


| Basic Information | |
|---|---|
| Family ID | F055144 |
| Family Type | Metagenome |
| Number of Sequences | 139 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ANGFQAPELFAATALVSAASIAIVLGLDALNDRLSHWRG |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.72 % |
| % of genes near scaffold ends (potentially truncated) | 94.96 % |
| % of genes from short scaffolds (< 2000 bps) | 93.53 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.122 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (16.547 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.777 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.007 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 9.35 |
| PF13378 | MR_MLE_C | 8.63 |
| PF02746 | MR_MLE_N | 5.76 |
| PF13419 | HAD_2 | 5.04 |
| PF04366 | Ysc84 | 4.32 |
| PF12911 | OppC_N | 2.16 |
| PF01497 | Peripla_BP_2 | 1.44 |
| PF09084 | NMT1 | 1.44 |
| PF01063 | Aminotran_4 | 0.72 |
| PF13561 | adh_short_C2 | 0.72 |
| PF01909 | NTP_transf_2 | 0.72 |
| PF12867 | DinB_2 | 0.72 |
| PF06537 | DHOR | 0.72 |
| PF04879 | Molybdop_Fe4S4 | 0.72 |
| PF13358 | DDE_3 | 0.72 |
| PF01844 | HNH | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 11.51 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 4.32 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.44 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.44 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.44 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.44 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.44 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.44 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.44 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.44 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.12 % |
| Unclassified | root | N/A | 2.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_102344335 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 559 | Open in IMG/M |
| 3300002561|JGI25384J37096_10071335 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1274 | Open in IMG/M |
| 3300003321|soilH1_10354050 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1128 | Open in IMG/M |
| 3300003324|soilH2_10283439 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300003999|Ga0055469_10308428 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005167|Ga0066672_10232207 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300005174|Ga0066680_10413630 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300005177|Ga0066690_10906468 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005181|Ga0066678_10351671 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 972 | Open in IMG/M |
| 3300005295|Ga0065707_10424367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 827 | Open in IMG/M |
| 3300005338|Ga0068868_102338510 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 510 | Open in IMG/M |
| 3300005440|Ga0070705_101470140 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 570 | Open in IMG/M |
| 3300005444|Ga0070694_100128408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1828 | Open in IMG/M |
| 3300005446|Ga0066686_10695521 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005447|Ga0066689_10787659 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
| 3300005451|Ga0066681_10175366 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300005467|Ga0070706_100693584 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300005526|Ga0073909_10265064 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 768 | Open in IMG/M |
| 3300005540|Ga0066697_10335109 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 883 | Open in IMG/M |
| 3300005546|Ga0070696_100310866 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1210 | Open in IMG/M |
| 3300005552|Ga0066701_10763589 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 577 | Open in IMG/M |
| 3300005555|Ga0066692_10827936 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
| 3300005587|Ga0066654_10138779 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1223 | Open in IMG/M |
| 3300005598|Ga0066706_11435274 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 520 | Open in IMG/M |
| 3300005713|Ga0066905_100876091 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 784 | Open in IMG/M |
| 3300005719|Ga0068861_102462475 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 524 | Open in IMG/M |
| 3300006031|Ga0066651_10394132 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300006031|Ga0066651_10435863 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 696 | Open in IMG/M |
| 3300006034|Ga0066656_10740669 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 630 | Open in IMG/M |
| 3300006049|Ga0075417_10076225 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300006058|Ga0075432_10076103 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1211 | Open in IMG/M |
| 3300006173|Ga0070716_100147413 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300006791|Ga0066653_10000673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9496 | Open in IMG/M |
| 3300006796|Ga0066665_10892265 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 690 | Open in IMG/M |
| 3300006846|Ga0075430_100581266 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300006847|Ga0075431_101650613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 598 | Open in IMG/M |
| 3300006854|Ga0075425_101006817 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300006876|Ga0079217_10481384 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 765 | Open in IMG/M |
| 3300006903|Ga0075426_10284447 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1208 | Open in IMG/M |
| 3300006904|Ga0075424_100786412 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1016 | Open in IMG/M |
| 3300007004|Ga0079218_11297913 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 766 | Open in IMG/M |
| 3300009089|Ga0099828_11532293 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300009094|Ga0111539_11136024 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 908 | Open in IMG/M |
| 3300009137|Ga0066709_101125952 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300009147|Ga0114129_11654364 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 782 | Open in IMG/M |
| 3300009156|Ga0111538_12651492 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 628 | Open in IMG/M |
| 3300009162|Ga0075423_10066421 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3739 | Open in IMG/M |
| 3300009177|Ga0105248_11696067 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 716 | Open in IMG/M |
| 3300009553|Ga0105249_10981053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 913 | Open in IMG/M |
| 3300009777|Ga0105164_10241839 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300009807|Ga0105061_1087433 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300009817|Ga0105062_1137765 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 504 | Open in IMG/M |
| 3300009818|Ga0105072_1079055 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 645 | Open in IMG/M |
| 3300009837|Ga0105058_1071578 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300010047|Ga0126382_10099267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1876 | Open in IMG/M |
| 3300010047|Ga0126382_10729446 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 835 | Open in IMG/M |
| 3300010301|Ga0134070_10367160 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
| 3300010304|Ga0134088_10488077 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 606 | Open in IMG/M |
| 3300010323|Ga0134086_10225900 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 706 | Open in IMG/M |
| 3300010325|Ga0134064_10369768 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 565 | Open in IMG/M |
| 3300010336|Ga0134071_10151622 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1127 | Open in IMG/M |
| 3300010359|Ga0126376_12262796 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 589 | Open in IMG/M |
| 3300010362|Ga0126377_11952437 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300010391|Ga0136847_13149648 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 904 | Open in IMG/M |
| 3300010398|Ga0126383_11094173 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300010398|Ga0126383_13152028 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 539 | Open in IMG/M |
| 3300010868|Ga0124844_1100964 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300011435|Ga0137426_1181928 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300011437|Ga0137429_1159636 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300012189|Ga0137388_10011128 | All Organisms → cellular organisms → Bacteria | 6371 | Open in IMG/M |
| 3300012198|Ga0137364_11016345 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 626 | Open in IMG/M |
| 3300012205|Ga0137362_11237945 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 631 | Open in IMG/M |
| 3300012208|Ga0137376_10248187 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300012285|Ga0137370_10148533 | Not Available | 1354 | Open in IMG/M |
| 3300012349|Ga0137387_10294427 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300012349|Ga0137387_11087132 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 570 | Open in IMG/M |
| 3300012353|Ga0137367_10550441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 810 | Open in IMG/M |
| 3300012361|Ga0137360_10250870 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300012363|Ga0137390_11682280 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300012503|Ga0157313_1041397 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 567 | Open in IMG/M |
| 3300012582|Ga0137358_10415135 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300012922|Ga0137394_10276295 | Not Available | 1436 | Open in IMG/M |
| 3300012925|Ga0137419_10264126 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300012929|Ga0137404_10332363 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1325 | Open in IMG/M |
| 3300012930|Ga0137407_10231983 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1667 | Open in IMG/M |
| 3300012944|Ga0137410_10651883 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300012948|Ga0126375_10139601 | Not Available | 1510 | Open in IMG/M |
| 3300012948|Ga0126375_10628830 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300014150|Ga0134081_10132587 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300014154|Ga0134075_10371386 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 629 | Open in IMG/M |
| 3300014259|Ga0075311_1097041 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 626 | Open in IMG/M |
| 3300014885|Ga0180063_1281002 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 529 | Open in IMG/M |
| 3300015264|Ga0137403_11419945 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
| 3300015358|Ga0134089_10439868 | Not Available | 563 | Open in IMG/M |
| 3300015359|Ga0134085_10068214 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
| 3300015371|Ga0132258_11124654 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300015372|Ga0132256_100128114 | All Organisms → cellular organisms → Bacteria | 2516 | Open in IMG/M |
| 3300015373|Ga0132257_102543527 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300015374|Ga0132255_104719516 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 577 | Open in IMG/M |
| 3300018031|Ga0184634_10016551 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2729 | Open in IMG/M |
| 3300018059|Ga0184615_10377508 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 781 | Open in IMG/M |
| 3300018468|Ga0066662_10747172 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 941 | Open in IMG/M |
| 3300025149|Ga0209827_10962011 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300025935|Ga0207709_11287866 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 604 | Open in IMG/M |
| 3300025937|Ga0207669_10181723 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1509 | Open in IMG/M |
| 3300026296|Ga0209235_1015861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4100 | Open in IMG/M |
| 3300026298|Ga0209236_1127719 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300026300|Ga0209027_1173138 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300026328|Ga0209802_1302149 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
| 3300026333|Ga0209158_1299915 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 553 | Open in IMG/M |
| 3300026335|Ga0209804_1189092 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300026528|Ga0209378_1080088 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300026550|Ga0209474_10089570 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
| 3300026551|Ga0209648_10165334 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300027324|Ga0209845_1012273 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300027511|Ga0209843_1008857 | All Organisms → cellular organisms → Bacteria | 2185 | Open in IMG/M |
| 3300027646|Ga0209466_1057895 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300027748|Ga0209689_1364915 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 552 | Open in IMG/M |
| 3300027873|Ga0209814_10550092 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300027882|Ga0209590_10547995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 746 | Open in IMG/M |
| 3300031170|Ga0307498_10205625 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 689 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1068418 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300031548|Ga0307408_100756911 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300031720|Ga0307469_10173421 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1648 | Open in IMG/M |
| 3300031723|Ga0318493_10386402 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 764 | Open in IMG/M |
| 3300031724|Ga0318500_10027587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2245 | Open in IMG/M |
| 3300031820|Ga0307473_10781773 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
| 3300031820|Ga0307473_10868214 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5 | 649 | Open in IMG/M |
| 3300031911|Ga0307412_11082744 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 712 | Open in IMG/M |
| 3300031954|Ga0306926_11404886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 810 | Open in IMG/M |
| 3300032002|Ga0307416_100583859 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300032002|Ga0307416_102975927 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300032003|Ga0310897_10239160 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 808 | Open in IMG/M |
| 3300032075|Ga0310890_11004932 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 671 | Open in IMG/M |
| 3300032180|Ga0307471_101803627 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 763 | Open in IMG/M |
| 3300032180|Ga0307471_103128703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Parahaliea → Parahaliea maris | 587 | Open in IMG/M |
| 3300032770|Ga0335085_11035861 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 884 | Open in IMG/M |
| 3300034817|Ga0373948_0019662 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1279 | Open in IMG/M |
| 3300034818|Ga0373950_0177598 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 500 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.04% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.32% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.88% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.16% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.16% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.44% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.44% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.72% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.72% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.72% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300025149 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1023443353 | 3300000559 | Soil | GSFANGFQAPELFAATALVSAVSIAIVLALDGINERLSRWRG* |
| JGI25384J37096_100713352 | 3300002561 | Grasslands Soil | MGALANGSKAPELFAATGLVSAASIAIVLALDHVSERLSRWRG* |
| soilH1_103540501 | 3300003321 | Sugarcane Root And Bulk Soil | ANGFQAPELFAATALVSAASIAIVLGLDALNDRLSHWRG* |
| soilH2_102834391 | 3300003324 | Sugarcane Root And Bulk Soil | SLANGFQAPELFAATALVSAASIALVLALDALGERLSRWRESPIAERS* |
| Ga0055469_103084281 | 3300003999 | Natural And Restored Wetlands | RGMGHVLSSLANGFQAPELFAATALVSVASIAIVLGLDALNERLSHWRR* |
| Ga0066672_102322071 | 3300005167 | Soil | VRGMGWELSAFANAFQAPELFASTLLVSAVAIAIGLVLDALGERLNRWR* |
| Ga0066680_104136301 | 3300005174 | Soil | LSSLANGFRAPALFAATALVSAASIVIVLSLDVLNDRLSQWRGEIR* |
| Ga0066690_109064681 | 3300005177 | Soil | YVLSSLANGFQAPELFAATALVSAASIVIVLSLDVLNDRLAQWRGEVR* |
| Ga0066678_103516714 | 3300005181 | Soil | LANGFQAPELFAATALVSASSIAIVLALDSLNNRLSRWR* |
| Ga0065707_104243673 | 3300005295 | Switchgrass Rhizosphere | RGMGHILGSYANGFQAPELFAATALVSSASIAIVLGLDHLNDKLSRWRG* |
| Ga0068868_1023385102 | 3300005338 | Miscanthus Rhizosphere | MGYVLGSYANGFQAPELFAATALVSAASIAIVLALDHLNDKLSRWRG* |
| Ga0070705_1014701402 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GHVLGSFANGFQAPELFAATALVSAASIAIVLALDHLNDKLSRWRG* |
| Ga0070694_1001284084 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGSYANGFQAPELFAATALVSAASIAIVLALDHLNDKLSRWRG* |
| Ga0066686_106955211 | 3300005446 | Soil | RGMGYVMGSLANGFQAPELFAATALVSATSIAIVLGLDHVNDRLSRWRG* |
| Ga0066689_107876591 | 3300005447 | Soil | GYVMSSLANGFRAPELFAATGLVSAASIAIVLVLDHVNERLSHWRG* |
| Ga0066681_101753661 | 3300005451 | Soil | YVMGSLANGFQAPELFAATALVSATSIAIVLGLDQLNERLSRWRG* |
| Ga0070706_1006935841 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGSFANGFQAPELFAATALVSAASIAIVLALDHLNDRLSRWRG* |
| Ga0073909_102650641 | 3300005526 | Surface Soil | MGHVLNSLANGFQAAELFAATALVSAASIAIVLGLDALNERLSHWRS* |
| Ga0066697_103351092 | 3300005540 | Soil | VMGGLANGFRAPELFAATGLVSVASIAIVLGLDHLNEKLSRWRG* |
| Ga0070696_1003108661 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LGSLANGFQAPELFAATALVSAASIVIVLGLDALNDRLSHWRG* |
| Ga0066701_107635891 | 3300005552 | Soil | GMGYVMSSLANGFRAPELFAATGLVSAASIAIVLVLDHVNERLSHWRG* |
| Ga0066692_108279363 | 3300005555 | Soil | YVMSSLANGFRAPELFAATGLVSAASIAIVLVLDHVNERLSHWRG* |
| Ga0066654_101387791 | 3300005587 | Soil | GYVMGAFANGFQAPELFAATGLVSAASVAIVLALDHVSERLSHWRG* |
| Ga0066706_114352742 | 3300005598 | Soil | HVLGSYANGFQAPELFAATALVSAASIAIVLALDHLNDKLSRWRG* |
| Ga0066905_1008760912 | 3300005713 | Tropical Forest Soil | GLANGFRAPELFAATGLVSVASIAIVLGLDHLNEKLSHWRG* |
| Ga0068861_1024624751 | 3300005719 | Switchgrass Rhizosphere | GFQAPELFAATALVSAVSIAIVLALDGINERLSRWRG* |
| Ga0066651_103941321 | 3300006031 | Soil | SFANAFRAPELFAATALVSAASIAIVLALDRLNDRLSHWRI* |
| Ga0066651_104358631 | 3300006031 | Soil | SLANGFRAPELFAATGLVSAASIAIVLALDHVNERLSHWRG* |
| Ga0066656_107406693 | 3300006034 | Soil | YVMSSLANGFRAPELFAATGLVSAASIAIVLGLDHVNERLSHWRG* |
| Ga0075417_100762253 | 3300006049 | Populus Rhizosphere | HVLGSFANGFQAPELFAATALVSMASIVIVLSLDALNDRLSHWRGEAR* |
| Ga0075432_100761031 | 3300006058 | Populus Rhizosphere | VLGSLANGFQAPELFAATALVSVSSIAIVLGLDALNERLSIWRG* |
| Ga0070716_1001474131 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GMGYVLSSLANGFQAPELFSATALVSAASIVIVLSLDSLNDRLSQWREESR* |
| Ga0066653_100006738 | 3300006791 | Soil | FRAPELFAATGLVSVASIAIVLGLDHLNEKLSRWRG* |
| Ga0066665_108922651 | 3300006796 | Soil | NGFRAPELFAATGLVSAASIAIVLGLDHVNERLSHWRG* |
| Ga0075430_1005812662 | 3300006846 | Populus Rhizosphere | SSLANGFQAAELFAATALVSAASIIIVLSLASVNERLSQWRGESR* |
| Ga0075431_1016506132 | 3300006847 | Populus Rhizosphere | RGMGFLLVSLANAFRAPELFAATALVSLLSIAIVLGLERLNRRLGHWR* |
| Ga0075425_1010068171 | 3300006854 | Populus Rhizosphere | FQAPELFAATALVSAASIAIVLALDGINERLSRWRG* |
| Ga0079217_104813842 | 3300006876 | Agricultural Soil | MGSLANGFRAPELFAATALVSAASIAIVLGLDALNERLSRWRG* |
| Ga0075426_102844471 | 3300006903 | Populus Rhizosphere | ANAFRAPELFAATGLISVASIAIVLALDALNERLSRWR* |
| Ga0075424_1007864124 | 3300006904 | Populus Rhizosphere | LANGFQAPELFAATALVSFASIAIVLALDALNDRLSHWRG* |
| Ga0079218_112979131 | 3300007004 | Agricultural Soil | MSALANGFQAAELFAVTALVSVASIVIVLSLDALGERLSVWRG* |
| Ga0099828_115322932 | 3300009089 | Vadose Zone Soil | GFRAPELFAATGLVSAASIAIVLGLDHLNEKLSHWRG* |
| Ga0111539_111360241 | 3300009094 | Populus Rhizosphere | ANGFRAAELFAVTGLVSAASIAIVLTLDVLNDRLAHWRG* |
| Ga0066709_1011259522 | 3300009137 | Grasslands Soil | MGALANGFQAPERFAATGLVSAASIAIVLALDHVSERLSRWRG* |
| Ga0114129_116543641 | 3300009147 | Populus Rhizosphere | LANGFQAPELFAATALVSAVSITIVLGLDALNERLSHWRR* |
| Ga0111538_126514923 | 3300009156 | Populus Rhizosphere | GFQAPELFAATALVSAVSITIVLGLDALNERLSHWRR* |
| Ga0075423_100664216 | 3300009162 | Populus Rhizosphere | QAPELFAATALVSVASIAIVLGLDALNERLSHWRH* |
| Ga0105248_116960671 | 3300009177 | Switchgrass Rhizosphere | VLGSLANGFQAPELFAATALVSASSIAIVLGLDALNDRLSHWRG* |
| Ga0105249_109810534 | 3300009553 | Switchgrass Rhizosphere | NSLANGFQAAELFAATALVSAASIAIVLGLDALNERLSHWRS* |
| Ga0105164_102418391 | 3300009777 | Wastewater | GYTLGALANGFQAPELFAATLLVSAVSITIVLALDALGERLGRWR* |
| Ga0105061_10874331 | 3300009807 | Groundwater Sand | MGYVLSSLANGFRAPELFAATALVSAASIVIVLSLDVLNDRLSQWRGELR* |
| Ga0105062_11377651 | 3300009817 | Groundwater Sand | QAPELFAATGLVSAASIAIVLTLDHLNDKLSHWRG* |
| Ga0105072_10790553 | 3300009818 | Groundwater Sand | SFANGFQAPELFAATALVSAASIAIVLALDHLNDKLSHWRG* |
| Ga0105058_10715781 | 3300009837 | Groundwater Sand | RAPELFAATALVSAASIALVLGLDAINEHLSRWR* |
| Ga0126382_100992671 | 3300010047 | Tropical Forest Soil | GFQAPELFAATALVSVASIAIVLALDHVNDRLSRWRG* |
| Ga0126382_107294462 | 3300010047 | Tropical Forest Soil | VMGGLANGFRAPELFAATGLVSVASIAIVLGLDHLNEKLSHWRG* |
| Ga0134070_103671602 | 3300010301 | Grasslands Soil | VMGSLANGFQAPELFAATGLVSAASIAIVLALDHLNDKLSHWRG* |
| Ga0134088_104880772 | 3300010304 | Grasslands Soil | GSVMGGLANGFRAPELFAATGLVSVASIAIVLGLDHLNEKLSHWRG* |
| Ga0134086_102259002 | 3300010323 | Grasslands Soil | SLANAFRAPELFAATGLVSVASIAIVLALDHVNERLSHWRG* |
| Ga0134064_103697681 | 3300010325 | Grasslands Soil | GMGYVMGAFANGFQAPELFAATGLVSAASIAIVLALDHVSERLSHWRG* |
| Ga0134071_101516224 | 3300010336 | Grasslands Soil | MGALANGFQAPELFAATGLVSAASIAIVLALDHVSERLSRWRG* |
| Ga0126376_122627962 | 3300010359 | Tropical Forest Soil | GFRAPELFAATGLVSVASIAIVLGLDHLNEKLSHWRG* |
| Ga0126377_119524371 | 3300010362 | Tropical Forest Soil | LFAATALVSAASIVIVLSLDALNDRLSHWRGESR* |
| Ga0136847_131496481 | 3300010391 | Freshwater Sediment | RAPELFAATALVSAASIAAVLGLDRLNERLSHWRG* |
| Ga0126383_110941733 | 3300010398 | Tropical Forest Soil | GSFANGFQAPELFAATALVSAASIAIVLALDSLNERLSGWRG* |
| Ga0126383_131520282 | 3300010398 | Tropical Forest Soil | YANGFQAPELFAATALVSAASITIVLALDHLNEKLSRWRG* |
| Ga0124844_11009643 | 3300010868 | Tropical Forest Soil | APELFAATALVSAASIAIVLALDSLNERLSGWRG* |
| Ga0137426_11819283 | 3300011435 | Soil | GMGSVMGALANGFRAPELFAATALVSAASIVSVLGLDALSERLSHWRD* |
| Ga0137429_11596362 | 3300011437 | Soil | LANGFQAPELFAATGLVSAASILLVLALDALNERLARWRG* |
| Ga0137388_100111281 | 3300012189 | Vadose Zone Soil | MGYVLGSFANGFQAPELFAATALVSAASIAIVLALDHVNDKLSRWRG* |
| Ga0137364_110163452 | 3300012198 | Vadose Zone Soil | GMGYVMSSFANGFRAPELFAATALVSAASIAIVLVLDHVNERLSHWRG* |
| Ga0137362_112379453 | 3300012205 | Vadose Zone Soil | ANGFRAPELFAATALVSVSSIAIVLGLDALNERLSHWRS* |
| Ga0137376_102481873 | 3300012208 | Vadose Zone Soil | LANGFQAPELFAATALVSAASIVIVLSLDVLNDRLAQWRGEVR* |
| Ga0137370_101485331 | 3300012285 | Vadose Zone Soil | PELFAATALVSAASIVIVLSLDSLNDRLSHWRGELR* |
| Ga0137387_102944271 | 3300012349 | Vadose Zone Soil | LANGFRAPELFAATGLVSAASIAIVLGLDHVNERLSHWRG* |
| Ga0137387_110871322 | 3300012349 | Vadose Zone Soil | VMGSLANGFQAPELFAATALVSATSIAIVLGLDQLNERLSRWRG* |
| Ga0137367_105504411 | 3300012353 | Vadose Zone Soil | AFRAPELFAATGLRSIASSAIVLALDAVNERLSRWR* |
| Ga0137360_102508701 | 3300012361 | Vadose Zone Soil | LFAATALVSAASIVIVLSLDVLNDRLSQWRGEIR* |
| Ga0137390_116822801 | 3300012363 | Vadose Zone Soil | AGVRGMGWELSAFANAFQAPELFAATLLVSAVAIAIGLVLDGLGERLARWR* |
| Ga0157313_10413972 | 3300012503 | Arabidopsis Rhizosphere | FLAPELFAATALVSAASIAIVLALDHLNDKLSRWRG* |
| Ga0137358_104151352 | 3300012582 | Vadose Zone Soil | LANGFRAPELFAATALVSAASIVIVLSLDVLNDRLAQWRGEVR* |
| Ga0137394_102762951 | 3300012922 | Vadose Zone Soil | APELFAATALVSAASIAIVLALDHLNDKLSRWRG* |
| Ga0137419_102641263 | 3300012925 | Vadose Zone Soil | YVMGSLANGFRAPELFAATALVSATSIAIVLGLDHVNARLSRWRG* |
| Ga0137404_103323631 | 3300012929 | Vadose Zone Soil | NSFANGFRAPELFAATALVSVSSIAIVLGLDALNERLSHWRS* |
| Ga0137407_102319831 | 3300012930 | Vadose Zone Soil | GFQAPELFAATALVSVSSIVIVLGLDALNERLSHWRS* |
| Ga0137410_106518831 | 3300012944 | Vadose Zone Soil | LFAATALVSAASIVIVLSLDVLNDHLSQWRGEPR* |
| Ga0126375_101396014 | 3300012948 | Tropical Forest Soil | VLGSYANGFQAPELFAATALVSVASIAIVLALDHVNERLSRWRG* |
| Ga0126375_106288303 | 3300012948 | Tropical Forest Soil | GMGHVLGSYANGFQAPELFAATALVSAASIAIVLALDHVNDRLSRWRG* |
| Ga0134081_101325872 | 3300014150 | Grasslands Soil | SLANGFRAPELFAATALVSAASIVIVLSLDVLNDRLSQWRGEPR* |
| Ga0134075_103713861 | 3300014154 | Grasslands Soil | MGGLANGFRAPELFAATGLVSVASIAIVLGLDHLNEKLSHWRG* |
| Ga0075311_10970411 | 3300014259 | Natural And Restored Wetlands | GFQAPELFAATALVSAASIGIVLGLDALNDRLARWRS* |
| Ga0180063_12810022 | 3300014885 | Soil | FRAPELFAATGLVSAASIAIVLALDALNERLSRWR* |
| Ga0137403_114199452 | 3300015264 | Vadose Zone Soil | GMGYMMGSLANGFQAPELFAATALVSATSIAIVLGLDHVNERLSRWRG* |
| Ga0134089_104398681 | 3300015358 | Grasslands Soil | MGALANCFQAPELFAATGLVSAASIAIVLALDHVSERLARWRG* |
| Ga0134085_100682141 | 3300015359 | Grasslands Soil | MGSLANGFQAPELFAATALVSATSIAIVLGLDQLNERLSRWRG* |
| Ga0132258_111246541 | 3300015371 | Arabidopsis Rhizosphere | GFQAPELFAATALVSAASIAIVLALDHLNDKLSRWRG* |
| Ga0132256_1001281141 | 3300015372 | Arabidopsis Rhizosphere | NGFQAPELFAATALVSAASIVIVLALDHLNEKLSSWRG* |
| Ga0132257_1025435271 | 3300015373 | Arabidopsis Rhizosphere | GFQAPELFAATALVSAASIVIVLSLDSLNDRLSQWREESR* |
| Ga0132255_1047195163 | 3300015374 | Arabidopsis Rhizosphere | GMGHVLGSLANGFQAPELFAATALVSAASIAIVLGLDALNDRLSHWRG* |
| Ga0184634_100165511 | 3300018031 | Groundwater Sediment | SLANGFQAPELFAATALVSISSIVIVLGLDALNERLSHWRS |
| Ga0184615_103775081 | 3300018059 | Groundwater Sediment | NGFQAPELFAATALVSISSIVIVLGLDALNERLSHWRS |
| Ga0066662_107471723 | 3300018468 | Grasslands Soil | VSLSRAHCYVMGALANGFQAPELFAATGLVSAASIAIVLALDHVSERLSRWRG |
| Ga0209827_109620114 | 3300025149 | Thermal Springs | SGLANAFQAAELFAATALVSALSIGIVVGLEVLNRRLGRWRG |
| Ga0207709_112878662 | 3300025935 | Miscanthus Rhizosphere | MGSLANGFQAPELFAATALVSAASIAIVLALDTLNDRLSHWRG |
| Ga0207669_101817231 | 3300025937 | Miscanthus Rhizosphere | GMGHVLGSLANGFQAPELFAATALVSASSIAIVLGLDALNDRLSHWRG |
| Ga0209235_10158613 | 3300026296 | Grasslands Soil | MAFQAPELFAATGLVSAASIAIVLALDHLNDKLSHWRG |
| Ga0209236_11277192 | 3300026298 | Grasslands Soil | FRAPELFAATGLVSAASIAIVLVLDHVNERLSHWRG |
| Ga0209027_11731382 | 3300026300 | Grasslands Soil | GFRAPELFAATALVSAASIVIVLSLDALNDRLSQWRGDLR |
| Ga0209802_13021491 | 3300026328 | Soil | MGYVMSSLANGFRAPELFAATGLVSAASIAIVLVLDHVNERLSHWRG |
| Ga0209158_12999152 | 3300026333 | Soil | LGSFANGFQAPELFAATALVSAASIAIVLALDHLNDRLSRWRG |
| Ga0209804_11890921 | 3300026335 | Soil | FRAPELFAATALVSAASIVIVLSLDVLNDRLSQWRGEIR |
| Ga0209378_10800881 | 3300026528 | Soil | FQAPELFAATGLVSAASIAIVLALDHLNDKLSHWSG |
| Ga0209474_100895704 | 3300026550 | Soil | GMGYVLSSLANGFRAPELFAATALVSAASIVIVLSLDVLNDRLSQWRGEIR |
| Ga0209648_101653341 | 3300026551 | Grasslands Soil | AFANAFQAPELFAATLLVSAVAIAIGLVLDGLGERLARWR |
| Ga0209845_10122733 | 3300027324 | Groundwater Sand | GSLANGFQAPELFAATGLVSAASIAIVLALDHLNDKLSHWRG |
| Ga0209843_10088571 | 3300027511 | Groundwater Sand | SLANGFQAPELFAATGLVSAASIAIVLALDHLNDKLSHWRG |
| Ga0209466_10578951 | 3300027646 | Tropical Forest Soil | ANGFQPPELFAATALVSTASIAIVLALDSLNERLSRWRA |
| Ga0209689_13649151 | 3300027748 | Soil | GYVMSSLANGFRAPELFAATGLVSAASIAIVLVLDHVNERLSHWRG |
| Ga0209814_105500922 | 3300027873 | Populus Rhizosphere | MGHVLGSFANGFQAPELFAATALVSMASIVIVLSLDALNDRLSHWRGEAR |
| Ga0209590_105479953 | 3300027882 | Vadose Zone Soil | VMGALANGFQAPELFAATGLVSAASIAIVLALDHVSERLSRWRG |
| Ga0307498_102056253 | 3300031170 | Soil | GFQAPELFAATALVSAASIAIVLALDHLNDKLSRWRG |
| (restricted) Ga0255312_10684181 | 3300031248 | Sandy Soil | MGALMGALANGFRAPELFAATALVSAASIALVLALDALNERLSRWR |
| Ga0307408_1007569111 | 3300031548 | Rhizosphere | FQAPELFAATALVSVASIVIVLSLDAVNDRLSHWRGDAR |
| Ga0307469_101734211 | 3300031720 | Hardwood Forest Soil | FQAPELFAATALVSAASIAIVLALDVLNDRLSHWRGQ |
| Ga0318493_103864021 | 3300031723 | Soil | GHMLGSYANGFQAPELFAATALVSAASIAIVLVLDHVNDKLSRWRG |
| Ga0318500_100275871 | 3300031724 | Soil | GHVLGSYANGFQAPELFAATALVSAASIAIVLVLDHVNDKLSRWRG |
| Ga0307473_107817731 | 3300031820 | Hardwood Forest Soil | GFQAPELFAATALVSAASIAIVLALGALSDRLSHWRG |
| Ga0307473_108682143 | 3300031820 | Hardwood Forest Soil | GMGAELAARANAFQAPELFAATLLVSTVSIAIVLALDALGDRLSRWR |
| Ga0307412_110827442 | 3300031911 | Rhizosphere | VMGSLANGFQAPELFAATALVSAASIAIVLGLDALNERLSHWR |
| Ga0306926_114048861 | 3300031954 | Soil | SYANGFQAPELFAATALVSAASITIVLALDHLNEKLSRWRG |
| Ga0307416_1005838592 | 3300032002 | Rhizosphere | HVLGSFANGFQAPELFAATALVSTASIVIVLSLDALNDRLSHWRGDAR |
| Ga0307416_1029759272 | 3300032002 | Rhizosphere | LANGFQAPELFAATALVSAASIVIVLSLDVLNDRLSHWRGDAR |
| Ga0310897_102391604 | 3300032003 | Soil | LNSLANGFQAAELFAATALVSAASIAIVLGLDALNERLSHWRS |
| Ga0310890_110049323 | 3300032075 | Soil | HVLGSLANGFQAPELFAATALVSAASIVIVLGLDALNDRLSHWRG |
| Ga0307471_1018036271 | 3300032180 | Hardwood Forest Soil | FQAPELFAATALVSVSSIAIVLGLDALNERLSIWRG |
| Ga0307471_1031287031 | 3300032180 | Hardwood Forest Soil | GFRAPELFAATGLISVVSIAIVLALDALNERLSRWR |
| Ga0335085_110358611 | 3300032770 | Soil | ANGFQAPELFAATALVSASSIAIVLALDTLNDRLSHWRG |
| Ga0373948_0019662_1172_1279 | 3300034817 | Rhizosphere Soil | QAAELFAATALVSAASIAIVLGLDALNERLSHWRS |
| Ga0373950_0177598_343_486 | 3300034818 | Rhizosphere Soil | MGYVLSSYANGFQAPELFAATALVSAASIAIVLALDHLNDKLSRWRG |
| ⦗Top⦘ |