


| Basic Information | |
|---|---|
| Family ID | F055108 |
| Family Type | Metagenome |
| Number of Sequences | 139 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MAKQLNPGDLFPDYTVSTTDGRTLNIPADLNGEYAVIIFYRGIW |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.00 % |
| % of genes near scaffold ends (potentially truncated) | 26.62 % |
| % of genes from short scaffolds (< 2000 bps) | 71.94 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.122 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.791 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.374 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (21.583 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 11.11% Coil/Unstructured: 88.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF04909 | Amidohydro_2 | 38.13 |
| PF00578 | AhpC-TSA | 20.86 |
| PF01212 | Beta_elim_lyase | 13.67 |
| PF03070 | TENA_THI-4 | 2.16 |
| PF04519 | Bactofilin | 2.16 |
| PF13382 | Adenine_deam_C | 1.44 |
| PF13531 | SBP_bac_11 | 0.72 |
| PF09084 | NMT1 | 0.72 |
| PF00570 | HRDC | 0.72 |
| PF01979 | Amidohydro_1 | 0.72 |
| PF14518 | Haem_oxygenas_2 | 0.72 |
| PF00893 | Multi_Drug_Res | 0.72 |
| PF06808 | DctM | 0.72 |
| PF00890 | FAD_binding_2 | 0.72 |
| PF01547 | SBP_bac_1 | 0.72 |
| PF00005 | ABC_tran | 0.72 |
| PF00696 | AA_kinase | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 27.34 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 13.67 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 13.67 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 13.67 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 13.67 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 13.67 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 13.67 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 13.67 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 13.67 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 13.67 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 13.67 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 13.67 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 13.67 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 13.67 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 13.67 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 13.67 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 13.67 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 2.16 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.72 |
| COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.72 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.12 % |
| Unclassified | root | N/A | 2.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918013|NODE_3448_length_2240_cov_12.970535 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
| 2140918013|NODE_7579_length_2083_cov_7.912626 | All Organisms → cellular organisms → Bacteria | 2115 | Open in IMG/M |
| 2228664022|INPgaii200_c1059471 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_13256422 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104370160 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300000787|JGI11643J11755_11481412 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300000956|JGI10216J12902_101593037 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300000956|JGI10216J12902_111485280 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
| 3300003319|soilL2_10167547 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300003987|Ga0055471_10068929 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300003993|Ga0055468_10000683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3703 | Open in IMG/M |
| 3300003993|Ga0055468_10062061 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300004057|Ga0055496_10159677 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300004070|Ga0055488_10065470 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300004114|Ga0062593_101993116 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300004282|Ga0066599_101132579 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300004463|Ga0063356_100331594 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300004463|Ga0063356_100484816 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300004480|Ga0062592_100024523 | All Organisms → cellular organisms → Bacteria | 2840 | Open in IMG/M |
| 3300004778|Ga0062383_10702182 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300004779|Ga0062380_10094947 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300005289|Ga0065704_10527888 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005294|Ga0065705_10246725 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300005467|Ga0070706_100560437 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300005518|Ga0070699_101004978 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300005526|Ga0073909_10504492 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005554|Ga0066661_10551580 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300005557|Ga0066704_10561872 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300005713|Ga0066905_101712939 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005836|Ga0074470_10303029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5694 | Open in IMG/M |
| 3300005895|Ga0075277_1011882 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300005937|Ga0081455_10051475 | All Organisms → cellular organisms → Bacteria | 3532 | Open in IMG/M |
| 3300006173|Ga0070716_101475381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300006846|Ga0075430_101813777 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006847|Ga0075431_102027961 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006852|Ga0075433_11439741 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006865|Ga0073934_10099877 | All Organisms → cellular organisms → Bacteria | 2214 | Open in IMG/M |
| 3300007004|Ga0079218_10092420 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
| 3300009012|Ga0066710_102202495 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300009012|Ga0066710_103065246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300009053|Ga0105095_10432523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300009078|Ga0105106_10608883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 783 | Open in IMG/M |
| 3300009087|Ga0105107_11247312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300009167|Ga0113563_10524914 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300009506|Ga0118657_10149970 | All Organisms → cellular organisms → Bacteria | 3328 | Open in IMG/M |
| 3300009609|Ga0105347_1009500 | All Organisms → cellular organisms → Bacteria | 3365 | Open in IMG/M |
| 3300009836|Ga0105068_1008946 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300010046|Ga0126384_11106971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 726 | Open in IMG/M |
| 3300010304|Ga0134088_10079483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1530 | Open in IMG/M |
| 3300010391|Ga0136847_10878946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1027 | Open in IMG/M |
| 3300010413|Ga0136851_11311991 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300011413|Ga0137333_1046228 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300011443|Ga0137457_1298470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300012041|Ga0137430_1046840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1167 | Open in IMG/M |
| 3300012174|Ga0137338_1008496 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300012204|Ga0137374_10014587 | All Organisms → cellular organisms → Bacteria | 9091 | Open in IMG/M |
| 3300012207|Ga0137381_10708833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 875 | Open in IMG/M |
| 3300012226|Ga0137447_1053674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 734 | Open in IMG/M |
| 3300012285|Ga0137370_10063884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2003 | Open in IMG/M |
| 3300012349|Ga0137387_10616430 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300012355|Ga0137369_11154850 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012582|Ga0137358_10248127 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300012685|Ga0137397_10894732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300012891|Ga0157305_10225822 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012929|Ga0137404_10282440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1435 | Open in IMG/M |
| 3300012930|Ga0137407_10137290 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
| 3300012931|Ga0153915_10789401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1100 | Open in IMG/M |
| 3300014272|Ga0075327_1232360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300014296|Ga0075344_1126160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300014300|Ga0075321_1150226 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300014307|Ga0075304_1022162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1302 | Open in IMG/M |
| 3300014877|Ga0180074_1015531 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300014877|Ga0180074_1125997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300014882|Ga0180069_1050744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 933 | Open in IMG/M |
| 3300014883|Ga0180086_1181286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300015245|Ga0137409_11014555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300017930|Ga0187825_10003639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5033 | Open in IMG/M |
| 3300017944|Ga0187786_10169761 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300017997|Ga0184610_1228676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300018052|Ga0184638_1254458 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300018056|Ga0184623_10178694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 979 | Open in IMG/M |
| 3300018059|Ga0184615_10073582 | All Organisms → cellular organisms → Bacteria | 1911 | Open in IMG/M |
| 3300018068|Ga0184636_1184854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300018075|Ga0184632_10001006 | All Organisms → cellular organisms → Bacteria | 11387 | Open in IMG/M |
| 3300018083|Ga0184628_10001342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12165 | Open in IMG/M |
| 3300018422|Ga0190265_10498288 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300018422|Ga0190265_10698706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1136 | Open in IMG/M |
| 3300018422|Ga0190265_13782104 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300018466|Ga0190268_11622162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300018481|Ga0190271_10193218 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300019487|Ga0187893_10001191 | All Organisms → cellular organisms → Bacteria | 64426 | Open in IMG/M |
| 3300020003|Ga0193739_1084387 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300020060|Ga0193717_1019544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2923 | Open in IMG/M |
| 3300020186|Ga0163153_10032224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3915 | Open in IMG/M |
| 3300020193|Ga0194131_10000364 | All Organisms → cellular organisms → Bacteria | 75497 | Open in IMG/M |
| 3300020197|Ga0194128_10066309 | All Organisms → cellular organisms → Bacteria | 2465 | Open in IMG/M |
| 3300020200|Ga0194121_10650021 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300022209|Ga0224497_10051009 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300025155|Ga0209320_10002917 | All Organisms → cellular organisms → Bacteria | 8615 | Open in IMG/M |
| 3300025324|Ga0209640_10457273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1046 | Open in IMG/M |
| 3300025925|Ga0207650_11584345 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300025988|Ga0208141_1004454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1103 | Open in IMG/M |
| 3300026320|Ga0209131_1068756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1941 | Open in IMG/M |
| 3300026535|Ga0256867_10001916 | All Organisms → cellular organisms → Bacteria | 8878 | Open in IMG/M |
| 3300027056|Ga0209879_1031783 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300027665|Ga0209983_1022286 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300027722|Ga0209819_10220737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300027778|Ga0209464_10076521 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300027815|Ga0209726_10049000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2966 | Open in IMG/M |
| 3300027831|Ga0209797_10096394 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300027917|Ga0209536_100017741 | All Organisms → cellular organisms → Bacteria | 10060 | Open in IMG/M |
| 3300030006|Ga0299907_10020461 | All Organisms → cellular organisms → Bacteria | 4970 | Open in IMG/M |
| 3300030006|Ga0299907_10078948 | All Organisms → cellular organisms → Bacteria | 2673 | Open in IMG/M |
| 3300030006|Ga0299907_11057692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300030619|Ga0268386_10133593 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
| 3300030620|Ga0302046_10176585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1754 | Open in IMG/M |
| 3300031228|Ga0299914_10651000 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300031538|Ga0310888_10819514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300031562|Ga0310886_11070576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300031820|Ga0307473_10008638 | All Organisms → cellular organisms → Bacteria | 3554 | Open in IMG/M |
| 3300031824|Ga0307413_10904062 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300031852|Ga0307410_10763931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 819 | Open in IMG/M |
| 3300031858|Ga0310892_11148686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300031911|Ga0307412_10045680 | All Organisms → cellular organisms → Bacteria | 2865 | Open in IMG/M |
| 3300031965|Ga0326597_10280656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1905 | Open in IMG/M |
| 3300032013|Ga0310906_10187214 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300032075|Ga0310890_10109537 | Not Available | 1751 | Open in IMG/M |
| 3300032075|Ga0310890_10364812 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300032163|Ga0315281_10385834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1512 | Open in IMG/M |
| 3300032770|Ga0335085_10265418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2054 | Open in IMG/M |
| 3300032829|Ga0335070_10160888 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
| 3300033414|Ga0316619_10853841 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300033480|Ga0316620_10027566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3538 | Open in IMG/M |
| 3300034115|Ga0364945_0004434 | All Organisms → cellular organisms → Bacteria | 3728 | Open in IMG/M |
| 3300034147|Ga0364925_0036160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1639 | Open in IMG/M |
| 3300034176|Ga0364931_0031550 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.79% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.19% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.32% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.60% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.88% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.88% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.88% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.16% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.16% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.16% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.16% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.16% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.44% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.44% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.44% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.72% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.72% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.72% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.72% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.72% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.72% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.72% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.72% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.72% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.72% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.72% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004057 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014307 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300022209 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025988 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_01909040 | 2140918013 | Soil | MAKQLGPGDPFPNYNVPTAHGGRLNIPTGFKGEYAVIIFYRGIW |
| Iowa-Corn-GraphCirc_02489830 | 2140918013 | Soil | MTKQLNPGDPFPTFDVNLTDGRSLKLPIDLKGEYAVIIYYRGIW |
| INPgaii200_10594712 | 2228664022 | Soil | MARQLNPGDLFPDYSVQLTDGRTLNIPRELRGEYAVIIFYRGIW |
| ICChiseqgaiiFebDRAFT_132564222 | 3300000363 | Soil | MAKQLNPGDPFPVFDVNLTDGRTLKLPTDLKGEYAVIIYYRGIW* |
| INPhiseqgaiiFebDRAFT_1043701603 | 3300000364 | Soil | MAKQLNPGDPFPSFNVQLTDGRTLDISSGLKGEYAVIIYYRGIW* |
| JGI11643J11755_114814122 | 3300000787 | Soil | MTKQLNPGDPFPTFDVNLTDGRSLKLPIDLKGEYAVIIYYRGIW* |
| JGI10216J12902_1015930371 | 3300000956 | Soil | MAKQLNPGDPFPVFDVNLTDGRRLTLPTDLTGEYAVIIYYRGIW* |
| JGI10216J12902_1114852802 | 3300000956 | Soil | MGKQLNPGDSFPVFNVNLTDGRRLDLPKDLPGDYAVIIYYRGTW* |
| soilL2_101675473 | 3300003319 | Sugarcane Root And Bulk Soil | MAKQLTPGDPFPRFDIKLTDGRTLNLPSGLTGEYAVIIFYRGIW* |
| Ga0055471_100689292 | 3300003987 | Natural And Restored Wetlands | MAKQLGPGDPFPNYTVPTVNGATLHIPADLNGEYAVIIFYR |
| Ga0055468_100006833 | 3300003993 | Natural And Restored Wetlands | MARQLNPGDLFPEYRVEVTDGTTLNVPADLRGEYAVIIFYRGIW* |
| Ga0055468_100620612 | 3300003993 | Natural And Restored Wetlands | MARQLGPNDPFPTYTVSTADGGRMKIPADLEGEYAVIIFYRGVW* |
| Ga0055496_101596771 | 3300004057 | Natural And Restored Wetlands | MRMAKQLNPGDPFLSFQVNLTNGGTLNLPTDLKAEYAVIIYYRGIW* |
| Ga0055488_100654701 | 3300004070 | Natural And Restored Wetlands | MARQLNPGDLFPEYRVEVTDGTILNMPWDLRGEYAVIIFYRGIW* |
| Ga0062593_1019931161 | 3300004114 | Soil | MAKQLGPGDPFPNYTVPTVNGATLHIPVDLNGEYAVIIFYRGI |
| Ga0066599_1011325791 | 3300004282 | Freshwater | MAKQLNPGDVFPAFKVKLTNGQTLDLPKDLTGDYAVIIYYRGIW* |
| Ga0063356_1003315943 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAAQLGPGAPFPSYAVRTVGGGTLAIPAEIEGEYAVIIFYRGIW* |
| Ga0063356_1004848162 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAKQLGPGDPFPNYNVPTAHGGRLNIPTGFKGEYAVIIFYRGIW* |
| Ga0062592_1000245231 | 3300004480 | Soil | MAKQLGPGDPFPNYNVPTADGGRLNIPTGFKGEYAVIIFYRGIW* |
| Ga0062383_107021822 | 3300004778 | Wetland Sediment | LNPGDAFPEFKVPTVNGPTLSIPNDLTGEYAVIIYYRGIW* |
| Ga0062380_100949473 | 3300004779 | Wetland Sediment | MTMAKQLNPGDAFPEFKVPTVGGRTLSIPNDLTGEYAVIIYYRGIW* |
| Ga0065704_105278882 | 3300005289 | Switchgrass Rhizosphere | MTMAKQLNPGDQFPNYIVQLADGGTLSIPHDLRGEYAVIIFYRGIW* |
| Ga0065705_102467253 | 3300005294 | Switchgrass Rhizosphere | MAKQLGPGDPFPSYSVQTAFGGTLNIPTDLKGEYAVIIFYRGIW* |
| Ga0070706_1005604372 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MARQLNPGDLFPDYSVQLTDGRTLNIPRELRGEYAVIIFYRGIW* |
| Ga0070699_1010049782 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKRLNPGDPFPNYLIQVTDGGTLSIPQDLRGEYAVIIFYRCIW* |
| Ga0073909_105044923 | 3300005526 | Surface Soil | QFPNYTIGTTTGTTLSIPADLAGEYAVILFYRGIW* |
| Ga0066661_105515803 | 3300005554 | Soil | MAKQLNPGDLFPSYTVQLIDGRTVNIPQELRGECAVIIFYRGIW* |
| Ga0066704_105618721 | 3300005557 | Soil | MAKQLKPGDSFPTYTVPITDGGTLNIPADLAGEYAVIIF |
| Ga0066905_1017129391 | 3300005713 | Tropical Forest Soil | NPGDQFPNYIVQLAEGGTLSIPQDLRGEYAVIIFYRGIW* |
| Ga0074470_103030297 | 3300005836 | Sediment (Intertidal) | MAKQLNPGDLFPNFTVNLTDGRTLNIPTDLKGEYAVIIYYRGIW* |
| Ga0075277_10118823 | 3300005895 | Rice Paddy Soil | MAKQLNPGDAFPTYIVPTTEGRTLNIPADLKGEYAVLIFYRGIW* |
| Ga0081455_100514754 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTMAKQLNPGDQFPNYIVQLADGGTLSIPQDLRGEYAVIIFYRGIW* |
| Ga0070716_1014753811 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKQLGPGDQFPNYTFGTTLGTTLSIPAALMGEYAVIIFYRGVW* |
| Ga0075430_1018137772 | 3300006846 | Populus Rhizosphere | NVNSMAKLGPGDPFPNYNVPTADGGRLNIPTGFKGEYAVIIFYRGIW* |
| Ga0075431_1020279611 | 3300006847 | Populus Rhizosphere | MAKQLGPGDLFPNYTAPSADGGTLNIPADFKGAYAVIIFYRGIW* |
| Ga0075433_114397411 | 3300006852 | Populus Rhizosphere | MAKQLGPGDAFPNYTVPTADGRTLNIPADLRGEYAVIILYRGVW* |
| Ga0073934_100998771 | 3300006865 | Hot Spring Sediment | MSKQLTPGAPFPAYTVPTVDGPTLNIPAGLEGECAVVIFYRGVW* |
| Ga0079218_100924205 | 3300007004 | Agricultural Soil | MAKQLGPGDPFPNYTVPTAEGGTLRIPADFEGEYAVI |
| Ga0066710_1022024951 | 3300009012 | Grasslands Soil | MAKQLKPGDSFPTYTVPITDGGTLNIPADLAAEYAVIIF |
| Ga0066710_1030652461 | 3300009012 | Grasslands Soil | QLNPAASLPTYTVPIRDGGTLNIPADLAGEYAVIIFFRGVW |
| Ga0105095_104325232 | 3300009053 | Freshwater Sediment | MAKQLGPGDKFPDYTVPTADGGLLRIPADLTGEYAVIIFYRGIW* |
| Ga0105106_106088831 | 3300009078 | Freshwater Sediment | MAKQLGPGDKFPDYTVPTTDGGILNIPANLKGEYAVIIFYRGVW* |
| Ga0105107_112473122 | 3300009087 | Freshwater Sediment | MAKQLNPGDAFPEFKVPTVSGSTLSIPNDLTGDYAVIIYYRGIW* |
| Ga0113563_105249142 | 3300009167 | Freshwater Wetlands | MAKQLNPGDPFPTFTVNLTDGRTLTLPANLQGEYAVIIYYRGIW* |
| Ga0118657_101499703 | 3300009506 | Mangrove Sediment | MARQLNVGDTFPQYTVSLTDNRTLNIPADLKGEYSVIIFYRGIW* |
| Ga0105347_10095005 | 3300009609 | Soil | MAKQLNPGDAFPEFKVPTVSGTTLSIPNDLKGDYAVIIYYRGIW* |
| Ga0105068_10089461 | 3300009836 | Groundwater Sand | KQLNPGDLFPDYTVQLTDGRTVNIPQELRGEYAVIIFYRGIW* |
| Ga0126384_111069712 | 3300010046 | Tropical Forest Soil | MAKQLTPGDPFPNYTVPTIDERRLNIPADLKGEYAVIIFYRGIW* |
| Ga0134088_100794832 | 3300010304 | Grasslands Soil | MAKQLGPGDAFPNYTVPTAEGPTLNIPADLRGEYAVIIFYRGVW* |
| Ga0136847_108789461 | 3300010391 | Freshwater Sediment | GMTMAKQLNPGDNFPNFVVPTTDGRSLNIPADLTGEYAVIIFYRGIW* |
| Ga0136851_113119912 | 3300010413 | Mangrove Sediment | MARQLNVGDTFPQYAVRLTGNRTLNIPGDLKGEYAVIIYYRGIW* |
| Ga0137454_10909392 | 3300011406 | Soil | MNLIRKKVAIMAKQLNPGEAFPEFKVPTVSGSTLSIPKDLTGDYAVIIYYRGIW* |
| Ga0137333_10462282 | 3300011413 | Soil | MAKQLNPGDLFPDFRVPISDGRTMNIPADLKGDYAVIIFYLGVW* |
| Ga0137457_12984702 | 3300011443 | Soil | MAKQLNPGDAFPEFKVPTVSGSTLSIPNDLKGDYAVIIYYRGIW* |
| Ga0137430_10468403 | 3300012041 | Soil | MDFQMAKQLNPGDPFPHFTVPLTDGRTLNIPTDLKGEYAVIIYYRGIW* |
| Ga0137338_10084963 | 3300012174 | Soil | MAKQLNPGDLFPNFRVPISNGRTMNIPADLKGDYAVIIFYRGVW* |
| Ga0137374_100145879 | 3300012204 | Vadose Zone Soil | MAKQLGPGDEFPNYTAPTADRRTLNIPADLKGGYAVIIFYRGVW* |
| Ga0137381_107088331 | 3300012207 | Vadose Zone Soil | SFPTYTVPITDGGTLNIPADLAGEYAVIIFYRGVW* |
| Ga0137447_10536741 | 3300012226 | Soil | PGDAFPAFKVPTVDGQMLSIPTDLKGEYAVIIYYRGVW* |
| Ga0137370_100638842 | 3300012285 | Vadose Zone Soil | MAKQLNPGDVFPEYIVPTTDGVTLNIPAGLAGDYAVIIFYRGVW* |
| Ga0137387_106164301 | 3300012349 | Vadose Zone Soil | MAKQLKPGDSFPTYTVPITDGGTLNIPADLAGEYAVII |
| Ga0137369_111548501 | 3300012355 | Vadose Zone Soil | MAKQLNPGDLFPDYTVRTSDGRKLNIPADLKGEYAVII |
| Ga0137358_102481273 | 3300012582 | Vadose Zone Soil | MAKQLGPGDQFPNYTIGTTIGTTLSMPADLAGEYAVIIFYRGIW* |
| Ga0137397_108947321 | 3300012685 | Vadose Zone Soil | PGDPFPNYLIQVTDGGTLSIPQDLRSEYAVIIFYRGIW* |
| Ga0157305_102258222 | 3300012891 | Soil | MARQINPGDPFPAFNVSLTDGRRLNLPGDLEGEYAVIIYYRGIW* |
| Ga0137404_102824402 | 3300012929 | Vadose Zone Soil | MAKQLNPGDLFPVYTVPTTDGRKLDIPADLKGEYAVVIFYRGIW* |
| Ga0137407_101372903 | 3300012930 | Vadose Zone Soil | MAKRLNPGDPFPNYLIQVTDGGTLSIPQDLRGDAVIIFYRGIW* |
| Ga0153915_107894013 | 3300012931 | Freshwater Wetlands | MAKQLNPGDAFPTYIVPTTEGRTLNIPADLKGEYAVIIFYRGIW* |
| Ga0075327_12323602 | 3300014272 | Natural And Restored Wetlands | MAKQLGPGDIFPNYTVPTVDGRTLNIPADIKAEYAVIIFYRGLW* |
| Ga0075344_11261601 | 3300014296 | Natural And Restored Wetlands | QLNPGDLFQKYCVAVTDGTTLNIPDDLRGEYAVIIFYRGIW* |
| Ga0075321_11502261 | 3300014300 | Natural And Restored Wetlands | MARQLNPGDAFPTYIVPTTEGRTLNIPADLKGEYA |
| Ga0075304_10221622 | 3300014307 | Natural And Restored Wetlands | MAKQLNPGDAFPEFKVATVSGPVLSIPSDLTGEYAVIIYYRGIW* |
| Ga0180074_10155312 | 3300014877 | Soil | MAKQLGPGDKFPDYSVPTTDGGVLNIPADLTGEYAVIIYYRGIW* |
| Ga0180074_11259971 | 3300014877 | Soil | KQLNPGDAFPEFEVSTVSGSKLSIPKDLNGDYAVIIYYRGIW* |
| Ga0180069_10507442 | 3300014882 | Soil | MAKQLNPGEPFPEFKVPTVSGSTLSIPNDLTGDYAVIIYYRGIW* |
| Ga0180086_11812862 | 3300014883 | Soil | MAKQLGPGDKFPDYTVPTADGGVLNIPADLKGEYAVIIYYRGIW* |
| Ga0137409_110145551 | 3300015245 | Vadose Zone Soil | MAKQLGPGEQFPNYTIGTTIGTTLSMPADLAGEYAVIIFYRGIW* |
| Ga0187825_100036392 | 3300017930 | Freshwater Sediment | MAKQLNPGDAFPTYIVPTTEGRTLNIPSDLKGEYAVIIFYRGIW |
| Ga0187786_101697611 | 3300017944 | Tropical Peatland | MAKQLNPGDPFPSYNVRITDGRTLSIPQDLTGEYAVIIFYRG |
| Ga0184610_12286761 | 3300017997 | Groundwater Sediment | LNPGDMFPTYTVPTTDGRTLNIPAHLKGEYAVIIFYRGIW |
| Ga0184638_12544582 | 3300018052 | Groundwater Sediment | MAKQLNPGDWFPNFTVPVTDGRTLNIPADLTGEYTVIIFYRGIW |
| Ga0184623_101786943 | 3300018056 | Groundwater Sediment | IYQSIAMARQLNPGDPFPTFNVNLTDGRTMNLPTDLKGEYAVIIYYRGIW |
| Ga0184615_100735823 | 3300018059 | Groundwater Sediment | MAKQLNPGDLFPNFRVPISDGRTMNIPADLKGDYAVVIFYRGVW |
| Ga0184636_11848542 | 3300018068 | Groundwater Sediment | MAKQLNPGDLFPNFRVPISDGRTMKIPADLKGDYAVIIFYRGVW |
| Ga0184640_101131331 | 3300018074 | Groundwater Sediment | LNHYQTWEAREIMAKQLNPGDNFPNFTVPITDGRTLNIPADLNGEYAVIIFYRGIW |
| Ga0184632_100010067 | 3300018075 | Groundwater Sediment | MAKQLNPGDLFPNFRVPISDGRTMNIPADLKGDYAVIIFYRGVW |
| Ga0184639_102848543 | 3300018082 | Groundwater Sediment | TKIQTWEAREIMAKQLNPGDNFPNFTVPITDGRTLNIPNDLTGEYAVIIFYRGIC |
| Ga0184628_100013429 | 3300018083 | Groundwater Sediment | MAKQLNPGDAFPEFKVPTVSGTTLSIPNDLKGDYAVIIYYRGIW |
| Ga0190265_104982882 | 3300018422 | Soil | MVKQLAPGDPFPNYMVKTAGGSTLDIPADLKGKYAVIIFYRR |
| Ga0190265_106987062 | 3300018422 | Soil | MAKQLGPGDPFPNYNVPTADGGRLNIPTDLKGEYAVIIFYRGIW |
| Ga0190265_137821041 | 3300018422 | Soil | MAKQLGPGGPFPNYTVPTASGGTLTIPADLKGEYAVILFY |
| Ga0190268_116221622 | 3300018466 | Soil | GDVFPAFNVKLTNGRRLDLPKDLTGDYAVIIYYRGIW |
| Ga0190271_101932183 | 3300018481 | Soil | MAKQLNPGDEFPEFKVPTVSGSTLSIPKDLKGDYAVIIYYRGIW |
| Ga0187893_1000119159 | 3300019487 | Microbial Mat On Rocks | MQRRKQLNAGDNFPEYTVQTTDGRTMNIPKDLHGDYAVVIFYRGVW |
| Ga0193739_10843871 | 3300020003 | Soil | MAKQLNPGDLFPDYTVSTTDGRTLNIPADLNGEYAVIIFYRGIW |
| Ga0193717_10195442 | 3300020060 | Soil | MAKQLGPGDKFPNYMVPTTDGGMLNIPADIKAEYAVIIFYRGIW |
| Ga0163153_100322245 | 3300020186 | Freshwater Microbial Mat | MAKQLNPGDAFPEFKVPTVSGSTLSIPNDLTGDYAVIIYYRGIW |
| Ga0194131_1000036448 | 3300020193 | Freshwater Lake | MAKQLLPGDPFPSFKANLTDGRPLNIPGDLKAEYAVIIYYRGIW |
| Ga0194128_100663093 | 3300020197 | Freshwater Lake | MAKQLTPGDLFPNFTVPVTDGRTLDIPNDLTGEYAVIIFYRGIW |
| Ga0194121_106500212 | 3300020200 | Freshwater Lake | MAKQLTPGDLFPNFTVPVTDGRTLDIPNDLTGEYAVIIFYR |
| Ga0224497_100510092 | 3300022209 | Sediment | MAKQLLPGDPFPDYAVQVVDGRRLTIPADLPGEYSVIIFYRGVW |
| Ga0209320_100029172 | 3300025155 | Soil | MARQLGPNDPFPTYTVSTADGGRMKIPADLEGEYAVIIFYRGVW |
| Ga0209640_104572731 | 3300025324 | Soil | MAKQLNPGDLFPNFRVPISDGRTMNIPVDLKGDYAVIIFYRGVW |
| Ga0207650_115843452 | 3300025925 | Switchgrass Rhizosphere | MARQINPGDPFPAFNVSLTDGRRLNLPGDLEGEYAVII |
| Ga0208141_10044543 | 3300025988 | Rice Paddy Soil | MAKQLNPGDAFPTYIVPTTEGRTLNIPADLKGEYAVLIFYRGIW |
| Ga0209131_10687561 | 3300026320 | Grasslands Soil | MAKQLNPGDPFPIFTVALADGRSLNIPGDLTADYAVIIYYRGIW |
| Ga0256867_100019165 | 3300026535 | Soil | MARQLGPGDPFPTYNVPTVSSGRLNIPGELKGEYAVIIFYRGIW |
| Ga0209879_10317832 | 3300027056 | Groundwater Sand | MAKQLNPGDLFPDYTVQLTDGRTVNIPQELRGEYAVIIFYRGIW |
| Ga0209983_10222862 | 3300027665 | Arabidopsis Thaliana Rhizosphere | MAKQLGPGDPFPNYTVPTVKGGTLNIPTDLNGEYAVIVF |
| Ga0209819_102207371 | 3300027722 | Freshwater Sediment | KQLNPGDQFPNYIVQLADGGTLCISQDLKGEYAVIIFYRGIW |
| Ga0209464_100765213 | 3300027778 | Wetland Sediment | MTMAKQLNPGDAFPEFKVPTVGGRTLSIPNDLTGEYAVIIYYRGIW |
| Ga0209726_100490002 | 3300027815 | Groundwater | MAKQLNPGDAFPNFTVPTADGRALNIPADLQGDYAVIIYYRGIW |
| Ga0209797_100963942 | 3300027831 | Wetland Sediment | MAKQLNPGDAFPEFKVPTVGGRTLSIPNDLTGEYAVIIYYRGIW |
| Ga0209536_10001774111 | 3300027917 | Marine Sediment | MARQLNVGDTFPQYTVPLIDDRTLNIPGDLKGEYAVIIFYRGIW |
| Ga0299907_100204614 | 3300030006 | Soil | MAQQLLPGDIFPDYKVQTADGRTLDIPRDLTGEYAVIIFYRGIW |
| Ga0299907_100789483 | 3300030006 | Soil | MARQLNPGDVFPNFSVGNIDGRTMNIPADLNGEYAVIIFYRGIW |
| Ga0299907_110576922 | 3300030006 | Soil | MARQLSPGDPFPTYNVPTVNHGRLNIPADLKGEYAVIIFYRGIW |
| Ga0268386_101335932 | 3300030619 | Soil | MAKQLNPGDLFPNFSVPVIDGPVMNIRADLKGEYAVVIFYRGIW |
| Ga0302046_101765851 | 3300030620 | Soil | LGPNDPFPTYTVSTADGGRMKIPADLEGEYAVIIFYRGVW |
| Ga0299914_106510002 | 3300031228 | Soil | MAKQLGPGDMFPHYTVPTVDGRTLNIPADIKAEYAVVIFYRGIW |
| Ga0310888_108195142 | 3300031538 | Soil | PGAPFPSYAVRTVGGGTLAIPAEIEGEYAVIIFYRGIW |
| Ga0310886_110705762 | 3300031562 | Soil | ERLMAAQLGPGAPFPSYAVRTVGGGTLAIPAEIEGEYAVIIFYRGIW |
| Ga0307473_100086384 | 3300031820 | Hardwood Forest Soil | MAKRLNPGDPFPNYLIQVTDGGTLSIPQDLRSEYAVIIFYRGIW |
| Ga0307413_109040622 | 3300031824 | Rhizosphere | LTPVRLQIDAEEDYMARQINPGDPFPTFNVSLTDGRTLMLPGDLDGQYAVIIYYRGIW |
| Ga0307410_107639313 | 3300031852 | Rhizosphere | MDAEEDYMARQINPGDPFPTFNVSLTDGRTLMLPGDLDGQYAVIIYYRGIW |
| Ga0310892_111486862 | 3300031858 | Soil | MARQINPGDPFPAFNVSLTDGRRLNLPGDLEGEYAVIIYYRGIW |
| Ga0307412_100456804 | 3300031911 | Rhizosphere | MARQINPGDPFPTFNVSLTDGRTLMLPGDLDGQYAVIIYYRGIW |
| Ga0326597_102806561 | 3300031965 | Soil | MARQLNPGDDFPNFTVPVTDGGTLNIPVDLTGEYAVIIFYRGIW |
| Ga0310906_101872141 | 3300032013 | Soil | MARQLNPGDPFPNYLIQVTDGRTLSIPRDLRSEYAVIIFYRGIW |
| Ga0310890_101095374 | 3300032075 | Soil | GPGDQFPNYTIGTTIGTTLGIPADLAGEYAVILFYRGIW |
| Ga0310890_103648123 | 3300032075 | Soil | IHAEEDYMARQINPGDPFPAFNVSLTDGRRLNLPGDLEGEYAVIIYYRGIW |
| Ga0315281_103858343 | 3300032163 | Sediment | MAKQLNPGDGFPNFTVPITDGRTLNIPADLKGEYAVIIYYRGIW |
| Ga0335085_102654181 | 3300032770 | Soil | MAQQLITGDRFPEYRVQTSAGRPLNIPADLPGDYAVLIFYRGIW |
| Ga0335070_101608884 | 3300032829 | Soil | MAKQLGPGDPFPSYVVATADGRTLNIPADINADYAVIIFYRGIW |
| Ga0316619_108538412 | 3300033414 | Soil | MAKQLNPGDPFPTFTVNLTDGRTLTLPANLQGEYAVIIYYRGIW |
| Ga0316620_100275664 | 3300033480 | Soil | MAKQLNPGDAFPTYIVPTTEGRTLNIPADLKGEYAVIIFYRGIW |
| Ga0364945_0004434_2506_2637 | 3300034115 | Sediment | MSKQLNPGDLFPAYTVQLTDGRTVNIPQELRSEYAVIIFYRGI |
| Ga0364925_0036160_892_1026 | 3300034147 | Sediment | MAKQLNPGDVFPNFRVPISDGRTMNIPADLKGDYAVIIFYRGVW |
| Ga0364931_0031550_2_112 | 3300034176 | Sediment | GDLFPAYTVQLTDGRTVNIPQELRSEYAVIIFYRGI |
| ⦗Top⦘ |