


| Basic Information | |
|---|---|
| Family ID | F055067 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 40 residues |
| Representative Sequence | HESLGYELAAVAGEGGFEPSELVVPGVPEESTEPPDQPD |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.40 % |
| % of genes from short scaffolds (< 2000 bps) | 88.49 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.590 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.460 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.424 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.799 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF02781 | G6PD_C | 7.19 |
| PF13193 | AMP-binding_C | 2.88 |
| PF01593 | Amino_oxidase | 2.16 |
| PF01872 | RibD_C | 2.16 |
| PF00083 | Sugar_tr | 2.16 |
| PF00155 | Aminotran_1_2 | 1.44 |
| PF01636 | APH | 1.44 |
| PF09126 | NaeI | 1.44 |
| PF00266 | Aminotran_5 | 1.44 |
| PF07969 | Amidohydro_3 | 1.44 |
| PF13450 | NAD_binding_8 | 1.44 |
| PF03704 | BTAD | 1.44 |
| PF00561 | Abhydrolase_1 | 1.44 |
| PF13191 | AAA_16 | 0.72 |
| PF00730 | HhH-GPD | 0.72 |
| PF00196 | GerE | 0.72 |
| PF03795 | YCII | 0.72 |
| PF01979 | Amidohydro_1 | 0.72 |
| PF03551 | PadR | 0.72 |
| PF12802 | MarR_2 | 0.72 |
| PF12680 | SnoaL_2 | 0.72 |
| PF05977 | MFS_3 | 0.72 |
| PF00440 | TetR_N | 0.72 |
| PF13602 | ADH_zinc_N_2 | 0.72 |
| PF01243 | Putative_PNPOx | 0.72 |
| PF02560 | Cyanate_lyase | 0.72 |
| PF07992 | Pyr_redox_2 | 0.72 |
| PF12730 | ABC2_membrane_4 | 0.72 |
| PF01828 | Peptidase_A4 | 0.72 |
| PF07722 | Peptidase_C26 | 0.72 |
| PF00102 | Y_phosphatase | 0.72 |
| PF03793 | PASTA | 0.72 |
| PF00113 | Enolase_C | 0.72 |
| PF13006 | Nterm_IS4 | 0.72 |
| PF00005 | ABC_tran | 0.72 |
| PF00067 | p450 | 0.72 |
| PF12679 | ABC2_membrane_2 | 0.72 |
| PF00248 | Aldo_ket_red | 0.72 |
| PF12804 | NTP_transf_3 | 0.72 |
| PF00313 | CSD | 0.72 |
| PF04961 | FTCD_C | 0.72 |
| PF04909 | Amidohydro_2 | 0.72 |
| PF05336 | rhaM | 0.72 |
| PF07702 | UTRA | 0.72 |
| PF12681 | Glyoxalase_2 | 0.72 |
| PF13469 | Sulfotransfer_3 | 0.72 |
| PF00768 | Peptidase_S11 | 0.72 |
| PF08044 | DUF1707 | 0.72 |
| PF07883 | Cupin_2 | 0.72 |
| PF07730 | HisKA_3 | 0.72 |
| PF04014 | MazE_antitoxin | 0.72 |
| PF01047 | MarR | 0.72 |
| PF04402 | SIMPL | 0.72 |
| PF01545 | Cation_efflux | 0.72 |
| PF01906 | YbjQ_1 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 7.19 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 2.16 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 2.16 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 1.44 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 1.44 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.72 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.72 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.72 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.72 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.72 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.72 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.72 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.72 |
| COG1513 | Cyanate lyase | Inorganic ion transport and metabolism [P] | 0.72 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.72 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.72 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.72 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.72 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.72 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.72 |
| COG2453 | Protein-tyrosine phosphatase | Signal transduction mechanisms [T] | 0.72 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.72 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.72 |
| COG3254 | L-rhamnose mutarotase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG3404 | Formiminotetrahydrofolate cyclodeaminase | Amino acid transport and metabolism [E] | 0.72 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.72 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.72 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.72 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.72 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.72 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.72 |
| COG5599 | Protein tyrosine phosphatase | Signal transduction mechanisms [T] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.59 % |
| Unclassified | root | N/A | 37.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_107455778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300000956|JGI10216J12902_106955350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 858 | Open in IMG/M |
| 3300001356|JGI12269J14319_10331568 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300001471|JGI12712J15308_10011385 | All Organisms → cellular organisms → Bacteria | 2401 | Open in IMG/M |
| 3300001653|JGI20275J16321_101118 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300004082|Ga0062384_100166146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1268 | Open in IMG/M |
| 3300004152|Ga0062386_101387597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300005437|Ga0070710_10404549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 916 | Open in IMG/M |
| 3300005437|Ga0070710_10414804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 905 | Open in IMG/M |
| 3300005439|Ga0070711_102049721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 503 | Open in IMG/M |
| 3300005547|Ga0070693_100773050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 710 | Open in IMG/M |
| 3300005549|Ga0070704_100242916 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300005578|Ga0068854_100386316 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300005602|Ga0070762_11099171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300005610|Ga0070763_10979286 | Not Available | 506 | Open in IMG/M |
| 3300005921|Ga0070766_10548140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 773 | Open in IMG/M |
| 3300005921|Ga0070766_11033624 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006175|Ga0070712_100457759 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300006175|Ga0070712_101506972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300006176|Ga0070765_101421212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
| 3300006804|Ga0079221_10892489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
| 3300006806|Ga0079220_10709435 | Not Available | 741 | Open in IMG/M |
| 3300006953|Ga0074063_14075228 | Not Available | 703 | Open in IMG/M |
| 3300009520|Ga0116214_1278142 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300009521|Ga0116222_1524410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 519 | Open in IMG/M |
| 3300009698|Ga0116216_10368839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
| 3300009698|Ga0116216_10897793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
| 3300010043|Ga0126380_11754370 | Not Available | 560 | Open in IMG/M |
| 3300010362|Ga0126377_12594797 | Not Available | 582 | Open in IMG/M |
| 3300010373|Ga0134128_12872795 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300010373|Ga0134128_13076236 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010376|Ga0126381_102818905 | Not Available | 693 | Open in IMG/M |
| 3300010379|Ga0136449_100505021 | Not Available | 2098 | Open in IMG/M |
| 3300010396|Ga0134126_12747051 | Not Available | 534 | Open in IMG/M |
| 3300010398|Ga0126383_11768425 | Not Available | 707 | Open in IMG/M |
| 3300010877|Ga0126356_10427124 | Not Available | 1217 | Open in IMG/M |
| 3300011120|Ga0150983_15475935 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012200|Ga0137382_10591033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 792 | Open in IMG/M |
| 3300012486|Ga0157331_1032888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300012971|Ga0126369_13617318 | Not Available | 506 | Open in IMG/M |
| 3300013100|Ga0157373_10988105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 628 | Open in IMG/M |
| 3300014325|Ga0163163_12316654 | Not Available | 596 | Open in IMG/M |
| 3300014501|Ga0182024_10858046 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300016294|Ga0182041_11124711 | Not Available | 714 | Open in IMG/M |
| 3300016294|Ga0182041_11478116 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300016357|Ga0182032_11586855 | Not Available | 569 | Open in IMG/M |
| 3300016387|Ga0182040_11801587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 524 | Open in IMG/M |
| 3300016404|Ga0182037_12048028 | Not Available | 514 | Open in IMG/M |
| 3300017821|Ga0187812_1019618 | All Organisms → cellular organisms → Bacteria | 2336 | Open in IMG/M |
| 3300017924|Ga0187820_1005924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2859 | Open in IMG/M |
| 3300017928|Ga0187806_1060443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1165 | Open in IMG/M |
| 3300017932|Ga0187814_10036156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1831 | Open in IMG/M |
| 3300017942|Ga0187808_10263656 | Not Available | 772 | Open in IMG/M |
| 3300017942|Ga0187808_10454125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300017955|Ga0187817_11023941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300017961|Ga0187778_10101164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1791 | Open in IMG/M |
| 3300017961|Ga0187778_10699410 | Not Available | 685 | Open in IMG/M |
| 3300017974|Ga0187777_10563096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 801 | Open in IMG/M |
| 3300018001|Ga0187815_10245738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300018007|Ga0187805_10056940 | Not Available | 1756 | Open in IMG/M |
| 3300018030|Ga0187869_10262972 | Not Available | 834 | Open in IMG/M |
| 3300018043|Ga0187887_10031850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3314 | Open in IMG/M |
| 3300018046|Ga0187851_10852480 | Not Available | 512 | Open in IMG/M |
| 3300018085|Ga0187772_11454383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura barringtoniae | 510 | Open in IMG/M |
| 3300018086|Ga0187769_10070915 | Not Available | 2457 | Open in IMG/M |
| 3300020581|Ga0210399_10521831 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300021171|Ga0210405_10369770 | Not Available | 1130 | Open in IMG/M |
| 3300021180|Ga0210396_10775259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 824 | Open in IMG/M |
| 3300021180|Ga0210396_10950072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 730 | Open in IMG/M |
| 3300021181|Ga0210388_10098851 | All Organisms → cellular organisms → Bacteria | 2496 | Open in IMG/M |
| 3300021181|Ga0210388_10634062 | Not Available | 933 | Open in IMG/M |
| 3300021181|Ga0210388_11223494 | Not Available | 636 | Open in IMG/M |
| 3300021402|Ga0210385_10179022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1532 | Open in IMG/M |
| 3300021407|Ga0210383_11765980 | Not Available | 505 | Open in IMG/M |
| 3300021432|Ga0210384_10152182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2076 | Open in IMG/M |
| 3300021432|Ga0210384_10950488 | Not Available | 761 | Open in IMG/M |
| 3300021432|Ga0210384_11281914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 637 | Open in IMG/M |
| 3300021477|Ga0210398_10004801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12636 | Open in IMG/M |
| 3300021478|Ga0210402_10644718 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300022715|Ga0242678_1017113 | Not Available | 846 | Open in IMG/M |
| 3300024279|Ga0247692_1049077 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300025901|Ga0207688_10070935 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300025912|Ga0207707_10916771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300025915|Ga0207693_10081592 | All Organisms → cellular organisms → Bacteria | 2532 | Open in IMG/M |
| 3300025915|Ga0207693_10540734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora deserti | 909 | Open in IMG/M |
| 3300025929|Ga0207664_10161145 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
| 3300025929|Ga0207664_11211135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 673 | Open in IMG/M |
| 3300025929|Ga0207664_11691207 | Not Available | 555 | Open in IMG/M |
| 3300025941|Ga0207711_10796425 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300027652|Ga0209007_1103049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 717 | Open in IMG/M |
| 3300027767|Ga0209655_10284771 | Not Available | 535 | Open in IMG/M |
| 3300027853|Ga0209274_10429547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
| 3300027889|Ga0209380_10076011 | All Organisms → cellular organisms → Bacteria | 1922 | Open in IMG/M |
| 3300028780|Ga0302225_10342610 | Not Available | 706 | Open in IMG/M |
| 3300028806|Ga0302221_10170369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 956 | Open in IMG/M |
| 3300028879|Ga0302229_10326432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 687 | Open in IMG/M |
| 3300030580|Ga0311355_10307842 | Not Available | 1589 | Open in IMG/M |
| 3300030617|Ga0311356_10185353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2134 | Open in IMG/M |
| 3300031233|Ga0302307_10177634 | Not Available | 1101 | Open in IMG/M |
| 3300031474|Ga0170818_103038402 | Not Available | 591 | Open in IMG/M |
| 3300031525|Ga0302326_11062816 | Not Available | 1129 | Open in IMG/M |
| 3300031545|Ga0318541_10557680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 641 | Open in IMG/M |
| 3300031561|Ga0318528_10334651 | Not Available | 813 | Open in IMG/M |
| 3300031572|Ga0318515_10635950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 566 | Open in IMG/M |
| 3300031680|Ga0318574_10757430 | Not Available | 569 | Open in IMG/M |
| 3300031681|Ga0318572_10478301 | Not Available | 742 | Open in IMG/M |
| 3300031681|Ga0318572_10635552 | Not Available | 636 | Open in IMG/M |
| 3300031708|Ga0310686_103363765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1761 | Open in IMG/M |
| 3300031723|Ga0318493_10055804 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
| 3300031723|Ga0318493_10331830 | Not Available | 825 | Open in IMG/M |
| 3300031744|Ga0306918_10229701 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300031747|Ga0318502_10199762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1156 | Open in IMG/M |
| 3300031747|Ga0318502_10651431 | Not Available | 635 | Open in IMG/M |
| 3300031779|Ga0318566_10494093 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031792|Ga0318529_10180761 | Not Available | 976 | Open in IMG/M |
| 3300031912|Ga0306921_12759925 | Not Available | 503 | Open in IMG/M |
| 3300031942|Ga0310916_10534253 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300031942|Ga0310916_11395434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 574 | Open in IMG/M |
| 3300032063|Ga0318504_10631396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 515 | Open in IMG/M |
| 3300032064|Ga0318510_10014587 | All Organisms → cellular organisms → Bacteria | 2383 | Open in IMG/M |
| 3300032076|Ga0306924_12383078 | Not Available | 534 | Open in IMG/M |
| 3300032174|Ga0307470_11067681 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300032261|Ga0306920_101437914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 987 | Open in IMG/M |
| 3300032770|Ga0335085_11928597 | Not Available | 601 | Open in IMG/M |
| 3300032805|Ga0335078_10805612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1144 | Open in IMG/M |
| 3300032805|Ga0335078_12706141 | Not Available | 505 | Open in IMG/M |
| 3300032828|Ga0335080_10801965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 973 | Open in IMG/M |
| 3300032828|Ga0335080_11878966 | Not Available | 583 | Open in IMG/M |
| 3300032896|Ga0335075_10070923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4721 | Open in IMG/M |
| 3300032896|Ga0335075_11439328 | Not Available | 578 | Open in IMG/M |
| 3300032898|Ga0335072_10670425 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300033134|Ga0335073_11441797 | Not Available | 669 | Open in IMG/M |
| 3300033134|Ga0335073_11999078 | Not Available | 530 | Open in IMG/M |
| 3300033158|Ga0335077_10543856 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300033290|Ga0318519_10636752 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300034268|Ga0372943_0741175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 650 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.19% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.04% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.04% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.60% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.16% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.16% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.16% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.72% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.72% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001653 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1074557782 | 3300000955 | Soil | AREPLGYELAAVTGDGSFEPGELVVPSIPEESTGPPDKPD* |
| JGI10216J12902_1069553502 | 3300000956 | Soil | LGYELAAVAGEGGFEPGELVIPSVPEESTGPPDKPA* |
| JGI12269J14319_103315681 | 3300001356 | Peatlands Soil | TPVPAARESLGYELAAVAAEGGFEPAELVVPASPEQSAEPPDQPN* |
| JGI12712J15308_100113854 | 3300001471 | Forest Soil | AESLGYELAAVAGEGAFEPSGLVPAAGEEGTETSDTPD* |
| JGI20275J16321_1011182 | 3300001653 | Forest Soil | RQSLSEELAAVAGEGAFEPSELVVPGVPEESTEPPDKPR* |
| Ga0062384_1001661461 | 3300004082 | Bog Forest Soil | PVPAAHESLGYELAAVAGEGGFEPSELVVPDVRGKSTEPPDKPD* |
| Ga0062386_1013875972 | 3300004152 | Bog Forest Soil | PAARESLGYELAAVAGEGSFEPGELVVPGVPEQSTEPPDKPG* |
| Ga0070710_104045491 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AHESLGYELAAVAGEGGFEPSELVVPGVSEESAEPPDQLD* |
| Ga0070710_104148041 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ESLGYELAAVAGEGGFEPSELVVPDVAGEGAELPGKPADPD* |
| Ga0070711_1020497213 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | AREPLGYELAAVAGEGGFEPGELVVPSVPEESTGPPDKPD* |
| Ga0070693_1007730502 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | AREPLGYELAAVAGEGGFEPSELAVPGVPEESTEPPDKPD* |
| Ga0070704_1002429161 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AAREPLGYELAAVAGDGSFEPGELVVPSIPEESTGPPDKPD* |
| Ga0068854_1003863162 | 3300005578 | Corn Rhizosphere | LGYELAAVAGDGSFEPGELVVPSIPEESTGPPDKPD* |
| Ga0070762_110991712 | 3300005602 | Soil | SLGYELAAVAGEGGFEPSELVVPDATGEGAEPPGKTGKRD* |
| Ga0070763_109792861 | 3300005610 | Soil | RESLGYELAAVAGEGGFEPGELVPGIPEESTEPPDKPG* |
| Ga0070766_105481403 | 3300005921 | Soil | ARESLGYELAAVAAEGVFEPSELVVPGVPEESTEPPDKPS* |
| Ga0070766_110336241 | 3300005921 | Soil | ESLGYELAAVAGEGGFEPGELVVPSVLEESTEPPDNPD* |
| Ga0070712_1004577591 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GYELAAVAGEGGFEPSELVVPGVPEQGTEPPDQPD* |
| Ga0070712_1015069722 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LGYELAAGAAEGGFEPSELVIPEMPEESAEPPGPQ* |
| Ga0070765_1014212121 | 3300006176 | Soil | AAHESLGYELAAVAGEGGFEPSELVVPGVPEQSTEPPDKPG* |
| Ga0079221_108924892 | 3300006804 | Agricultural Soil | RTLAPAAPEPLGYELAAVAGDGSFEPGELVVPSGPEESTAPPDKPD* |
| Ga0079220_107094352 | 3300006806 | Agricultural Soil | GYELAAVAGEGGFEPSELVVPGVPEESTEPPDKPD* |
| Ga0074063_140752282 | 3300006953 | Soil | ESLGYELAAVAGEGGFEPGELIVPSVPEESTGPPDKPA* |
| Ga0116214_12781422 | 3300009520 | Peatlands Soil | AAVAAEGSFEPSELVVPDVPGDGAERPDKPPEPD* |
| Ga0116222_15244102 | 3300009521 | Peatlands Soil | YELAAVAAEGGFEPSELVVPGVQEESTEPPDKPG* |
| Ga0116216_103688391 | 3300009698 | Peatlands Soil | AARESLGYELAAVAGEGGFEPSELVVPGLPEESTEPSDKPD* |
| Ga0116216_108977932 | 3300009698 | Peatlands Soil | APAGHESLGYELAAVAGEGGFEPSELVVPGVPEQSTEPPDKPG* |
| Ga0126380_117543702 | 3300010043 | Tropical Forest Soil | RRTPAPAAPESLGYELAAVAGEGGFEPSELVVPSVPDESTGPPAKPD* |
| Ga0126377_125947971 | 3300010362 | Tropical Forest Soil | SLGYELAAVAGEGGFEPSELVVPSVPDESTGPPAKPD* |
| Ga0134128_128727952 | 3300010373 | Terrestrial Soil | YELAAVAGEGSFEPGELVVPSIPEESTGPPDKPD* |
| Ga0134128_130762361 | 3300010373 | Terrestrial Soil | RRTLVPAAREPLGYELAAVAGDGSFEPGELVVPSLPEESTGPPDKPD* |
| Ga0126381_1028189051 | 3300010376 | Tropical Forest Soil | YELAAVAAEGGFEPSELVVPGVPEESAEPPDRSD* |
| Ga0136449_1005050211 | 3300010379 | Peatlands Soil | LGYELAAVAGEGGFEPGELVVPGVPEESTEPPDKPD* |
| Ga0134126_127470511 | 3300010396 | Terrestrial Soil | GYELAAVAGEGGFEPSELVVPGVPEESTEPPDQPD* |
| Ga0126383_117684252 | 3300010398 | Tropical Forest Soil | TPAAHESLGYELAAVAGEGGFEPGELVIPSVPEESTGPPDKPD* |
| Ga0126356_104271245 | 3300010877 | Boreal Forest Soil | GYELAAAAGEGGFEPSPLVVPTSGEESAETSDSPD* |
| Ga0150983_154759351 | 3300011120 | Forest Soil | LSEELAAVAGEGGFEPSELVVPGVPEESTGPPDKPR* |
| Ga0137382_105910331 | 3300012200 | Vadose Zone Soil | HESLGYELAAVAGEGGFEPSELVVPGVPEESTEPPDQPD* |
| Ga0157331_10328881 | 3300012486 | Soil | MGARRTHELAAVAAEGAFEPSELVVPDVPEPTTEPPGKPGKPG* |
| Ga0126369_136173182 | 3300012971 | Tropical Forest Soil | ESLGYELAAVAAEGGFEPSELVVSDAPEESTQPPDKPGKPG* |
| Ga0157373_109881052 | 3300013100 | Corn Rhizosphere | AREPLGYELAAVAGEGGFEPGELVVPCVPEESAGPPDKPD* |
| Ga0163163_123166541 | 3300014325 | Switchgrass Rhizosphere | PEPLGAELAAVSAEGGFEPSELVITDAQDERTEPPG* |
| Ga0182024_108580462 | 3300014501 | Permafrost | YELAAVAGEGGFEPSELVVPGVPEESTEPPDKPD* |
| Ga0182041_111247111 | 3300016294 | Soil | LGYELAAVAGEGGFEPGELVVPGVPEESAEPPDQPD |
| Ga0182041_114781162 | 3300016294 | Soil | HESLGYELAAVAGEGGFEPGELVIPSAPEESTGPPDQPD |
| Ga0182032_115868552 | 3300016357 | Soil | SLGYELAAVAGEGGFEPGELVIPSAPEESTGPPDQPD |
| Ga0182040_118015871 | 3300016387 | Soil | RTTVPAGPEALGYELAAVAGEGSFEPGELVVPSIPEENTGPPDQPD |
| Ga0182037_120480282 | 3300016404 | Soil | LGYELAAVAGEGGFEPGELVVPSVPEESTGPPDQPD |
| Ga0187812_10196182 | 3300017821 | Freshwater Sediment | PVPASRQSLGYELAAVAAEGGFEPTELVVPGAPEESTEPSDKPEK |
| Ga0187820_10059241 | 3300017924 | Freshwater Sediment | GYELAAVAGEGGFEPSELVVPGVPEQSTELPEKPG |
| Ga0187806_10604432 | 3300017928 | Freshwater Sediment | SLGYELAAVAAEGGFEPGEPVVPGVPEASTEPPDKPG |
| Ga0187806_11384821 | 3300017928 | Freshwater Sediment | GRRTPVPAAREPLGYELAAVAGEGGFEPGELVVPGVPEESTEPPDKPG |
| Ga0187814_100361561 | 3300017932 | Freshwater Sediment | AAREPLGYELAAVAGEGGFEPGELVVPGVPEESTEPPDKPD |
| Ga0187808_102636563 | 3300017942 | Freshwater Sediment | GYELAAVAGEGGFEPSELVVPTGPEESTEPPDRPG |
| Ga0187808_104541251 | 3300017942 | Freshwater Sediment | AAVAAEGGFEPAELVVPATPEPSTEPPDQPDQGRR |
| Ga0187817_110239412 | 3300017955 | Freshwater Sediment | GYELAAVAAEGGFEPAELVVPATPEPSTEPPDQPD |
| Ga0187778_101011641 | 3300017961 | Tropical Peatland | PAAHESLGYELAAVAGEGGFEPGELVVPSVPEESTGPPDKPD |
| Ga0187778_106994101 | 3300017961 | Tropical Peatland | APAAHESLGYELAAVAGEGGFEPGELVVPGVPEESIRAPDQPD |
| Ga0187777_105630961 | 3300017974 | Tropical Peatland | ESLGYELAAVAGEGGFEPGELVPGVPEESTGPPDQPD |
| Ga0187815_102457382 | 3300018001 | Freshwater Sediment | AARESLGYELAAVAAEGGFEPAELVVPAAPEPSTEPPDQPD |
| Ga0187805_100569401 | 3300018007 | Freshwater Sediment | PAAREPLGYELAAVAGEGGFEPSELVPGVPEESTEPPDRPD |
| Ga0187869_102629723 | 3300018030 | Peatland | ESLGYELAAVAGEGVFEPTELVVPEESTEPPDQPG |
| Ga0187887_100318507 | 3300018043 | Peatland | PVPAARESLGYELAAVAGEGVFEPTELVVPEESTEPPDQPG |
| Ga0187851_108524801 | 3300018046 | Peatland | RESLGYELAAVAGEGGFEPSELVVPEESTEPPDQPD |
| Ga0187772_114543831 | 3300018085 | Tropical Peatland | LAAVAGEGGFEPSELVIPDAAEEGTEPPGKPGPSG |
| Ga0187769_100709157 | 3300018086 | Tropical Peatland | GRRTPAPAAHESLGFELAGVAGEGGFEPSELVVPGVPEQSTEPPHKPD |
| Ga0210399_105218311 | 3300020581 | Soil | RTPAPAAHESLGYELAAVAGEGGFEPSELVVPGVPEESTEPPDKPD |
| Ga0210405_103697702 | 3300021171 | Soil | AAHDSLGYELAAVAGEGGFEPSELVVPGVPEQSTEPPDNPG |
| Ga0210396_107752591 | 3300021180 | Soil | PESLGSELAAVAAEGGFEPTELVVPNAAEESTTEQRDKAD |
| Ga0210396_109500722 | 3300021180 | Soil | AVAAEGGFEPSELVVPDGVPDVSGEGAELPDKPPQPG |
| Ga0210388_100988514 | 3300021181 | Soil | VAAEGGFEPSELVVPDGVPDVSGEGAELPDKPPQPG |
| Ga0210388_106340621 | 3300021181 | Soil | PVDTAPQSLGYELAAVAAEGAFEPSELVVPGVPEESTEPPDQPG |
| Ga0210388_112234942 | 3300021181 | Soil | SLGYELAAVAGEGGFEPSELVVPAAPEQSSEPPDKSG |
| Ga0210385_101790223 | 3300021402 | Soil | GYELAAVSAEGGFEPSELVVPDAHEESGESPGNPVNPD |
| Ga0210383_117659801 | 3300021407 | Soil | VPAAHESLGYELAAVAGEGGFEPSELVVPDVRGKSTEPPDKSD |
| Ga0210384_101521824 | 3300021432 | Soil | TLAPAAPESLGYELAAVAGEGGFEPSGLVPDVREDATESPAKPAKPD |
| Ga0210384_109504882 | 3300021432 | Soil | RTPAPAARESLGYELAAVAGEGGFEPGELVVPGGLEESTEPPDNPD |
| Ga0210384_112819141 | 3300021432 | Soil | LGYELAAVAGEGGFEPSELVVPGVPEESTEPPDQPG |
| Ga0210398_1000480114 | 3300021477 | Soil | LSEELAAVAGEGGFEPSELVVPGVPEESTGPPDKPR |
| Ga0210402_106447181 | 3300021478 | Soil | APAAHESLGYELAAVAGEGGFEPSELVVPGVPEESTEPPDKPD |
| Ga0242678_10171131 | 3300022715 | Soil | QSLGYELAAVAAEGAFEPSELVVPGVPEESTEPPDQPG |
| Ga0247692_10490771 | 3300024279 | Soil | GYELAAVAGEGSFEPGELVVPSIPEESTGPPDKPD |
| Ga0207688_100709352 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | RRTPAPAAHESLGYELAAVAGEGSFEPGELVVPSIPEESTGPPDKPD |
| Ga0207707_109167712 | 3300025912 | Corn Rhizosphere | AAHESLGYELAAVAGEGGFEPSELVVPGVPEESTEPPDKPD |
| Ga0207693_100815923 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RRTPAPAAHESLGYELAAVAGEGGFEPSELVVPGVPEESTEPPDQPD |
| Ga0207693_105407341 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PAPAARESLGYELAAVAGEGSFEPGELVVPSAPEGSTEPPGKPG |
| Ga0207664_101611451 | 3300025929 | Agricultural Soil | TPAPAGHESLGYELAAVAGEGGFEPSELVVPGVPEESTEPPDQPD |
| Ga0207664_112111351 | 3300025929 | Agricultural Soil | GRRTPVPAARESLGYELAAVAGEGGFEPGELVPGIPEESTEPPDQPG |
| Ga0207664_116912072 | 3300025929 | Agricultural Soil | RTPAPAAHESLGYELAAVAGEGGFEPSELVVPGVPEQGTEPPDQPD |
| Ga0207711_107964252 | 3300025941 | Switchgrass Rhizosphere | RRTLVPAAREPLGYELAAVAGEGSFEPGELVVPSIPEESTGPPDKPD |
| Ga0209007_11030491 | 3300027652 | Forest Soil | EPLGYDLAAVAGEGAFEPSELVVPDVPEESAESPDKPGKPD |
| Ga0209655_102847712 | 3300027767 | Bog Forest Soil | PVPAAHESLGYELAAVAGEGGFEPSELVVPDVRGKSTEPPDKPD |
| Ga0209274_104295471 | 3300027853 | Soil | HESLGYELAAVAGEGGFEPSELVIPDESTEPPDTPS |
| Ga0209380_100760111 | 3300027889 | Soil | VPDSVGYELAAVAAEGSFEPSELVVPDVPGDGAERPDKPPEPD |
| Ga0302225_103426102 | 3300028780 | Palsa | GRRTPVPATREPLGYELAAVAGEGGFEPSELVVPEESTEPPEKPG |
| Ga0302221_101703691 | 3300028806 | Palsa | RRTPAPANRESLGYELAAVAGEGGFEPSELVVPGAPEESTDPPDQPG |
| Ga0302229_103264321 | 3300028879 | Palsa | PAAHQSLGYELAAVAGEGGFEPSELVVPRAPEESTEPPDQPG |
| Ga0311355_103078421 | 3300030580 | Palsa | LAAVAGEGTFEPSELVVPEVAESVVESTTEVADKPGITG |
| Ga0311356_101853533 | 3300030617 | Palsa | PVPATREPLGYELAAVAGEGGFEPSELVVPEESTEPPDKPG |
| Ga0302307_101776341 | 3300031233 | Palsa | RESLGYELAAVAGEGGFEPSELVVPEESTEPPDKPG |
| Ga0170818_1030384022 | 3300031474 | Forest Soil | LLLLPAPESLGYELAAVAGEGGFEPSELVVPSATESGSG |
| Ga0302326_110628163 | 3300031525 | Palsa | TPVPATREPLGYELAAVAGEGGFEPSELVVPEESTEPPDKPG |
| Ga0318541_105576801 | 3300031545 | Soil | VPAGPEALGYELAAVAGEGGFEPGELVVPSIPEENTGPPDQPD |
| Ga0318528_103346512 | 3300031561 | Soil | VGYELAAVAGEGGFEPGELVLPGVPEESTEPPDKPD |
| Ga0318515_106359502 | 3300031572 | Soil | RESLGYELAAVAGEGGFEPSELVVPGVPDESPQPPDQPD |
| Ga0318574_107574301 | 3300031680 | Soil | SLGYELAAVAGEGGFEPGELVVPSVPEESTEPPDEPD |
| Ga0318572_104783011 | 3300031681 | Soil | AARESLGYELAAVAGEGGFEPGELVVPSVPDESSGPPDQPD |
| Ga0318572_106355522 | 3300031681 | Soil | GPRKQAPAAPESLGYELAAVAGEGSFEPGELVVPSAPEESTGPPDQPD |
| Ga0310686_1033637651 | 3300031708 | Soil | RESLGYELAAVAGEGGFEPSELVVSDVPEKSIEPPDKPG |
| Ga0318493_100558043 | 3300031723 | Soil | PAPAAHESLGYELAAVAGEGGFEPGELVVPSVPEESTGPPDQPD |
| Ga0318493_103318302 | 3300031723 | Soil | YELAAVAAEGGFEPSGLVVPDGPQGSTEPPDKPGKP |
| Ga0306918_102297011 | 3300031744 | Soil | RRTPAPAAHESLGYELAAVAGEGGFEPGELVVPSVPEESTGPPDQPD |
| Ga0318502_101997623 | 3300031747 | Soil | GYELAAVAGEGGFEPGELVVPSIPEENTGPPDQPD |
| Ga0318502_106514312 | 3300031747 | Soil | RTPAPAAHESLGYELAAVAGEGGFEPGELVVPSVPEESTGPPDQPD |
| Ga0318566_104940932 | 3300031779 | Soil | PTPAGHESLGYELAAVAGEGGFEPGELVIPSAPEESTGPPDQPD |
| Ga0318529_101807611 | 3300031792 | Soil | RARAPAAHESLGYELAAVAGEGSFEPSELVVPGVPEESTGPSDHPD |
| Ga0306925_106369721 | 3300031890 | Soil | GPRTPAPAAHEALGYELAAVAGEGGFEPNELVVPSVPDQSTGPPDQPD |
| Ga0306921_127599251 | 3300031912 | Soil | AHESLGYELAAVAGEGSFEPSELVVPGVPEESTGPSDHPD |
| Ga0310916_105342531 | 3300031942 | Soil | TPAPAAHESLGYELAAVAGEGGFEPGELVVPSVPEESTGPPDQPD |
| Ga0310916_113954342 | 3300031942 | Soil | PEALGYELAAVAGEGGFEPGELVVPSIPEENTGPPDQPD |
| Ga0318504_106313961 | 3300032063 | Soil | TAAHESVGYELAAVAGEGGFEPGELVVPSVPEESTGPPDQPD |
| Ga0318510_100145873 | 3300032064 | Soil | ESLGYELAAVAGEGGFEPGELVVPSVPEESTGPPDQPD |
| Ga0306924_123830781 | 3300032076 | Soil | RAPAPAARESLGYELAAVAAEGGFEPSGLVVPDGPEGSTEPPDKPGKP |
| Ga0307470_110676811 | 3300032174 | Hardwood Forest Soil | LGYELAAVAGEGGFEPSELVVPGVPEESTEPPDKPD |
| Ga0306920_1014379141 | 3300032261 | Soil | TTVPAGPEALGYELAAVAGEGSFEPGELVVPSIPEENTGPPDQPD |
| Ga0335085_118856181 | 3300032770 | Soil | GRRTPAPAAHESLGYELAAVAGEGAFEPGELVVPGVPEESTGPSDQPD |
| Ga0335085_119285971 | 3300032770 | Soil | RRTPAPAAHESLGYELAAVAGEGGFEPGELVVPSIPEDSAEPPDKPD |
| Ga0335078_108056124 | 3300032805 | Soil | ARESLGYELAAVAGEGSFEPGELVVPAVQEESTEPPDKPI |
| Ga0335078_127061412 | 3300032805 | Soil | RRTPAPAAHESLGYELAAVAGEGGFEPGELVVPSVPEESTGTPDTPD |
| Ga0335080_108019653 | 3300032828 | Soil | TPAPAVRESLGYELAAVAGEGGFEPGELVLPGVPEESTEPPDKPD |
| Ga0335080_118789662 | 3300032828 | Soil | PAPATRESLGYELAAVAGEGGFEPGELVVPAVPDQSTGPPDKPD |
| Ga0335075_100709236 | 3300032896 | Soil | LGYELAAVTAEGGFEPAELIVPGIPEQSTEPPDKPD |
| Ga0335075_114393281 | 3300032896 | Soil | PLGYELAAVAAEGSFEPSELVIPVTEAVAQEESTESPPDQPAKPG |
| Ga0335072_106704251 | 3300032898 | Soil | LGYELAAAAAEGGFEPSGIVVPSGQEDSPEAAEQSE |
| Ga0335073_114417971 | 3300033134 | Soil | APAGESLGYELAAAAAEGGFEPTGLVVPAAPDEGAEPADHVE |
| Ga0335073_119990782 | 3300033134 | Soil | QSLGYELAAVASEGGFEPSELVVPGIPEESTEQPDKPG |
| Ga0335077_105438561 | 3300033158 | Soil | GSLGYELAAVAGEGGFEPGELVVPGVPEESTAPPDQPD |
| Ga0318519_106367521 | 3300033290 | Soil | GYELAAVAGEGGFEPGELVIPSAPEESTGPPDQPD |
| Ga0372943_0741175_511_648 | 3300034268 | Soil | RTKVPAARESLGYELAAVAGEGGFEPGELVPGIPEESTEPPDQPG |
| ⦗Top⦘ |