


| Basic Information | |
|---|---|
| Family ID | F055221 |
| Family Type | Metagenome |
| Number of Sequences | 139 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LSVNTDEARRRAEALFKKEQQLREAQQAMAEYQAELH |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.12 % |
| % of genes near scaffold ends (potentially truncated) | 97.12 % |
| % of genes from short scaffolds (< 2000 bps) | 95.68 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.590 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.532 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.079 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.799 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF13545 | HTH_Crp_2 | 5.76 |
| PF01925 | TauE | 3.60 |
| PF00583 | Acetyltransf_1 | 2.16 |
| PF01425 | Amidase | 2.16 |
| PF03401 | TctC | 1.44 |
| PF04392 | ABC_sub_bind | 1.44 |
| PF07992 | Pyr_redox_2 | 0.72 |
| PF13505 | OMP_b-brl | 0.72 |
| PF13458 | Peripla_BP_6 | 0.72 |
| PF10431 | ClpB_D2-small | 0.72 |
| PF04909 | Amidohydro_2 | 0.72 |
| PF00083 | Sugar_tr | 0.72 |
| PF13202 | EF-hand_5 | 0.72 |
| PF00701 | DHDPS | 0.72 |
| PF13493 | DUF4118 | 0.72 |
| PF00924 | MS_channel | 0.72 |
| PF12244 | DUF3606 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 3.60 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 2.16 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.44 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.44 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.44 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.59 % |
| Unclassified | root | N/A | 37.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0425575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 647 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0896900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1075110 | Not Available | 503 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10047034 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300004281|Ga0066397_10155407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum extorquens | 526 | Open in IMG/M |
| 3300005168|Ga0066809_10107156 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300005332|Ga0066388_105423336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum extorquens | 646 | Open in IMG/M |
| 3300005332|Ga0066388_105574708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 637 | Open in IMG/M |
| 3300005446|Ga0066686_11066449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum extorquens | 521 | Open in IMG/M |
| 3300005457|Ga0070662_100482798 | Not Available | 1032 | Open in IMG/M |
| 3300005713|Ga0066905_100516257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 996 | Open in IMG/M |
| 3300005713|Ga0066905_100811344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 812 | Open in IMG/M |
| 3300005764|Ga0066903_101691499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1204 | Open in IMG/M |
| 3300005764|Ga0066903_105105684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 695 | Open in IMG/M |
| 3300005764|Ga0066903_108470914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 524 | Open in IMG/M |
| 3300006046|Ga0066652_101561692 | Not Available | 609 | Open in IMG/M |
| 3300006163|Ga0070715_10879337 | Not Available | 550 | Open in IMG/M |
| 3300006173|Ga0070716_100916457 | Not Available | 687 | Open in IMG/M |
| 3300006800|Ga0066660_10953996 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300006800|Ga0066660_11204426 | Not Available | 594 | Open in IMG/M |
| 3300006904|Ga0075424_100852726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 972 | Open in IMG/M |
| 3300009012|Ga0066710_101548091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1020 | Open in IMG/M |
| 3300009089|Ga0099828_10529912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1062 | Open in IMG/M |
| 3300009137|Ga0066709_101984115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 807 | Open in IMG/M |
| 3300009143|Ga0099792_10412173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 829 | Open in IMG/M |
| 3300009147|Ga0114129_12229216 | Not Available | 659 | Open in IMG/M |
| 3300010047|Ga0126382_10439431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1030 | Open in IMG/M |
| 3300010047|Ga0126382_11854238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300010048|Ga0126373_10715037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1060 | Open in IMG/M |
| 3300010048|Ga0126373_10757107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1032 | Open in IMG/M |
| 3300010048|Ga0126373_11300955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 793 | Open in IMG/M |
| 3300010358|Ga0126370_10840425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 823 | Open in IMG/M |
| 3300010359|Ga0126376_12766465 | Not Available | 540 | Open in IMG/M |
| 3300010361|Ga0126378_11286305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 827 | Open in IMG/M |
| 3300010361|Ga0126378_13171448 | Not Available | 523 | Open in IMG/M |
| 3300010362|Ga0126377_12248107 | Not Available | 621 | Open in IMG/M |
| 3300010366|Ga0126379_11384063 | Not Available | 809 | Open in IMG/M |
| 3300010366|Ga0126379_13458653 | Not Available | 529 | Open in IMG/M |
| 3300010366|Ga0126379_13513320 | Not Available | 525 | Open in IMG/M |
| 3300010373|Ga0134128_10691318 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300010376|Ga0126381_103410853 | Not Available | 625 | Open in IMG/M |
| 3300012189|Ga0137388_10719384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 927 | Open in IMG/M |
| 3300012199|Ga0137383_11080184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300012202|Ga0137363_10384521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1167 | Open in IMG/M |
| 3300012356|Ga0137371_11382496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
| 3300012357|Ga0137384_11314783 | Not Available | 570 | Open in IMG/M |
| 3300012361|Ga0137360_10407781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1146 | Open in IMG/M |
| 3300012362|Ga0137361_10565390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1043 | Open in IMG/M |
| 3300012948|Ga0126375_11326652 | Not Available | 606 | Open in IMG/M |
| 3300012971|Ga0126369_11709771 | Not Available | 718 | Open in IMG/M |
| 3300012971|Ga0126369_12525427 | Not Available | 599 | Open in IMG/M |
| 3300012971|Ga0126369_12635277 | Not Available | 587 | Open in IMG/M |
| 3300014150|Ga0134081_10069283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1076 | Open in IMG/M |
| 3300015245|Ga0137409_11109289 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300015357|Ga0134072_10315232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300015371|Ga0132258_12285483 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300016270|Ga0182036_10163744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1597 | Open in IMG/M |
| 3300016270|Ga0182036_11632487 | Not Available | 543 | Open in IMG/M |
| 3300016294|Ga0182041_10936859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300016294|Ga0182041_11042014 | Not Available | 741 | Open in IMG/M |
| 3300016294|Ga0182041_11134236 | Not Available | 711 | Open in IMG/M |
| 3300016319|Ga0182033_10214513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1540 | Open in IMG/M |
| 3300016319|Ga0182033_10977331 | Not Available | 752 | Open in IMG/M |
| 3300016319|Ga0182033_11193173 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300016341|Ga0182035_11515963 | Not Available | 603 | Open in IMG/M |
| 3300016387|Ga0182040_10743514 | Not Available | 805 | Open in IMG/M |
| 3300016404|Ga0182037_10459220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1060 | Open in IMG/M |
| 3300016404|Ga0182037_10774342 | Not Available | 826 | Open in IMG/M |
| 3300016445|Ga0182038_10368269 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300021560|Ga0126371_13128344 | Not Available | 560 | Open in IMG/M |
| 3300021560|Ga0126371_13819959 | Not Available | 508 | Open in IMG/M |
| 3300025915|Ga0207693_11481160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300025916|Ga0207663_10292028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1215 | Open in IMG/M |
| 3300026507|Ga0257165_1048448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300026547|Ga0209156_10354831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300026552|Ga0209577_10292036 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300026555|Ga0179593_1179999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3307 | Open in IMG/M |
| 3300027748|Ga0209689_1390055 | Not Available | 533 | Open in IMG/M |
| 3300027874|Ga0209465_10031331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2504 | Open in IMG/M |
| 3300028536|Ga0137415_10337600 | Not Available | 1310 | Open in IMG/M |
| 3300028811|Ga0307292_10507709 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031545|Ga0318541_10602652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
| 3300031546|Ga0318538_10083101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1629 | Open in IMG/M |
| 3300031546|Ga0318538_10177830 | Not Available | 1131 | Open in IMG/M |
| 3300031564|Ga0318573_10082331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1627 | Open in IMG/M |
| 3300031572|Ga0318515_10066037 | Not Available | 1850 | Open in IMG/M |
| 3300031573|Ga0310915_10658237 | Not Available | 740 | Open in IMG/M |
| 3300031640|Ga0318555_10739181 | Not Available | 531 | Open in IMG/M |
| 3300031668|Ga0318542_10414604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
| 3300031680|Ga0318574_10319528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 903 | Open in IMG/M |
| 3300031681|Ga0318572_10055539 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
| 3300031681|Ga0318572_10062578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2032 | Open in IMG/M |
| 3300031736|Ga0318501_10592030 | Not Available | 608 | Open in IMG/M |
| 3300031744|Ga0306918_10955399 | Not Available | 666 | Open in IMG/M |
| 3300031748|Ga0318492_10120279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1305 | Open in IMG/M |
| 3300031751|Ga0318494_10040179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2437 | Open in IMG/M |
| 3300031765|Ga0318554_10087006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1747 | Open in IMG/M |
| 3300031769|Ga0318526_10072739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1345 | Open in IMG/M |
| 3300031778|Ga0318498_10343463 | Not Available | 667 | Open in IMG/M |
| 3300031780|Ga0318508_1027747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1419 | Open in IMG/M |
| 3300031781|Ga0318547_10210516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1164 | Open in IMG/M |
| 3300031781|Ga0318547_10263900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1040 | Open in IMG/M |
| 3300031794|Ga0318503_10025835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1691 | Open in IMG/M |
| 3300031795|Ga0318557_10043067 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300031795|Ga0318557_10105538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1249 | Open in IMG/M |
| 3300031795|Ga0318557_10165459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1003 | Open in IMG/M |
| 3300031798|Ga0318523_10009669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3870 | Open in IMG/M |
| 3300031819|Ga0318568_10138543 | Not Available | 1481 | Open in IMG/M |
| 3300031880|Ga0318544_10108435 | Not Available | 1050 | Open in IMG/M |
| 3300031880|Ga0318544_10373262 | Not Available | 554 | Open in IMG/M |
| 3300031894|Ga0318522_10027943 | Not Available | 1887 | Open in IMG/M |
| 3300031896|Ga0318551_10187528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1140 | Open in IMG/M |
| 3300031910|Ga0306923_10913605 | Not Available | 960 | Open in IMG/M |
| 3300031910|Ga0306923_11517421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
| 3300031912|Ga0306921_11993663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
| 3300031941|Ga0310912_11099873 | Not Available | 607 | Open in IMG/M |
| 3300031946|Ga0310910_10132151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1891 | Open in IMG/M |
| 3300031946|Ga0310910_10847117 | Not Available | 719 | Open in IMG/M |
| 3300031947|Ga0310909_10779784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
| 3300031959|Ga0318530_10144641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 964 | Open in IMG/M |
| 3300032001|Ga0306922_10304589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1711 | Open in IMG/M |
| 3300032025|Ga0318507_10180029 | Not Available | 909 | Open in IMG/M |
| 3300032035|Ga0310911_10496569 | Not Available | 707 | Open in IMG/M |
| 3300032039|Ga0318559_10367618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300032044|Ga0318558_10092142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1409 | Open in IMG/M |
| 3300032055|Ga0318575_10371232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
| 3300032059|Ga0318533_10710904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300032063|Ga0318504_10048948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1767 | Open in IMG/M |
| 3300032064|Ga0318510_10531917 | Not Available | 511 | Open in IMG/M |
| 3300032065|Ga0318513_10610261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300032076|Ga0306924_11381330 | Not Available | 752 | Open in IMG/M |
| 3300032094|Ga0318540_10057885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1755 | Open in IMG/M |
| 3300032094|Ga0318540_10578728 | Not Available | 541 | Open in IMG/M |
| 3300032261|Ga0306920_100670191 | Not Available | 1530 | Open in IMG/M |
| 3300032261|Ga0306920_101782904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 869 | Open in IMG/M |
| 3300032261|Ga0306920_103560372 | Not Available | 574 | Open in IMG/M |
| 3300032261|Ga0306920_103592766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300032261|Ga0306920_104336751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300033290|Ga0318519_10256433 | Not Available | 1013 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.39% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_04255751 | 3300000033 | Soil | LSTNLDEAHRRAEALFKKEQQLRVGTIAEYEAEQRAMREKTARLRALRLA |
| ICChiseqgaiiDRAFT_08969001 | 3300000033 | Soil | LSINTDEAHRRAEALFKKEQQLREAQQAMAEYQAGLHAMREKT |
| AP72_2010_repI_A01DRAFT_10751102 | 3300000579 | Forest Soil | LSMNADDAHRRAGALFKKEQQLREAQQAMAEYQAELQA |
| AF_2010_repII_A1DRAFT_100470343 | 3300000597 | Forest Soil | MNSDEAHRRAEALFKKQQPLREGEQAMAKHQAELLAMR |
| Ga0066397_101554071 | 3300004281 | Tropical Forest Soil | MHSDEALRRAQALFRKEQQAREGEQAMAEYQAKLDAMREKTAR |
| Ga0066809_101071561 | 3300005168 | Soil | MNSDEAHRRAEALFKKEQQSREAQQATAEYDAEQRAVQEKTA |
| Ga0066388_1054233361 | 3300005332 | Tropical Forest Soil | LSMDSDQAHRRAGALFRKEQQLREGQQAMAEYQAKLDAMREKTARLRA |
| Ga0066388_1055747081 | 3300005332 | Tropical Forest Soil | MTVEETRRAETLFKKEQQQREAEKAMAEYQAELQATREKTARLRAL |
| Ga0066686_110664491 | 3300005446 | Soil | LSTNVHEPHRRAEALFKKEQQLREGQQAMTEYQAELRAMREKTARLRAL |
| Ga0070662_1004827983 | 3300005457 | Corn Rhizosphere | LSTPSDEAHRRAEALFKQDQPPHEGQQGMAEYQANLDVIREK |
| Ga0066905_1005162571 | 3300005713 | Tropical Forest Soil | LSMNSDEAHRRAEALFKKEQQLREGQQTMAEYQAEL |
| Ga0066905_1008113441 | 3300005713 | Tropical Forest Soil | VSVNTDETRRRAETLFKKEQQLREAQQAMAEYQAQ |
| Ga0066903_1016914991 | 3300005764 | Tropical Forest Soil | VSVNADETRRRAETLFKKEQQLREAQQAMAEYQAQLHATREKTARLR |
| Ga0066903_1051056841 | 3300005764 | Tropical Forest Soil | LSTNLDEAHRRAEALFKKEQRLREGEQAMAEYQAE |
| Ga0066903_1084709141 | 3300005764 | Tropical Forest Soil | LSMNTDEARRRAEALFKKEQQSHEAQQAMTEYEAELQAMREKTARLRA |
| Ga0066652_1015616921 | 3300006046 | Soil | LSAHSDEALRRAEALFKKEQQAREGQQAMAEYHAKLDVIREN |
| Ga0070715_108793372 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LSTPSDEAHRRAEAQFKQDQQAPKGQQRMAEYQANLDA |
| Ga0070716_1009164572 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LSTNLDEAHRRAEALFKKEQQLRVGTIAEYEAEQR |
| Ga0066660_109539962 | 3300006800 | Soil | MNTDETHRRAEALFKKGQQLRGGGQAMTEYQTELQA |
| Ga0066660_112044261 | 3300006800 | Soil | LSVNTDEARRRAETLFKKEQQLREAQQAMTEYQAGLR |
| Ga0075424_1008527262 | 3300006904 | Populus Rhizosphere | LRMNTDETHRRAEALFKKEQQLRGGGQAMTEYQTELQATREKTARLRA |
| Ga0066710_1015480911 | 3300009012 | Grasslands Soil | MDTEEARRRAGALFKKEQQSREAEQAMTDYQAQLKAMREKTARLR |
| Ga0099828_105299121 | 3300009089 | Vadose Zone Soil | LSVNTDEARRRAETLFKKEQQLREAQQAMTEYQAG |
| Ga0066709_1019841152 | 3300009137 | Grasslands Soil | MEFQLSMDTEEARRRAGALFKKEQQSREAEQAMTDYQ |
| Ga0099792_104121732 | 3300009143 | Vadose Zone Soil | LSVNTDEARRRAETLFKKEQQLREAEQAMTEYQAELRAMREKTA |
| Ga0114129_122292161 | 3300009147 | Populus Rhizosphere | LSTPSDEAHRRAEALFKQDQQAPKGQQRMAEYHAN |
| Ga0126382_104394311 | 3300010047 | Tropical Forest Soil | MSMDTEETRRRAQTLFKKEQQLREGQQAMAEYQAQLLAMR |
| Ga0126382_118542382 | 3300010047 | Tropical Forest Soil | VSVNTDETRRRAETLFKKEQQLREAQQAMAEYQAQLHATREKTA |
| Ga0126373_107150373 | 3300010048 | Tropical Forest Soil | LSVNTDEARRRAEALFKKEQQLREAQQAMAEYQAELRMMREKTARLR |
| Ga0126373_107571071 | 3300010048 | Tropical Forest Soil | VNTDESRRRAEALFKKEQQSREAQQAMAEYQAELRMMREKTARL |
| Ga0126373_113009553 | 3300010048 | Tropical Forest Soil | LSVNTDESRRRAEALFKKEQQSREAQQAMAEYQAELRMMR |
| Ga0126370_108404251 | 3300010358 | Tropical Forest Soil | MHSDEALRRAQALFRKEQQAREGEQAMAEYQAKLDAM |
| Ga0126376_127664651 | 3300010359 | Tropical Forest Soil | MHSDEALRRAQALFRKEQQAREGQQAMAEHQAKLD |
| Ga0126378_112863053 | 3300010361 | Tropical Forest Soil | LSVNTDESRRRAEALFKKEQQSREAQQAMAEYQAELRMMREKTAR |
| Ga0126378_131714481 | 3300010361 | Tropical Forest Soil | VNTDESRRRAEALFKKEQQSREAQQAMAEYQAELR |
| Ga0126377_122481071 | 3300010362 | Tropical Forest Soil | MDSDLTHRRAEALFKKQEQAREGQQAMAEYQANLDAMREKTA |
| Ga0126379_113840631 | 3300010366 | Tropical Forest Soil | MNSDEAHRRAEALFKKERQLREGQQTMPEYQAELRATREKTA |
| Ga0126379_134586532 | 3300010366 | Tropical Forest Soil | MHSDEATRRAQALFRKEQQAREGQQAMAEHQAKLD |
| Ga0126379_135133201 | 3300010366 | Tropical Forest Soil | VNTDESRRRAEALFKKEQQSREAQQAMAEYQAELHMMREKTARL |
| Ga0134128_106913181 | 3300010373 | Terrestrial Soil | MTVEETRRRAETLFKKEQQQREAQQAMSEYQAGLRVMREK |
| Ga0126381_1034108532 | 3300010376 | Tropical Forest Soil | MSPVAPHEAHRRAETPFKKEKQLGEGQQAMAEYQARATQEKT |
| Ga0137388_107193843 | 3300012189 | Vadose Zone Soil | LSVNTDEARRRAEALFKKEQQLREAQQAMAEYQAGL |
| Ga0137383_110801841 | 3300012199 | Vadose Zone Soil | MSTNADEAHRRAEALFKKEQQLREGQQAMAEYQTELRAMRDKTARLRALRL |
| Ga0137363_103845211 | 3300012202 | Vadose Zone Soil | LSVNTDEARRRAETLFKKEQQLREAQQAMTEYQAGL |
| Ga0137371_113824961 | 3300012356 | Vadose Zone Soil | MNADEAHRRAEALFKKEQQLREGQQAMAEYQTELRAMRDKTARLRALR |
| Ga0137384_113147832 | 3300012357 | Vadose Zone Soil | MNSDEAHRRAEALFKKERQLREGQQTMAEYQAELRAMRE |
| Ga0137360_104077814 | 3300012361 | Vadose Zone Soil | LSVNTDEARRRAETLFKKEQQLREAQQAMTEYQAGLRMMR |
| Ga0137361_105653903 | 3300012362 | Vadose Zone Soil | LSKNADEAHRRAGALFKKEQQSREAQLAMVEYQAELRAMREKTARLRAVCTENLIRID* |
| Ga0126375_113266522 | 3300012948 | Tropical Forest Soil | MHNEDAQRRASALFKKEQQSREAEKAMADYQADLQATREKTARL |
| Ga0126369_117097711 | 3300012971 | Tropical Forest Soil | MHSNEALRRAQALFRKEQQAREGQQAMAEYQAKLDAMR |
| Ga0126369_125254271 | 3300012971 | Tropical Forest Soil | VNTDESRRRAEALFKKEQQSREAQQAMAEYQAELHMM |
| Ga0126369_126352772 | 3300012971 | Tropical Forest Soil | LSVNTDESRRRAEALFKKEQQSREAQQAMAEYQAELRMMREKTARL |
| Ga0134081_100692832 | 3300014150 | Grasslands Soil | MEFQLSMDTEEARRRAGALFKKEQQSREAEQAMSDYEAQL |
| Ga0137409_111092892 | 3300015245 | Vadose Zone Soil | MADTVSPDRAAALLKKEQQAREGQQAWAEYEAQINAIRDKTARLR |
| Ga0134072_103152322 | 3300015357 | Grasslands Soil | MEFQLSMETEEARRRAGALFKKEQQSREAEQAMADYEAQLQAMRE |
| Ga0132258_122854831 | 3300015371 | Arabidopsis Rhizosphere | MNVDEPHRRAEALFKKEQQLREGQQAMSEYQAELRAMRDKTARLRALR |
| Ga0182036_101637445 | 3300016270 | Soil | VNTDESRRRAEALFKKEQQSREAQQAMAEYQAELH |
| Ga0182036_116324871 | 3300016270 | Soil | LSMNTDEAHRRAEALFKKEQQFSGGQQATTQHQAEL |
| Ga0182041_109368593 | 3300016294 | Soil | MNSDEAHRRAEALFKKEQQLREGQQTMAEYQAELRAMREKT |
| Ga0182041_110420141 | 3300016294 | Soil | MLDINADEAHRRAEALFKKEQQLREGQQAMAQYQAEL |
| Ga0182041_111342361 | 3300016294 | Soil | LSTNLDEVHRRAEALFKKQQPLREGEQAMAEYQAELLAMREKTARL |
| Ga0182033_102145134 | 3300016319 | Soil | LSTNTDEAHRRAEALFKKEQQSHEAQQAMTEYEAELQAMREKT |
| Ga0182033_109773312 | 3300016319 | Soil | LSTNLDEVHRRAEALFKKQQPLREGEQAMAEYQAELLAMRE |
| Ga0182033_111931732 | 3300016319 | Soil | MNSDEAHRRAEALFKKEQQLREGQEAMAEYQAEPRAM |
| Ga0182035_115159631 | 3300016341 | Soil | LSMNTDEAHRRAEALFKKEQQFSGGQQATTQHQAELQAM |
| Ga0182040_107435143 | 3300016387 | Soil | MLDINADEAHRRAEALFKKEQQLREGQQAMAQYQAELRATR |
| Ga0182037_104592201 | 3300016404 | Soil | LSVNTDEARRRAEALFKKEQQLREAQQAMAEYQAEQHMMREKTARL |
| Ga0182037_107743422 | 3300016404 | Soil | MNSDEAHHRAEALFKKERQLREGQQTMPEYQAELRATREK |
| Ga0182038_103682692 | 3300016445 | Soil | MNSDEAHRHAEALFKKEQQLREGQQAMAEYQAELRAMRE |
| Ga0126371_131283442 | 3300021560 | Tropical Forest Soil | LSVNTDESRRRAEALFKKEQQSREAQQAIAEYQAE |
| Ga0126371_138199591 | 3300021560 | Tropical Forest Soil | LSMHSDEALRRAQALFRKEQQAREGQKAMAEYEAKLDVVREKT |
| Ga0207693_114811602 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LSMNTDEAHRRAEALFKKEQQSHEAQQAMTEYEAELQAMREK |
| Ga0207663_102920281 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LTISHEAQRRAEALFKKEQQGRQAMTDYQANLDAMREKTA |
| Ga0257165_10484481 | 3300026507 | Soil | LSVNTDEARRRAETLFKKEQQLREAEQAMTEYQAELRAM |
| Ga0209156_103548312 | 3300026547 | Soil | LSMQSDQAHRRAEALFKKEKQLREGQQAMAEYEAKLRATQKKTARLRAL |
| Ga0209577_102920362 | 3300026552 | Soil | MSVEETRRAETLFKKEQQLREAEKAMADYRAELQATR |
| Ga0179593_11799991 | 3300026555 | Vadose Zone Soil | MNTDEAHRRAEALFKKEQQSHEAQQAMTEYEAELQA |
| Ga0209689_13900551 | 3300027748 | Soil | LSVNTDEARRRAETLFKKEQQLREAEQAMTEYQAELHA |
| Ga0209465_100313317 | 3300027874 | Tropical Forest Soil | VNTDESRRRAEALFKKEQQSREAQQAMAEYQAELRMMREKTAR |
| Ga0137415_103376002 | 3300028536 | Vadose Zone Soil | MNTDEAHRCAEALFKKEQQSHEAQQAMTEYEAELQAMR |
| Ga0307292_105077091 | 3300028811 | Soil | MTVEETRRRAETLFKKEQQQREAQQAMSEYQAGVRAMRE |
| Ga0318541_106026521 | 3300031545 | Soil | MLDINADEAHRRAEALFKKEQQLREGQQAMAQYQAELRATREK |
| Ga0318538_100831011 | 3300031546 | Soil | VSVNTDETRRRAETLFKKEQQLREAQQAMAEYQAQLHATREKTARLRA |
| Ga0318538_101778303 | 3300031546 | Soil | LSMNADDAHRRAGALFKKEQQLREAQQAMAEYQAELQ |
| Ga0318573_100823315 | 3300031564 | Soil | LSVNTDESRRRAEALFKKEQQSREAQQAMAEYQAELHMMR |
| Ga0318515_100660374 | 3300031572 | Soil | MLGINADEAHRRAEALFKKEQQLREGQQAMAQYQAE |
| Ga0310915_106582372 | 3300031573 | Soil | MHSDEAVRRAQALFRKEQQAREGQQATAEYQAKLDAVREKTA |
| Ga0318555_107391811 | 3300031640 | Soil | LSMNTDEAHRRAEALFKKEQQSHEAQQAMTEYEAELQAMREKTA |
| Ga0318542_104146043 | 3300031668 | Soil | LSVNTDEARRRAEALFKKEQQLREAQQAMAEYQAGLRMMSEKTAR |
| Ga0318574_103195281 | 3300031680 | Soil | LSTNTDEAHRRAEALFKKEQQSHEAQQAMTEYEAELQAMREKTA |
| Ga0318572_100555391 | 3300031681 | Soil | LSVNTDESRRRAEALFKKEQQSREAQQAMAEYQAELHM |
| Ga0318572_100625785 | 3300031681 | Soil | LSVNTDEARRRAEALFKKEQQLREAQQAMAEYQAE |
| Ga0318501_105920303 | 3300031736 | Soil | MHNEDAQRRASALFKKEQQSREAEKAMADYQADLQATREK |
| Ga0306918_109553991 | 3300031744 | Soil | MNSHRRAEALFKKEQQLREGQQTMAEYQAELRAMR |
| Ga0318492_101202794 | 3300031748 | Soil | VNTDESRRRAEALFKKEQQSREAQQAMAEYQAELHMMREKT |
| Ga0318494_100401791 | 3300031751 | Soil | LSVNTDEARRRAEALFKKEQQLREAQQAMAEYQAELHM |
| Ga0318554_100870064 | 3300031765 | Soil | LSVNTDESRRRAEALFKKEQQSREAQQAMAEYQAELRMMREKTA |
| Ga0318526_100727393 | 3300031769 | Soil | LSMNADDAHRRAGALFKKEQQLREAQQAMAEYQAEL |
| Ga0318498_103434631 | 3300031778 | Soil | MDSDQARHRAEALFKKEQQAREGQQAMAEYQAKLDAMSEKTARL |
| Ga0318508_10277471 | 3300031780 | Soil | LSVNTDESRRRAEALFKKEQQSREAQQAMAEYQAELRMM |
| Ga0318547_102105165 | 3300031781 | Soil | LSVNTDEARRRAEALFKKEQQLREAQQAMAEYQAELH |
| Ga0318547_102639001 | 3300031781 | Soil | LSVNTDEARRRAEALFKKEQQLREAQQAMAEYQAEQHMMR |
| Ga0318503_100258351 | 3300031794 | Soil | LSVNTDESRRRAEALFKKEQQSREAQQAMAEYQAELRM |
| Ga0318557_100430674 | 3300031795 | Soil | LSVNTDESRRRAEALFKKEQQSREAQQAMAEYQAELHMMREK |
| Ga0318557_101055381 | 3300031795 | Soil | LSVNNDESRRRAEALFKKEQQSREAQQAMAEYQAELHTMREKT |
| Ga0318557_101654591 | 3300031795 | Soil | LSVNTDEARRRAEALFKKEQQLREAQQAMAEYQAEQHMMREKTARMR |
| Ga0318523_100096696 | 3300031798 | Soil | MHSDEAVRRAQALFRKEQQAREGQQATAEYQAKLDAVREKTARLLFL |
| Ga0318568_101385433 | 3300031819 | Soil | MLGINADEAHRRAEALFKKEQQLREGQQAMAQYQAELR |
| Ga0318544_101084352 | 3300031880 | Soil | MNTDEAHRRAEALFKKEQQFSGSQQATTQHQAELRAMREKTARL |
| Ga0318544_103732621 | 3300031880 | Soil | MNSHRRAEALFKKEQQLREGQQTMAEYQAELRAMREKTARL |
| Ga0318522_100279434 | 3300031894 | Soil | MLGINADEAHRRAEALFKKEQQLREGQQAMAQYQAELRATREK |
| Ga0318551_101875281 | 3300031896 | Soil | LSVNTDEARRRAEALFKKEQQLREAQQAMAEYQAEL |
| Ga0306923_109136051 | 3300031910 | Soil | MNSDEAHHRAEALFKKERQLREGQQTMPEYQAELRATR |
| Ga0306923_115174211 | 3300031910 | Soil | MNSDEAHRRAEALFKKEQQLREGQEAMAEYQAEPRAMQEKT |
| Ga0306921_119936631 | 3300031912 | Soil | LSVNSDGAHRRAEALFKKEQQLREGQQPMAEYQAELRAAREKT |
| Ga0310912_110998732 | 3300031941 | Soil | MRRADALFKKEQQSREAQQATAEYQAELQATREKTER |
| Ga0310910_101321514 | 3300031946 | Soil | LSTNTDEAHRRAEALFKKEQQSHEAQQAMTEYEAELQAMREK |
| Ga0310910_108471171 | 3300031946 | Soil | MLDINADEAHRRAEALFKKEQQLREGQQAMAQYQA |
| Ga0310909_107797842 | 3300031947 | Soil | MHSNEHEARRRAEALFKKEQQLREAQQAMADYQAKLHAM |
| Ga0318530_101446411 | 3300031959 | Soil | MHSDEALRRAQALFRKEQQAREGQQAMAEYQAKLDAMRE |
| Ga0306922_103045891 | 3300032001 | Soil | LSTNTDEAHRRAEALFKKEQQSHEAQQAMTEYEAELQAMREKTAR |
| Ga0318507_101800293 | 3300032025 | Soil | LSMHNEDAQRRASALFKKEQQSREAEKAMADYQADLQATREKTARL |
| Ga0310911_104965691 | 3300032035 | Soil | MLDINADEAHRRAEALFKKEQQLREGQQAMAQYQAE |
| Ga0318559_103676182 | 3300032039 | Soil | MNLDEAHRRAEALFKKEQQLHEGQQAMAEYQAELRAMRE |
| Ga0318558_100921421 | 3300032044 | Soil | VSVNTDETRRRAETLFKKEQQLREAQQAMAEYQAQLH |
| Ga0318575_103712321 | 3300032055 | Soil | MHSDEALRRAQALFRKEQQAREGQQAMAEYQAKLDAMREK |
| Ga0318533_107109041 | 3300032059 | Soil | LSVNTDETRRRAEALFKKEQQLREAQQAMAEYQVGLHMMRE |
| Ga0318504_100489484 | 3300032063 | Soil | LSVNTDESRRRAEALFKKEQQSREAQQAMAEYQAEL |
| Ga0318510_105319171 | 3300032064 | Soil | LSMNTDEAHRRAEALFKKEQQSHEAQQAMTEYEAE |
| Ga0318513_106102611 | 3300032065 | Soil | LSANTDEARRRAEALFKKEQQLREAQQAMAEYQPGLHMM |
| Ga0306924_113813303 | 3300032076 | Soil | MLDINADEAHRRAEALFKKEQQLREGQQAMAQYQAELRA |
| Ga0318540_100578854 | 3300032094 | Soil | LSVNTDEARRRAEALFKKEQQLREAQQAMAEYQAEQHM |
| Ga0318540_105787281 | 3300032094 | Soil | VSMDSDQARHRAEALFKKEQQVREGQQAMAEYQAKLDAMREK |
| Ga0306920_1006701914 | 3300032261 | Soil | LSMNTDEAHRRAEALFKKEQQSHEAQQAMTEYEAELQAMREKTAR |
| Ga0306920_1017829041 | 3300032261 | Soil | MNSDETHRRAEALFKKEQQLREGQQAMAEYQAELR |
| Ga0306920_1035603721 | 3300032261 | Soil | MNSHRRAEALFKKEQQLREGQQTMAEYQAELRAMREKTARLRAL |
| Ga0306920_1035927661 | 3300032261 | Soil | LSMNSDEAHRRAEALFKKEQQLREDQQAMAEYQAELRTMREKTARLRA |
| Ga0306920_1043367511 | 3300032261 | Soil | MNLDEAHRRAEALFKKEKQLGEVQQPMAEYQAELCA |
| Ga0318519_102564333 | 3300033290 | Soil | LSMNADDAHRRAGALFKKEQQLREAQQAMAEYQAELQATREMTARLRALRL |
| ⦗Top⦘ |