


| Basic Information | |
|---|---|
| Family ID | F055122 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MNGTSVIDVGRPAVRRRTLSRSLRGGLKGGEYTWAVAFVVPY |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.26 % |
| % of genes near scaffold ends (potentially truncated) | 97.12 % |
| % of genes from short scaffolds (< 2000 bps) | 92.81 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.842 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.827 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.180 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.043 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.71% β-sheet: 0.00% Coil/Unstructured: 64.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF13416 | SBP_bac_8 | 41.73 |
| PF01547 | SBP_bac_1 | 5.04 |
| PF04909 | Amidohydro_2 | 1.44 |
| PF00528 | BPD_transp_1 | 1.44 |
| PF13458 | Peripla_BP_6 | 0.72 |
| PF00884 | Sulfatase | 0.72 |
| PF02653 | BPD_transp_2 | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.84 % |
| Unclassified | root | N/A | 2.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320006|FACEOR_FYWIORV02G2ZRI | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300000955|JGI1027J12803_107322660 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300000956|JGI10216J12902_100958877 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300002886|JGI25612J43240_1082182 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300002908|JGI25382J43887_10099601 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300004156|Ga0062589_101445198 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 673 | Open in IMG/M |
| 3300004267|Ga0066396_10121204 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300004281|Ga0066397_10152753 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300004801|Ga0058860_11382274 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005295|Ga0065707_10198042 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300005332|Ga0066388_102009917 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300005332|Ga0066388_104801418 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 687 | Open in IMG/M |
| 3300005440|Ga0070705_101416155 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005467|Ga0070706_100202254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1855 | Open in IMG/M |
| 3300005467|Ga0070706_100208845 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300005467|Ga0070706_101649106 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 584 | Open in IMG/M |
| 3300005468|Ga0070707_100320477 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300005518|Ga0070699_101169698 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300005536|Ga0070697_100370853 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300005536|Ga0070697_102092459 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005536|Ga0070697_102093688 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
| 3300005547|Ga0070693_100405043 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300005558|Ga0066698_10584813 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005586|Ga0066691_10146606 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300005598|Ga0066706_10575783 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300005713|Ga0066905_101663122 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005764|Ga0066903_107875284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 547 | Open in IMG/M |
| 3300005841|Ga0068863_101731391 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
| 3300005875|Ga0075293_1006194 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300006173|Ga0070716_100946055 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300006579|Ga0074054_11462178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 725 | Open in IMG/M |
| 3300006796|Ga0066665_10644626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 844 | Open in IMG/M |
| 3300006796|Ga0066665_10745303 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300006797|Ga0066659_11069278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 674 | Open in IMG/M |
| 3300006806|Ga0079220_10670435 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300006854|Ga0075425_100911695 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300006854|Ga0075425_102346506 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006904|Ga0075424_101684496 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300006914|Ga0075436_100603714 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300006914|Ga0075436_100772011 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300006954|Ga0079219_10336446 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300007076|Ga0075435_100267500 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300009012|Ga0066710_101025423 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300009090|Ga0099827_11231072 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300009094|Ga0111539_11341371 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300009147|Ga0114129_11691716 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300009162|Ga0075423_12195605 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300009792|Ga0126374_10243229 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300010043|Ga0126380_12125603 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
| 3300010046|Ga0126384_12392866 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010047|Ga0126382_11755865 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300010109|Ga0127497_1111906 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300010303|Ga0134082_10072633 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300010323|Ga0134086_10051626 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300010333|Ga0134080_10173306 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300010333|Ga0134080_10362143 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300010336|Ga0134071_10118138 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300010337|Ga0134062_10015879 | All Organisms → cellular organisms → Bacteria | 2824 | Open in IMG/M |
| 3300010359|Ga0126376_11041577 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300010361|Ga0126378_11253248 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300010361|Ga0126378_13470743 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010366|Ga0126379_13554649 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300010376|Ga0126381_103267927 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300010399|Ga0134127_12856281 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010401|Ga0134121_12939139 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300011269|Ga0137392_11193855 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 619 | Open in IMG/M |
| 3300011270|Ga0137391_11434511 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300011271|Ga0137393_10712819 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300012198|Ga0137364_10260689 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300012207|Ga0137381_10263362 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300012207|Ga0137381_11484650 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 570 | Open in IMG/M |
| 3300012211|Ga0137377_11106949 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300012350|Ga0137372_10199610 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300012350|Ga0137372_10400713 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300012355|Ga0137369_10494289 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300012361|Ga0137360_10512236 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300012582|Ga0137358_10032307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3437 | Open in IMG/M |
| 3300012685|Ga0137397_11309515 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
| 3300012911|Ga0157301_10313391 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300012918|Ga0137396_10646544 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300012922|Ga0137394_11526984 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012923|Ga0137359_10870431 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300012925|Ga0137419_10168903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1595 | Open in IMG/M |
| 3300012930|Ga0137407_10528234 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300012971|Ga0126369_13542282 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012972|Ga0134077_10235607 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300013308|Ga0157375_11393843 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300014326|Ga0157380_11050338 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300015374|Ga0132255_102562608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 779 | Open in IMG/M |
| 3300016371|Ga0182034_10962844 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300017656|Ga0134112_10001066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7971 | Open in IMG/M |
| 3300017657|Ga0134074_1142727 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300017659|Ga0134083_10001134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7559 | Open in IMG/M |
| 3300017944|Ga0187786_10558255 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300017973|Ga0187780_10846231 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300017994|Ga0187822_10162104 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300018089|Ga0187774_10264224 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 982 | Open in IMG/M |
| 3300018433|Ga0066667_11547561 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300018482|Ga0066669_11862800 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300019248|Ga0180117_1128441 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300021151|Ga0179584_1414370 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300021361|Ga0213872_10087261 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300021388|Ga0213875_10482158 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300022504|Ga0242642_1004440 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300025885|Ga0207653_10118766 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300025910|Ga0207684_11485640 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300025922|Ga0207646_11367113 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300025940|Ga0207691_10738166 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300026075|Ga0207708_10858944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300026089|Ga0207648_11189299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 716 | Open in IMG/M |
| 3300026095|Ga0207676_11705528 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 628 | Open in IMG/M |
| 3300026314|Ga0209268_1049030 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300026327|Ga0209266_1253357 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300026328|Ga0209802_1273458 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300026446|Ga0257178_1018571 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300026524|Ga0209690_1119552 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300026529|Ga0209806_1041679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2212 | Open in IMG/M |
| 3300027651|Ga0209217_1120450 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300027882|Ga0209590_10808225 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300027903|Ga0209488_10420316 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300027909|Ga0209382_10144328 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
| 3300027909|Ga0209382_12248960 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10087306 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300031538|Ga0310888_10029332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2408 | Open in IMG/M |
| 3300031573|Ga0310915_10263886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 1213 | Open in IMG/M |
| 3300031720|Ga0307469_11883308 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
| 3300031720|Ga0307469_12512543 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031820|Ga0307473_10773220 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300031820|Ga0307473_11498313 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031912|Ga0306921_10774810 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300032001|Ga0306922_12013839 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300032205|Ga0307472_102451217 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300032261|Ga0306920_102493329 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300034090|Ga0326723_0321762 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300034661|Ga0314782_063875 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300034678|Ga0314803_101115 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.16% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.44% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.44% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320006 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010109 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORE_2410320 | 2032320006 | Soil | MSSVSVADVGRPALRWHTLSRSLRGGLKGGEYTWAVAFVVPYLAVFLTFVAYPVIYGL |
| JGI1027J12803_1073226602 | 3300000955 | Soil | MDNASVVAVGRPAVRRRTLSRYLRGNLKGGEYTWALAFVVPYAA |
| JGI10216J12902_1009588771 | 3300000956 | Soil | MDTASVVEIGRPSVRRDSVWRSLRGPLKGSEYTWALAFVVPYVAVFLTFVAYPVA |
| JGI25612J43240_10821821 | 3300002886 | Grasslands Soil | MDSASVVDVGRPAVRRGTLARSLRGGLKGGEYTWAVAFVVPYIAVF |
| JGI25382J43887_100996011 | 3300002908 | Grasslands Soil | MNGTSVIDVGRPAIRRRTLSRSLRGGLKGGEYTWAVAFVVPYIAVFLTF |
| Ga0062589_1014451982 | 3300004156 | Soil | MMDSASVVDVRRPSVRWHALSRSLRGGLKGGEYTWAVAFV |
| Ga0066396_101212041 | 3300004267 | Tropical Forest Soil | MNGVSVAEVDRSSVRWRALSRSLRGGLKGAEYTWSLAFVVPYLAVFVTF |
| Ga0066397_101527531 | 3300004281 | Tropical Forest Soil | MNGASAIDIGRPAVRRRTLARSLRGPLKGGEYTWALAFVVPYIAVF |
| Ga0058860_113822741 | 3300004801 | Host-Associated | MTDSASVVDVGRPAVRRGTLSRSLRGGLKGGEYTWAVAFVVPYVAVFAAFV |
| Ga0066679_109474922 | 3300005176 | Soil | MDTASVVEIGRPSVRRETVWRSLRGPLKGTEYTWALAFVVPYVAVFLTFVAYPVVYGL |
| Ga0065707_101980421 | 3300005295 | Switchgrass Rhizosphere | MMNGTSVLDLGRPAVRRQAWSRYLRGGLKGGEYTWALAFLVPYVAVFLTF |
| Ga0066388_1020099171 | 3300005332 | Tropical Forest Soil | MNSASVADISSPAIRRRTLSRSLRGNLKGGEYTWALAFVVPYLAVF |
| Ga0066388_1048014181 | 3300005332 | Tropical Forest Soil | MMDSASVVDIGRPALRWRTLSRSLRGGLKGGEYTWAVAFLVPYIAVFVA |
| Ga0070705_1014161551 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSASVVDVSRLAIRRRTLARSLRGGLKGGEYAWAVAFVVP |
| Ga0070706_1002022541 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGASVVDVGRPAIRQRTLLRSLRGGLKGGEYTWALAFVVPYIAVFVTFVAYPVVYG |
| Ga0070706_1002088451 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGTSAVEVSRPALRRRALSRSLRGSLKGGEYTWAVAFVVPYVAVFIT |
| Ga0070706_1016491061 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGTSAVDLSRPALRRRALSRSLRGSLKGGEYTWAVAFVVPYVAVFIT |
| Ga0070707_1003204771 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGTSAVDLSRPALRRRALSRSLRGSLKGGEYTWAVAFVVPYV |
| Ga0070699_1011696981 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSASAVDIGRPAIRRQTLTRYLRGGLKGGEYTWAVAFVV |
| Ga0070697_1003708532 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MMDNASVVDVDRLALRRRTLSLSLRGGLKGGEYAWALAFVVPY |
| Ga0070697_1020924591 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MASTSALDIGRPSVRRQALSRYFRGNLKGGEYTWAAAFLVPYVAV |
| Ga0070697_1020936881 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGTSAVDVSRPALRRRALSRSLRGSLKGGEYTWAVAFVVP |
| Ga0070693_1004050431 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MADSASVVNVPRPAVRFEALSRSLRGGLKGGEYTWAIAFV |
| Ga0066698_105848131 | 3300005558 | Soil | MDSTSVVDVGRPAVRRGTLSQFLRGSLKGAEYTWAVAFVVPYI |
| Ga0066691_101466061 | 3300005586 | Soil | MNGTSVIDVGRPASRRRTLSRSLRGGLKGGEYTWAVAFV |
| Ga0066706_105757831 | 3300005598 | Soil | MNGTSVLDIERPSIRRHALARYFRGNLKGGEYTWALAFLVPYVAVF |
| Ga0066905_1016631222 | 3300005713 | Tropical Forest Soil | MIDSASVLDLGRPAVRWRSFVRSLRGSLKGGEYTWAVAFVVPYA |
| Ga0066903_1078752842 | 3300005764 | Tropical Forest Soil | MMNSASVADISRPAIQRRTLSRSLRGNLKGGEYTWALAFVVPYLAVFITFVAYP |
| Ga0068863_1017313911 | 3300005841 | Switchgrass Rhizosphere | MNGTSAVDVSRFALRRRALSRSFRGGLKGGEYTWAVAFVVPYVA |
| Ga0075293_10061941 | 3300005875 | Rice Paddy Soil | MDSASVAISRPAPWRDSLSRSLRGGLKGGEYTWAVAFVVPYLA |
| Ga0070716_1009460552 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSVSVADIGRPALRWHTLSRSLRGGLKGGEYTWAVAFV |
| Ga0074054_114621781 | 3300006579 | Soil | MMNSASVADIDRPAVRRATLSRSLRGGLKGGEYTWALAFVVPYL |
| Ga0066665_106446262 | 3300006796 | Soil | MATTSVLDLGRPSIRRQTWSRYFRGNLKGGEYTWAIAFLVPYVAVFVTFVVYP |
| Ga0066665_107453031 | 3300006796 | Soil | MDSASVIDAVRPAVRRRTLPRALRGNLKGGEYTWAVAFVIPYIAV |
| Ga0066659_110692781 | 3300006797 | Soil | MNGTSVLDVARPALRGQTLLRHFRGHLKGGEYTWALAFLVPYVAVFLTFVVY |
| Ga0079220_106704351 | 3300006806 | Agricultural Soil | MDSTSVVDIRRPAVRRTTLSRHLRGGLKGGEYAWAVAF |
| Ga0075425_1009116952 | 3300006854 | Populus Rhizosphere | MNGASVVDIARPAIRRRTLARSLRGTLKGGEYTWAL |
| Ga0075425_1023465062 | 3300006854 | Populus Rhizosphere | MSSSVIDISRPAIRRRTLARSLRGTLKGGEYTWAVAFVVPYIAVFL |
| Ga0075424_1016844962 | 3300006904 | Populus Rhizosphere | MDNVSVVEVGRPAVRRRTLSRYLSGHLKGGEYTWAV |
| Ga0075436_1006037141 | 3300006914 | Populus Rhizosphere | MNGTSVIDVGRPAIRRRTLSRSLRGGLKGGEYTWA |
| Ga0075436_1007720112 | 3300006914 | Populus Rhizosphere | MNGTSALDIARPAVRRRDWSRYFRGNLKGGEYTWAVAFLVPYVAVFLTFVV |
| Ga0079219_103364462 | 3300006954 | Agricultural Soil | MNSVSVADIGRPALRWHTLSRSLRGGLKGGEYTWAVAF |
| Ga0075435_1002675001 | 3300007076 | Populus Rhizosphere | MNGTSVIDVARPAVRRRTLSRSLRGGLKGGEYTWAV |
| Ga0066710_1010254231 | 3300009012 | Grasslands Soil | MDSASVADVARPAIRWRTLSRSLRGGLKGGEYAWAVAFV |
| Ga0099827_112310722 | 3300009090 | Vadose Zone Soil | MDSASVVDIGRSAIRRQTLSRYLHGSLKGGEYTWAVAFVVPYVAVFLIFVAYPVVY |
| Ga0111539_113413711 | 3300009094 | Populus Rhizosphere | MNGTSVIDVARPAVRRRTLSRSLRGGLKGGEYTWALAFVVPYIAV |
| Ga0114129_116917162 | 3300009147 | Populus Rhizosphere | MDTASVVAVGRPAVRRRALARYLHGNLKGGEYTWAVAFLVP |
| Ga0075423_121956051 | 3300009162 | Populus Rhizosphere | MNGTSAVEVSRFALRRRALSRSLRGSLKGGEYTWAVAFVVPYVAVFITFVAYPV |
| Ga0126374_102432291 | 3300009792 | Tropical Forest Soil | MMDSASAVAIGRPGLQWRTLSRSLRGGLKGGEYTWAVA |
| Ga0126380_121256032 | 3300010043 | Tropical Forest Soil | MIDSASVVDVGRPAVARRTLARSLRGGLKGGEYTWAIAFVVPYIAVFLTFVAYP |
| Ga0126384_123928661 | 3300010046 | Tropical Forest Soil | MDTASVVAVGRPAVRRRALARYLRGNLKGGEYTWAVAFLVPYVAV |
| Ga0126382_117558652 | 3300010047 | Tropical Forest Soil | MDTASVVAVGHPAVRRRVLARYLHGHLKGGEYAWA |
| Ga0127497_11119061 | 3300010109 | Grasslands Soil | MNGTSVIDVGRPALRRRALSRSLRGGLKGGEYTWAVAFVVPYIA |
| Ga0134082_100726331 | 3300010303 | Grasslands Soil | MNGTSVIDVGRRPAIRRRTLSRSLRGGLKGGEYTWA |
| Ga0134086_100516262 | 3300010323 | Grasslands Soil | MNGTSVIDVGRRPAIRRRTLSRSLRGGLKGGEYTWAVAFVVPYIAVFLTFVA |
| Ga0134080_101733061 | 3300010333 | Grasslands Soil | MMDTASVVEIGRPSVRRDSIWRSLRGPLKGSEYTWALAFVVPYIA |
| Ga0134080_103621431 | 3300010333 | Grasslands Soil | MMDSASVVDVGRPAIRRRTLSRSLRGGLKGGEYTWAVAFVVPYIAVFLAF |
| Ga0134071_101181382 | 3300010336 | Grasslands Soil | MNGTSVIDVGRPALRRGALSRSLRGGLKGGEYTWAVAFVVPYIAVFL |
| Ga0134062_100158791 | 3300010337 | Grasslands Soil | MMDTASVVEIGRPSVRRDSIWRSLRGPLKGSEYTWALAFVVPYIAVFVT |
| Ga0126376_110415772 | 3300010359 | Tropical Forest Soil | MASVSIAEVSRPALWRHTLSRSLRGSLKGGEYTWAVAFVVPYVAVFITFVA |
| Ga0126378_112532481 | 3300010361 | Tropical Forest Soil | MNGASVAALDRAGVRWRALSRSLRGGLKGAEYTWSLAFVVPYLAVF |
| Ga0126378_134707431 | 3300010361 | Tropical Forest Soil | MMDSASAVAIGRPGLQWRTLSRSLRGGLKGGEYTWA |
| Ga0126379_135546492 | 3300010366 | Tropical Forest Soil | MDTASVVAVGRPAVRRQALGLYLRGNLKGGEYTWAVAFLVP |
| Ga0126381_1032679272 | 3300010376 | Tropical Forest Soil | MDSASAIDLSRPTARGLSRSLRGGLKGGEYTWALAFVVPYI |
| Ga0134127_128562812 | 3300010399 | Terrestrial Soil | MSTSIVNVSRPAVQRRTFARSLRGGLKGGEYTWAL |
| Ga0134121_129391392 | 3300010401 | Terrestrial Soil | MNSVSAVDVARPGLQRRTLSRSLRGSLKGDEYTWALAFVVPYLVVFVTFVA |
| Ga0137392_111938551 | 3300011269 | Vadose Zone Soil | MMDSASVIDVSRPAVRRRTLSRALRGNLKGGEYTWAVAFVVPYIAVFATF |
| Ga0137391_114345111 | 3300011270 | Vadose Zone Soil | MDSASVVDIGRPASRGQALSRSLRGGLKGGEYTWAVAFVVPYIAVFVA |
| Ga0137393_107128192 | 3300011271 | Vadose Zone Soil | MMASTSVLDIGRPSIRRQTWSRYFRGNLKGGEYTWAVAFLVPYVAVFLTFVVYPIV |
| Ga0137364_102606892 | 3300012198 | Vadose Zone Soil | MNGTAAVEVSRFALRRRALSRSFRGGLKGGEYTWAVAFV |
| Ga0137381_102633621 | 3300012207 | Vadose Zone Soil | MDSTSVVDVGRPAVRRGTLSQFLRGSLKGAEYTWAVAFVVPYIAVFVTF |
| Ga0137381_114846501 | 3300012207 | Vadose Zone Soil | MDSASVVEIGRPAVRRQTLWRYFRGDLKTTEYTWAVAF |
| Ga0137377_111069491 | 3300012211 | Vadose Zone Soil | MNGTSVIDVGRPAIRRRTLSRSLRGGLKGGEYTWAS |
| Ga0137372_101996101 | 3300012350 | Vadose Zone Soil | MMDGTSVVDVGRPAIRRRTLSLSRSLRGGLKGGEYTWAVA |
| Ga0137372_104007132 | 3300012350 | Vadose Zone Soil | MDSASVVDIGRPASRRRTLSRSLRGGLKGGEYTWAVAFVVP |
| Ga0137369_104942891 | 3300012355 | Vadose Zone Soil | MNGTSAIDVSRPAIRRRTLSRSLRGGLKGGEYTWAVAFVVPYIAVFLTFVA |
| Ga0137360_105122362 | 3300012361 | Vadose Zone Soil | MDSASVIDVGRPATRRRTLSRSLRGGLKGGEYTWAVAFVVPYVAVFVTFVAYP |
| Ga0137358_100323074 | 3300012582 | Vadose Zone Soil | MNGTSVIDVSRPAIRRRTLSRSLRGGLKGGEYTWAVAFVVPYI |
| Ga0137397_113095152 | 3300012685 | Vadose Zone Soil | MNGTSVIDAGRPALRRRALSRSLRGGLKGGEYTWAVAFVVPYIAVFLT |
| Ga0157301_103133911 | 3300012911 | Soil | MMNSASVADLGRPAVRRGTLSRSLRGGLKGGEYTWALAFVVPYLAVFV |
| Ga0137396_106465442 | 3300012918 | Vadose Zone Soil | MNGTSAVEVSRFALRRRALSRSFRGGLKGGEYTWAVAFVVPYVAV |
| Ga0137394_115269841 | 3300012922 | Vadose Zone Soil | MNGTSVIDVSRPAIRRRTFSRSLRGGLKGGEYTWAVAFVVPYIAVFLTFVAYPVVYGLWM |
| Ga0137359_108704311 | 3300012923 | Vadose Zone Soil | MDSTSVVDVGRPAVRRGTLSQFLRGSLKGAEYTWAVA |
| Ga0137419_101689031 | 3300012925 | Vadose Zone Soil | MNGASVVGVGRLAIRKRTLSRSLRGGLKGGEYTWAVAFVVPYIAVFLTFVAYPVVYGLWMGSEASL |
| Ga0137407_105282341 | 3300012930 | Vadose Zone Soil | MNGTSVIDAGRPALRRRTLSRSLRGGLKGGEYTWAVAFVVPYIAVFLTFV |
| Ga0126369_135422822 | 3300012971 | Tropical Forest Soil | MNGVSVAEVDRPGVRWRALSRSLRGGLKGAEYTWSLAFVVPYLAVFVTFVA |
| Ga0134077_102356071 | 3300012972 | Grasslands Soil | MTDTASVVEISRPAIRRRTLARYFRGSLKGGEYTWAVAFVVPYVAVFLTFVAYPVVYGL |
| Ga0157375_113938432 | 3300013308 | Miscanthus Rhizosphere | MNGTSVIDVGRPAVRRRTLSRSLRGGLKGGEYTWAVAFVVPYVAVFLTFV |
| Ga0157380_110503381 | 3300014326 | Switchgrass Rhizosphere | MNGTSVIDVGRPAVRRRTLSRSLRGGLKGGEYTWAVAFVVPY |
| Ga0132255_1025626081 | 3300015374 | Arabidopsis Rhizosphere | MIDSASVVDVRRPALRWHALSRSLRGGLKGGEYTWAVAFIVPYLAVFVTFVAYPVIYGL |
| Ga0182034_109628441 | 3300016371 | Soil | MMDSASVVDVGRPALRWRTLSRSLRGGLKGGEYTWAVAFLVPYIAVFVA |
| Ga0134112_100010667 | 3300017656 | Grasslands Soil | MNGTSVIDVGRPALRRRALSRSLRGGLKGGEYTWAVAFVVPYIAVFLTFVAYPVVYGLWM |
| Ga0134074_11427272 | 3300017657 | Grasslands Soil | MNGTSAVDVSRFALRRRALSRSFRGGLKGGEYTWAVAFVVPY |
| Ga0134083_100011341 | 3300017659 | Grasslands Soil | MNGTSVIDVGRPALRRRALSRSLRGGLKGGEYTWAVAFVVPYIAVFLTFVAYPVV |
| Ga0187786_105582551 | 3300017944 | Tropical Peatland | MDSASAVAIGRPGLQWRTLSRSLRGGLKGREYTWAVAFVIP |
| Ga0187780_108462311 | 3300017973 | Tropical Peatland | MAGASVAEVSRPLLWRHTLSRSLRGSLKGGEYTWAIAFVVPYLAVFLTF |
| Ga0187822_101621042 | 3300017994 | Freshwater Sediment | MNGVSVAGIERPGLRWQMLSRSLRGGLKGGEYIWAVAFVMPYLAVFVTFVAY |
| Ga0187774_102642241 | 3300018089 | Tropical Peatland | MNGVSVAHVGRPALRWHTLSRSLRGGLKGGEYIWAVAFVVP |
| Ga0066667_115475612 | 3300018433 | Grasslands Soil | MATSVLDIGRPSIRRQALLRYFRGNLKGGEYTWAVAF |
| Ga0066669_118628001 | 3300018482 | Grasslands Soil | MNGTSAVDVSRPALRRRALSRSLRGSLKGGEYTWAVAFVVPYVAVFIAFV |
| Ga0180117_11284411 | 3300019248 | Groundwater Sediment | MDSASVVDIGRPPIRRGTLSRSLRGGLKGGEYTWALAFVVPYLAVFVAF |
| Ga0179584_14143702 | 3300021151 | Vadose Zone Soil | MDSTSVIDVGRPAIRRRTLSRSLRGGLKGGEYTWAVAFVVPYIAVFLT |
| Ga0213872_100872611 | 3300021361 | Rhizosphere | MSGLSAVGISRPAIVRPARSRYWRGSLKGSEYTWAVAFV |
| Ga0213875_104821581 | 3300021388 | Plant Roots | MTTASFVEVGRPAAVRRPFLSQLRGHLKGSEYTWAVAFIVPYAAVFLT |
| Ga0242642_10044401 | 3300022504 | Soil | MNSVSVADVGRPAIRWHTLSRSLRGGLKGGEYTWAVAFVVPYLAVFLTFVAYPVV |
| Ga0207653_101187662 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MMDGASVVDVGRPAIRRGTLSRSLRGGLKGGESTW |
| Ga0207653_104053281 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGASVLDIDRPAIRRRTLARSLRGTLKGGEYTWAVAFVVPYIAVFLTFVAYPVVYGLWMGS |
| Ga0207684_114856401 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSASVVDIRRPAVRWGTLSRSLRGGLKGGEYTWALAFVVTYIAVFVTFVAYP |
| Ga0207646_113671131 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSASVVDIARPALRRRTLSRVLRGSLKGGEYTWAVA |
| Ga0207691_107381662 | 3300025940 | Miscanthus Rhizosphere | MTDSASVVDVGRPAVRRGTLSRSLRGGLKGGEYTWAVAFVVPYVA |
| Ga0207708_108589443 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MADSASVVNVPRPAVRFEALSRSLRGGLKGGEYTWAIA |
| Ga0207648_111892992 | 3300026089 | Miscanthus Rhizosphere | MMDSASVVDVRRPSVRWHALSRSLRGGLKGGEYTWAVAFVVPYLAVFVTFVAYPVIYGLWMGSEA |
| Ga0207676_117055281 | 3300026095 | Switchgrass Rhizosphere | MNSASVVDIGRPAGRRGTLSRSLRGGLKGGEYTWALAFVVPYLAVFVAFV |
| Ga0209268_10490302 | 3300026314 | Soil | MMDRASVDRASVVDVARPAIWRRTLSRSLRGNLHGGEYAWAVAFVVPY |
| Ga0209266_12533572 | 3300026327 | Soil | MSGTSVIDVSRPAIRRRTLSRSLRGGLKGGEYTWAVAFVVPYIAVFLTFVAYPVVYGLW |
| Ga0209802_12734582 | 3300026328 | Soil | MMDNASVVDVGRPAIRWRAVSRSLRGGLKGGEYPWAVAFVLPYIAVFLVFVAYPVVYGLW |
| Ga0257178_10185712 | 3300026446 | Soil | MDGASVVDVGRPAIRRGTLSRSLRGGLKGGEYTWAVAFVVPYV |
| Ga0209690_11195521 | 3300026524 | Soil | MNGTSVIDVGRPAIRRRTLSRSLRGGLKGGEYTWAV |
| Ga0209806_10416793 | 3300026529 | Soil | MDSTSVVDVGRPAVRRGTLSQFLRGSLKGAEYTWAVAFVVPY |
| Ga0209217_11204501 | 3300027651 | Forest Soil | MNSVSVADVGRPAIRWHTLSRSLRGGLKGGEYTWAVAFVVPYLAVFLTF |
| Ga0209590_108082251 | 3300027882 | Vadose Zone Soil | MMDTTSVAGIGRPAVRRGTLSQFLRGSLKGGEYTWAVAFVVPYLAVFVAFVA |
| Ga0209488_104203162 | 3300027903 | Vadose Zone Soil | MNGASVVDVGRPVIRRHTLSRSLRGGLKGGEYTWAVA |
| Ga0209382_101443281 | 3300027909 | Populus Rhizosphere | MDTASVVAVGRPAIRRRALARYLHGNLKGGEYTWAVAFLVP |
| Ga0209382_122489601 | 3300027909 | Populus Rhizosphere | MDNVSVVEVGRPAVRRRTLSRYLSGHLKGGEYTWAVAFLVPYVAVFLTFV |
| (restricted) Ga0255310_100873062 | 3300031197 | Sandy Soil | MDSASVVDLHRPTVGRGTFLRSLRGGLKGGEYTWALAFVVPYIAVFL |
| Ga0310888_100293323 | 3300031538 | Soil | MNGASFVDIGRPAIRRRTLARSLRGTLKGGEYTWAVAFV |
| Ga0310915_102638861 | 3300031573 | Soil | MMDSASVVDVGRPALRWRTLSRSLRGGLKGGEYTWAVAFLVPYIAVFVAFVVYP |
| Ga0307469_118833081 | 3300031720 | Hardwood Forest Soil | MDSASVLDVSRPVVRRRTLSRFLRGGLKGGEYTWAVAFVVPYIAVFAT |
| Ga0307469_125125431 | 3300031720 | Hardwood Forest Soil | MDSASVIDVTRPAVRWRTLSRSLRGGLKGGEYRWAVAFVVPYIAVFITFV |
| Ga0307473_107732201 | 3300031820 | Hardwood Forest Soil | MNSATVADVGRPAVRWRTISRSLRGGLKGGEYTWAVAFV |
| Ga0307473_114983132 | 3300031820 | Hardwood Forest Soil | MMDTASVIEIGHSAVRRQAVWRYLRGNLKSGEYAWAAAFVVPYVAVFL |
| Ga0306921_107748101 | 3300031912 | Soil | MSSSIVDISRPAIQRRTFARSLRGGLKGGEYTWALAFVVPYIAVFV |
| Ga0310903_103964601 | 3300032000 | Soil | MNGASFVDIGRPAIRRRTLARSLRGTLKGGEYTWAVAFVVPYLAVFVTFVAYPVVYGLWMGSD |
| Ga0306922_120138391 | 3300032001 | Soil | MSSSIVEISRPAIQRRTFARSLRGSLKGGEYTWALA |
| Ga0307472_1024512171 | 3300032205 | Hardwood Forest Soil | MGSASVIDAVRPAERRRTLARSLRGGLKGGEYACAVAFVVPYIAVFVTFVAYPVVYWLW |
| Ga0306920_1024933291 | 3300032261 | Soil | MNGASVAEVDRQGVRGHALSRSLRGSLKGAEYTWAVAFVVPYLAVFVTFV |
| Ga0326723_0321762_1_105 | 3300034090 | Peat Soil | MDSASVVDVGRPALRWHALSRSLRGGLKGGEYTWA |
| Ga0314782_063875_3_137 | 3300034661 | Soil | MNGASFVDIDRPAIRRRTLARSLRGTLKGGEYTWAVAFVVPYIAV |
| Ga0314803_101115_424_564 | 3300034678 | Soil | MNGASFVDIGRPAIRRRTLARSLRGTLKGGEYTWAVAFVVPYIAVFI |
| ⦗Top⦘ |