREWVSKGGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA |
| Ga0181552_102518773 | 3300017824 | Salt Marsh | WTELSREWVSKSGDKLLTYYDLVNEGYRTAKGQYTIIAVGGNNVQ |
| Ga0181577_102971421 | 3300017951 | Salt Marsh | WTELSREWVSKSGDKLLTYYDLVNEGYRTAKGQYTIIAVGGNNAQ |
| Ga0181580_110259281 | 3300017956 | Salt Marsh | LSREWVSKSGDKLLTYYDLVNEGYRTAKGQYTIIAVGGNNAQ |
| Ga0181558_105499411 | 3300018417 | Salt Marsh | LSREWVSKSGDKLLTYYDLVNEGYRTAKGQYTIIAVGGNNVQ |
| Ga0181555_10185446 | 3300020051 | Salt Marsh | TELSREWVSKSGDKLLTYYDLVNEGYRTAKGQYTIIAVGGNNAQ |
| Ga0211653_101677364 | 3300020421 | Marine | VSKSGEKLFTYYDLTNEGYRTAKGQYTLIAVGGSQ |
| Ga0181557_11642991 | 3300020601 | Salt Marsh | KSGDKLLTYYDLVNEGYRTAKGQYTIIAVGGNNAQ |
| Ga0222717_102773653 | 3300021957 | Estuarine Water | WTELSREWVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSE |
| Ga0222715_105471793 | 3300021960 | Estuarine Water | SREWVSKSGDKLLTYYDLVNEGYRTAKGQYTIIAVGGNNAQ |
| Ga0212024_10433983 | 3300022065 | Aqueous | REWVSKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGDYAQ |
| Ga0224906_11953921 | 3300022074 | Seawater | WTELSREWVSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNA |
| Ga0196893_10168021 | 3300022159 | Aqueous | CKEWISKQGERLMTYFDIDANGYRTAKGKYTIIATGGSDDTIN |
| Ga0196887_10640963 | 3300022178 | Aqueous | LSREWVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSE |
| Ga0196887_11116101 | 3300022178 | Aqueous | KSGDKLLTYYDIANEGYRTAKGKYTLIAVGGDYAQ |
| Ga0196901_11585134 | 3300022200 | Aqueous | TNLSREWVSKGGDKLLTYYDIANEGYRTAKGKYTLIAVGGNQ |
| Ga0207896_10635041 | 3300025071 | Marine | REWVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSE |
| Ga0207890_10770571 | 3300025079 | Marine | REWVSKSGDKLLTYYDTANEGYRTAKGKYTLIAVGGNQ |
| Ga0208791_10343301 | 3300025083 | Marine | EWISKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGDYAK |
| Ga0208157_10667233 | 3300025086 | Marine | RERVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA |
| Ga0208157_11084143 | 3300025086 | Marine | WVSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNA |
| Ga0208157_11522921 | 3300025086 | Marine | LSREWVSKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGNNA |
| Ga0208434_10495523 | 3300025098 | Marine | WISKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGDYAK |
| Ga0208666_10752221 | 3300025102 | Marine | ELSREWVSKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGSNV |
| Ga0208793_11239841 | 3300025108 | Marine | EWISKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGSQ |
| Ga0208158_10987313 | 3300025110 | Marine | VSKSGEKLFTYYDLTNEGYRTAKGQYTLIAVGGSNA |
| Ga0209349_12005752 | 3300025112 | Marine | LSREWVSKSGDKLLTYYDLVNEGYRTAKGQYTIIAVGGNNA |
| Ga0209535_11224121 | 3300025120 | Marine | WTNLSREWVSKGGDKLLTYYDIANEGYRTAKGKYTLIAVGGNQ |
| Ga0209535_11785403 | 3300025120 | Marine | LSREWVSKGGEKLFTYYDITNEGYRTAKGQYTLIAVGGNNA |
| Ga0209348_11721523 | 3300025127 | Marine | SKSGDKLLTYYDLVNEGYRTAKGQYTIIAVGGNNAQ |
| Ga0208919_12150362 | 3300025128 | Marine | KWTELSREWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA |
| Ga0209232_10852104 | 3300025132 | Marine | EWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA |
| Ga0209232_10929741 | 3300025132 | Marine | EWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGSQ |
| Ga0209232_11141861 | 3300025132 | Marine | CREWKSKKGDKLFTYYDITDPTNQGYRTAKGQYTLIAVGGNNE |
| Ga0209232_12437902 | 3300025132 | Marine | LSREWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNAQ |
| Ga0209336_101028581 | 3300025137 | Marine | VSKQGDKLLTYYDTANEGYRTAKGKYTLIAVGGNDE |
| Ga0209336_101482213 | 3300025137 | Marine | LSREWVSKGGEKLFTYYDLTNEGYRTAKGQYTLIAVGGSQ |
| Ga0209336_101858902 | 3300025137 | Marine | EWVSKGGDKLLTYYDIANEGYRTAKGKYTLIAVGGNQ |
| Ga0209336_101916991 | 3300025137 | Marine | WVSKQGDKLLTYYDTANEGYRTAKGKYTLIAVGGNDE |
| Ga0209634_11842471 | 3300025138 | Marine | REWVSKGGEKLFTYYDITNEGYRTAKGQYTLIAVGGNNA |
| Ga0209634_12679071 | 3300025138 | Marine | EWVSKGGEKLFTYYDITNEGYRTAKGQYTLIAVGGNNA |
| Ga0209634_13094812 | 3300025138 | Marine | LSREWVSKSGDKLLTYYDTANEGYRTAKGKYTLIAVGGNQ |
| Ga0209337_13018262 | 3300025168 | Marine | EWVSKSGDKLLTYYDTANEGYRTAKGKYTLIAVGGNQ |
| Ga0208316_10869733 | 3300025296 | Deep Ocean | LSREWVSKGGDKLLTYYDIANEGYRTAKGKYTLIAVGGN |
| Ga0208767_12738422 | 3300025769 | Aqueous | KWTELSREWVSKSGDKLLTYYDIANEGYRTAKGQYTLIAVGGSNG |
| Ga0208425_11134981 | 3300025803 | Aqueous | KWTELSREWVSKGGEKLLTYYDIANEGYRTAKGQYTLIAVGGSE |
| Ga0209193_10670041 | 3300025816 | Pelagic Marine | REWISKSGEKLFTYYDITNEGYRTAKGQYTLIAVGGNNA |
| Ga0256382_11108123 | 3300028022 | Seawater | WVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGNNA |
| Ga0256383_1108921 | 3300028448 | Seawater | GKWTELSREWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGSQ |
| Ga0185543_10928732 | 3300029318 | Marine | SKKGDKLFTYYDITDPTNQGYRTAKGQYTLIAVGGNNE |
| Ga0183755_10508404 | 3300029448 | Marine | SREWVSKKGEKLFTYYDLTNEGYRTAKGQYTLIAVGGSQ |
| Ga0307999_10590311 | 3300031608 | Marine | RKGRWTNLCRKHISKKGDNLFTYYDTQGEGYRTAKGKYTLIAVGGN |
| Ga0307375_106215451 | 3300031669 | Soil | SKAGDKLLTYYDTDNNGYRTAKGDYMISVQGGNDE |
| Ga0315316_102940811 | 3300032011 | Seawater | REWISKSGDKLLTYYDIANEGYRTAKGKYTLIAVGGSQ |
| Ga0314858_107096_586_711 | 3300033742 | Sea-Ice Brine | LSREWVSKQGDKLLTYYDTANEGYRTAKGKYTLIAVGGNDE |
| ⦗Top⦘ |