


| Basic Information | |
|---|---|
| Family ID | F055043 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 45 residues |
| Representative Sequence | KAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.46 % |
| % of genes near scaffold ends (potentially truncated) | 96.40 % |
| % of genes from short scaffolds (< 2000 bps) | 89.93 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.086 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.935 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.849 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.007 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.39% β-sheet: 0.00% Coil/Unstructured: 67.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 51.08 |
| PF13343 | SBP_bac_6 | 13.67 |
| PF01522 | Polysacc_deac_1 | 2.16 |
| PF01557 | FAA_hydrolase | 2.16 |
| PF00528 | BPD_transp_1 | 1.44 |
| PF01925 | TauE | 0.72 |
| PF00596 | Aldolase_II | 0.72 |
| PF02900 | LigB | 0.72 |
| PF00135 | COesterase | 0.72 |
| PF03471 | CorC_HlyC | 0.72 |
| PF00903 | Glyoxalase | 0.72 |
| PF04606 | Ogr_Delta | 0.72 |
| PF00156 | Pribosyltran | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 51.08 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 2.16 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.72 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.09 % |
| Unclassified | root | N/A | 7.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0729359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1004 | Open in IMG/M |
| 3300000858|JGI10213J12805_10162273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300000955|JGI1027J12803_106357643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300001455|JGI11848J15208_101249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300004479|Ga0062595_100749908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 794 | Open in IMG/M |
| 3300005332|Ga0066388_102905260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
| 3300005332|Ga0066388_106454200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300005332|Ga0066388_107315683 | Not Available | 554 | Open in IMG/M |
| 3300005439|Ga0070711_100907918 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005459|Ga0068867_100180637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1677 | Open in IMG/M |
| 3300005545|Ga0070695_100047310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2747 | Open in IMG/M |
| 3300005548|Ga0070665_100608753 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300005719|Ga0068861_100117627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2139 | Open in IMG/M |
| 3300005764|Ga0066903_103613070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
| 3300005764|Ga0066903_106840182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300006028|Ga0070717_10320283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1381 | Open in IMG/M |
| 3300006028|Ga0070717_11347790 | Not Available | 648 | Open in IMG/M |
| 3300006049|Ga0075417_10568829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 574 | Open in IMG/M |
| 3300006058|Ga0075432_10173757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 839 | Open in IMG/M |
| 3300006175|Ga0070712_101950877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300006844|Ga0075428_101910793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 616 | Open in IMG/M |
| 3300006881|Ga0068865_100074602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2416 | Open in IMG/M |
| 3300006903|Ga0075426_10631658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 801 | Open in IMG/M |
| 3300006953|Ga0074063_10098096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1146 | Open in IMG/M |
| 3300009137|Ga0066709_103721623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300009162|Ga0075423_12079253 | Not Available | 616 | Open in IMG/M |
| 3300010043|Ga0126380_10795478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 773 | Open in IMG/M |
| 3300010047|Ga0126382_10809446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 800 | Open in IMG/M |
| 3300010048|Ga0126373_10257865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1720 | Open in IMG/M |
| 3300010048|Ga0126373_10848637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 976 | Open in IMG/M |
| 3300010359|Ga0126376_10274682 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1449 | Open in IMG/M |
| 3300010360|Ga0126372_10134754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1940 | Open in IMG/M |
| 3300010360|Ga0126372_10804451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 931 | Open in IMG/M |
| 3300010361|Ga0126378_12433884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300010361|Ga0126378_12588130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300010373|Ga0134128_11293432 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300010376|Ga0126381_102652274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 717 | Open in IMG/M |
| 3300010376|Ga0126381_104281516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300010376|Ga0126381_104586663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300010398|Ga0126383_11269433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 826 | Open in IMG/M |
| 3300010398|Ga0126383_12132707 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300012208|Ga0137376_10959436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 733 | Open in IMG/M |
| 3300012209|Ga0137379_10807203 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012908|Ga0157286_10008194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1961 | Open in IMG/M |
| 3300012948|Ga0126375_10987723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300012971|Ga0126369_12614295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 589 | Open in IMG/M |
| 3300014969|Ga0157376_13140969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 500 | Open in IMG/M |
| 3300015374|Ga0132255_101469307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1031 | Open in IMG/M |
| 3300016294|Ga0182041_10416128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1147 | Open in IMG/M |
| 3300016319|Ga0182033_10282241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1363 | Open in IMG/M |
| 3300016319|Ga0182033_10940361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 767 | Open in IMG/M |
| 3300016341|Ga0182035_10114466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2005 | Open in IMG/M |
| 3300016445|Ga0182038_10843367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 805 | Open in IMG/M |
| 3300016445|Ga0182038_11177622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 683 | Open in IMG/M |
| 3300018028|Ga0184608_10008690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3398 | Open in IMG/M |
| 3300018028|Ga0184608_10506486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300018067|Ga0184611_1311979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300018433|Ga0066667_11529893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300018482|Ga0066669_10625843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 945 | Open in IMG/M |
| 3300020000|Ga0193692_1035631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1154 | Open in IMG/M |
| 3300021363|Ga0193699_10149433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 961 | Open in IMG/M |
| 3300025315|Ga0207697_10491146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300025893|Ga0207682_10087587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1345 | Open in IMG/M |
| 3300025910|Ga0207684_10513083 | Not Available | 1027 | Open in IMG/M |
| 3300025916|Ga0207663_10748844 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300025917|Ga0207660_11148901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 632 | Open in IMG/M |
| 3300025922|Ga0207646_11324508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300025981|Ga0207640_11232144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 666 | Open in IMG/M |
| 3300026035|Ga0207703_10051960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3325 | Open in IMG/M |
| 3300026508|Ga0257161_1105270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300027288|Ga0208525_1015620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 857 | Open in IMG/M |
| 3300027381|Ga0208983_1033704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1002 | Open in IMG/M |
| 3300027383|Ga0209213_1060507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300027480|Ga0208993_1011126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1551 | Open in IMG/M |
| 3300027616|Ga0209106_1014854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1660 | Open in IMG/M |
| 3300027846|Ga0209180_10060800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2100 | Open in IMG/M |
| 3300027862|Ga0209701_10233652 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1082 | Open in IMG/M |
| 3300027866|Ga0209813_10499041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300028380|Ga0268265_10541256 | Not Available | 1104 | Open in IMG/M |
| 3300028536|Ga0137415_11455233 | Not Available | 509 | Open in IMG/M |
| 3300028710|Ga0307322_10134298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 652 | Open in IMG/M |
| 3300028710|Ga0307322_10213724 | Not Available | 528 | Open in IMG/M |
| 3300028714|Ga0307309_10178250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 550 | Open in IMG/M |
| 3300028768|Ga0307280_10271696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 613 | Open in IMG/M |
| 3300028796|Ga0307287_10206516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 745 | Open in IMG/M |
| 3300028810|Ga0307294_10273812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 605 | Open in IMG/M |
| 3300028824|Ga0307310_10232566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 880 | Open in IMG/M |
| 3300031543|Ga0318516_10106875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1585 | Open in IMG/M |
| 3300031543|Ga0318516_10571290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
| 3300031545|Ga0318541_10286469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 917 | Open in IMG/M |
| 3300031545|Ga0318541_10537622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300031546|Ga0318538_10372564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 772 | Open in IMG/M |
| 3300031561|Ga0318528_10105045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1484 | Open in IMG/M |
| 3300031564|Ga0318573_10422677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 716 | Open in IMG/M |
| 3300031668|Ga0318542_10622289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300031680|Ga0318574_10322087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 899 | Open in IMG/M |
| 3300031681|Ga0318572_10034486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2654 | Open in IMG/M |
| 3300031713|Ga0318496_10059613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1993 | Open in IMG/M |
| 3300031713|Ga0318496_10119644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1425 | Open in IMG/M |
| 3300031718|Ga0307474_11030508 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031719|Ga0306917_10642356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 834 | Open in IMG/M |
| 3300031723|Ga0318493_10462482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
| 3300031724|Ga0318500_10437193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
| 3300031747|Ga0318502_10295725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 951 | Open in IMG/M |
| 3300031764|Ga0318535_10006108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4025 | Open in IMG/M |
| 3300031764|Ga0318535_10334183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300031778|Ga0318498_10081373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1461 | Open in IMG/M |
| 3300031781|Ga0318547_10125876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1489 | Open in IMG/M |
| 3300031795|Ga0318557_10075290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1464 | Open in IMG/M |
| 3300031805|Ga0318497_10016100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3557 | Open in IMG/M |
| 3300031833|Ga0310917_10217164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1281 | Open in IMG/M |
| 3300031833|Ga0310917_10405776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 926 | Open in IMG/M |
| 3300031846|Ga0318512_10392921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
| 3300031880|Ga0318544_10446447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300031893|Ga0318536_10069901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 1725 | Open in IMG/M |
| 3300031894|Ga0318522_10351100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
| 3300031912|Ga0306921_11102890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 889 | Open in IMG/M |
| 3300031912|Ga0306921_11257611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 821 | Open in IMG/M |
| 3300031942|Ga0310916_10100798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2320 | Open in IMG/M |
| 3300031946|Ga0310910_10615161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 861 | Open in IMG/M |
| 3300031947|Ga0310909_10115276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2175 | Open in IMG/M |
| 3300031954|Ga0306926_10631338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1305 | Open in IMG/M |
| 3300031981|Ga0318531_10040715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1944 | Open in IMG/M |
| 3300031981|Ga0318531_10424841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300032001|Ga0306922_10349011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1587 | Open in IMG/M |
| 3300032008|Ga0318562_10409599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 788 | Open in IMG/M |
| 3300032010|Ga0318569_10084460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1418 | Open in IMG/M |
| 3300032025|Ga0318507_10170355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 935 | Open in IMG/M |
| 3300032025|Ga0318507_10494237 | Not Available | 532 | Open in IMG/M |
| 3300032041|Ga0318549_10578680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300032054|Ga0318570_10080716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1398 | Open in IMG/M |
| 3300032055|Ga0318575_10066814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1687 | Open in IMG/M |
| 3300032064|Ga0318510_10395834 | Not Available | 588 | Open in IMG/M |
| 3300032065|Ga0318513_10154696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1095 | Open in IMG/M |
| 3300032076|Ga0306924_11237821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 805 | Open in IMG/M |
| 3300032090|Ga0318518_10192109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1044 | Open in IMG/M |
| 3300032205|Ga0307472_100377064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1176 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.19% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.44% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.44% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001455 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_07293592 | 2228664021 | Soil | EFRADATKAQLEIEPLTATEIDKLLTTAYGAPKSIVQKAAALVEPSSRSP |
| JGI10213J12805_101622731 | 3300000858 | Soil | TAGEIEQLLAAAYGAPKTIVQKAAALVEPSSRAP* |
| JGI1027J12803_1063576432 | 3300000955 | Soil | EIDPLAASEIETLLARAYGAPKAIVQKAAAFVEPAGRAP* |
| JGI11848J15208_1012491 | 3300001455 | Forest Soil | RSDAAKAQLEIEPLTADEIDRLLATAYSAPKPIVQKAAALVEPSNRAP* |
| Ga0062595_1007499081 | 3300004479 | Soil | ATKAQLEIEPLTATEIDKLLATAYGAPKSIVQKAAALVEPSSRSP* |
| Ga0066388_1029052601 | 3300005332 | Tropical Forest Soil | MRDADFRAEAERAQLEIEPLQAGAIEELLAKAYAAPAPIVAQAAALVDPSAHKH* |
| Ga0066388_1064542002 | 3300005332 | Tropical Forest Soil | EFRADADKAQLEIEPLTAAEIDTLLAKAYGAPKAIVQKAAALIEPPGRAP* |
| Ga0066388_1073156831 | 3300005332 | Tropical Forest Soil | LADDEFRADAQKAQLEIEPLAAAEIETLLATAYGTPNAIVQRAAALVEPSGRTP* |
| Ga0070711_1009079181 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RTQLEIDPLAASEIETLLARAYGAPKATVQKAAAFVEPAGRAP* |
| Ga0068867_1001806373 | 3300005459 | Miscanthus Rhizosphere | DAEFRADAAKAQLEIEPLTAAEIDALLATAYGARKPIVQKAAALVEPSVRAP* |
| Ga0070695_1000473105 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DAEFRADAARAQLEIEPLTAAEIDGLLATAYGAPKPIVQKAAALVEPSVRAP* |
| Ga0070665_1006087531 | 3300005548 | Switchgrass Rhizosphere | DAEFRADAAKAQLEIEPLTAAEIDALLATAYGAPKPIVQKAAALVEPSVRAP* |
| Ga0068861_1001176271 | 3300005719 | Switchgrass Rhizosphere | FRADAAKAQLEIEPLTAAEIDALLATAYGARKPIVQKAAALVEPSVRAP* |
| Ga0066903_1036130702 | 3300005764 | Tropical Forest Soil | EIEPLEAGEIETLLAKAYSAPKPIVQKAAALVEPSARAP* |
| Ga0066903_1068401822 | 3300005764 | Tropical Forest Soil | PLTAREIETFLATAYGAPRTTVQKAAALVEPSARAP* |
| Ga0070717_103202831 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EFRADADKAQLEIEPLTAGEIDTLLALAYGAPKAIVQKAAALVEPSGRAP* |
| Ga0070717_113477901 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FEATLVDPEFRTEAEKAQLEIEPLTAHEIEQFLAKAYAASKPIVQKAGALVEPSGRAQ* |
| Ga0075417_105688291 | 3300006049 | Populus Rhizosphere | AEFRADATKAQLEIEPLTATEIDKLLATAYGAPKSIVQKAAALVEPSSRSP* |
| Ga0075432_101737572 | 3300006058 | Populus Rhizosphere | LEDAEFRADATKAQLEIEPLTATEIDKLLATAYGAPKPIVQKAAALVEPSSRAP* |
| Ga0070712_1019508771 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LTAHEIEQFLAKAYAASKPIVQKAGALVEPSGRAQ* |
| Ga0075428_1019107932 | 3300006844 | Populus Rhizosphere | DAEKVQLEIEPLTAGEIETLLASAYGAPKTIVQKAAALVEPSGRAQ* |
| Ga0068865_1000746024 | 3300006881 | Miscanthus Rhizosphere | KAQLEIEPLTAAEIDALLATAYGARKPIVQKAAALVEPSVRAP* |
| Ga0075426_106316581 | 3300006903 | Populus Rhizosphere | PLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP* |
| Ga0074063_100980962 | 3300006953 | Soil | LADGEFRADADKAQMEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP* |
| Ga0066709_1037216231 | 3300009137 | Grasslands Soil | ADADKAQLEIEPLTAGEIETLLALAYGAPKAIVEKAAALVEPSGRAP* |
| Ga0075423_120792531 | 3300009162 | Populus Rhizosphere | QLEIEPLTAGEIDTLLALAYGAPKAIVQKAAALVEPSGRAP* |
| Ga0126380_107954781 | 3300010043 | Tropical Forest Soil | DADKAQLEVEPLTAAEIDTLLAKAYAAPKTIVRKAAALIEPGRAP* |
| Ga0126382_108094463 | 3300010047 | Tropical Forest Soil | TASEIETFLATAYGAPRTTVQKAAALVEPSARAP* |
| Ga0126373_102578651 | 3300010048 | Tropical Forest Soil | ADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP* |
| Ga0126373_108486371 | 3300010048 | Tropical Forest Soil | LEIEPLTAAEIETLLARAFGAPKTIVQKAAALIEPPGRAP* |
| Ga0126376_102746821 | 3300010359 | Tropical Forest Soil | DKAQLEIEPLTASEIETFLATAYGAPRTTVQKAAALVEPSARAP* |
| Ga0126372_101347543 | 3300010360 | Tropical Forest Soil | ADAEFRADAEKAQLEIEPLTAPEIENYLAAAYSAPKAIVQKAGALVEPSGRVQ* |
| Ga0126372_108044511 | 3300010360 | Tropical Forest Soil | GEFRADADKAQLEIEPLTAGEIETLLAAAYSAPKAIVQKAAALVEPSGRAP* |
| Ga0126378_124338841 | 3300010361 | Tropical Forest Soil | FRADADKAQLEVEPLTAAEIDTLLAKDYAAPKTIVQNAAALIEPSGRAP* |
| Ga0126378_125881301 | 3300010361 | Tropical Forest Soil | LTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP* |
| Ga0134128_112934322 | 3300010373 | Terrestrial Soil | LTAAEIDALLATAYGAPKPIVQKAAALVGPSVRAP* |
| Ga0126381_1026522742 | 3300010376 | Tropical Forest Soil | EKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP* |
| Ga0126381_1042815162 | 3300010376 | Tropical Forest Soil | IEPLTAAEIETLLAAAYSAPKAIVQKAAALVEPSGRAP* |
| Ga0126381_1045866631 | 3300010376 | Tropical Forest Soil | AQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRVP* |
| Ga0126383_112694332 | 3300010398 | Tropical Forest Soil | DGEFRADADKAQLEVEPLTAAEIDTLLAKAYGAPKTIVQKAAALIEPSGRAP* |
| Ga0126383_121327071 | 3300010398 | Tropical Forest Soil | LAEADKISLEIDPLKAGEIERLLGAAYGAPKPIIERAAALVEPSGH* |
| Ga0153924_11251791 | 3300012089 | Attine Ant Fungus Gardens | DPLTGQEIEKLLARAYAAPKTIVQRAAALVEPSAPNVK* |
| Ga0137376_109594361 | 3300012208 | Vadose Zone Soil | TMTDPEFVAEAGKLQMEIEPLTAAQIDALLATAYGAPRPIVQQAAELLEPAGQR* |
| Ga0137379_108072032 | 3300012209 | Vadose Zone Soil | ADADKAQLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP* |
| Ga0157286_100081941 | 3300012908 | Soil | IEPLTAAEIDALLATAYGARKPIVQNAAALVEPSVRAP* |
| Ga0126375_109877231 | 3300012948 | Tropical Forest Soil | DADKAQLEVEPLTAAEIDTLLAKAYAAPKTIVRKAAALIEPSGRAP* |
| Ga0126369_126142952 | 3300012971 | Tropical Forest Soil | DADKAQLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVDPSVRAP* |
| Ga0157376_131409691 | 3300014969 | Miscanthus Rhizosphere | TEFRADAAKAQLEIESLTAAEIDGLLATAYDTPKPIVHKAAVLVEPSVRAP* |
| Ga0132255_1014693071 | 3300015374 | Arabidopsis Rhizosphere | AAKAQLEIEPLTGEEIDRLLATAYTTPKPIVQKAAALVEPSTRAP* |
| Ga0182041_104161282 | 3300016294 | Soil | GEFRADADKAQLKIEPLTAAEIEALLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0182033_102822411 | 3300016319 | Soil | PLTAAEIDTLLAKAYAAPKTIVKKAAALIEPPGRAP |
| Ga0182033_109403612 | 3300016319 | Soil | RADADKAQLEIEPLTATEIEALLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0182035_101144663 | 3300016341 | Soil | AEKAQLEIEPLTGAEIEKLLATAYSAPKSIVQQAAGLVEPGGRAN |
| Ga0182038_108433671 | 3300016445 | Soil | QLEIEPLTAAEIERLLDMAYSTPKPIVTEAAALLEPGK |
| Ga0182038_111776221 | 3300016445 | Soil | RADAQKAQLEIEPLAAVEIETLLATAYGAPSAIVQRAAALVEPSGRTP |
| Ga0187868_12821751 | 3300018002 | Peatland | TQLEIDPLTGDEIEKLLAKAYAAPKPIVQRAAALVEPAHRAR |
| Ga0184608_100086905 | 3300018028 | Groundwater Sediment | LGDAEFRSDAAKAQLEIEPLTGDEIDNLLATAYSTPKPIVQKAAALVEPSTRAP |
| Ga0184608_105064862 | 3300018028 | Groundwater Sediment | LGDAEFRSDAAKAQLEIEPLTGDEIDNLLATAYSTPKPIVHKAAALVEPSTRAP |
| Ga0184611_13119791 | 3300018067 | Groundwater Sediment | KAQLEIEPLTAAEIDGLLATAYAAPKPIVQKAAALVEPSVRAP |
| Ga0066667_115298932 | 3300018433 | Grasslands Soil | GEFRVDADKAQLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP |
| Ga0066669_106258432 | 3300018482 | Grasslands Soil | GDAEFRADADKAQLEIEPLTSGEIEQLLARAYGAPKPIVQKAAALVEPSGRAP |
| Ga0193692_10356312 | 3300020000 | Soil | TLGDAEFRSDAAKAQLEIEPLTGNEIDNLLATAYSTPKPIVHKAAALVEPSTRAP |
| Ga0193699_101494332 | 3300021363 | Soil | LEIEPLTADEIDRLLATAYSAPKPIVQKAAALVEPSNRAP |
| Ga0207697_104911462 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | ADAAKAQLEIEPLTAAEIDALLATAYGAPKPIVQKAAALVEPSVRAP |
| Ga0207682_100875872 | 3300025893 | Miscanthus Rhizosphere | LEIEPLTAAEIDALLATAYGARKPIVQKAAALVEPSVRAP |
| Ga0207684_105130831 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EPLTAGEIETLLALAYGAPKAVVQKAAALVEPSARAP |
| Ga0207663_107488441 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RTQLEIDPLAASEIETLLARAYGAPKATVQKAAAFVEPAGRAP |
| Ga0207660_111489011 | 3300025917 | Corn Rhizosphere | LTAAEIDGLLATAYDTPKPIVHKAAVLVEPSVRAP |
| Ga0207646_113245081 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GEFRADADKAQLEIEPLTAGEIDTLLALAYGAPKAIVQKAAALVEPSGRAP |
| Ga0207640_112321441 | 3300025981 | Corn Rhizosphere | IEPLTAAEIDALLATAYGARKPIVQKAAALVEPSVRAP |
| Ga0207703_100519601 | 3300026035 | Switchgrass Rhizosphere | EIEPLTAAEIDALLATAYGAPKPIVQKAAALVEPSVRAP |
| Ga0257161_11052702 | 3300026508 | Soil | KAQLEIEPLTAGEIETLLALAYGAPKAIVEKAAALVEPSGRAP |
| Ga0208525_10156202 | 3300027288 | Soil | EPLTAGEIETLLALAYGAPKAIVQKAAALVEPSSRAP |
| Ga0208983_10337042 | 3300027381 | Forest Soil | LGDAEFRSDAAKAQLEIEPLTADEIDRLLATAYSAPKPIVQKAAALVEPSNRAP |
| Ga0209213_10605072 | 3300027383 | Forest Soil | TLGDAEFRSDAAKAQLEIEPLTADEIDRLLATAYSAPKPIVQKAAALVEPSNRAP |
| Ga0208993_10111263 | 3300027480 | Forest Soil | EPLTADEIDRLLATAYSAPKPIVQKAAALVEPSNRAP |
| Ga0209106_10148541 | 3300027616 | Forest Soil | ADAEFRADADKAQLEIEPLTASEIETFLAKAYGAPRPIVQKAAALVEPAGRAQ |
| Ga0209180_100608001 | 3300027846 | Vadose Zone Soil | EFRADADKAQLEIEPLTAGEIETLLALAYGAPKAIVEKAAALVEPSGRAP |
| Ga0209701_102336521 | 3300027862 | Vadose Zone Soil | FEATLRDAEFRAEAERAQLEIEPLTAGEIEQFLATAYGAPKPIVQKAAALVEPSGRAQ |
| Ga0209813_104990412 | 3300027866 | Populus Endosphere | GKAQLEIEPLTAAEIDALLAKAYGAPQPIVQKAAALVEPSVRAP |
| Ga0268265_105412561 | 3300028380 | Switchgrass Rhizosphere | IEPLTATAIDKLLATAYGAPKSIVQKAAALVEPSSRSP |
| Ga0137415_114552331 | 3300028536 | Vadose Zone Soil | AQLEIEPLTAGEIETLLALAYGAPKAIVEKAAALVEPSGRAP |
| Ga0307322_101342981 | 3300028710 | Soil | QLEIEPLTAAEIDALLATAYGARKPIVQKAAALVEPSVRAP |
| Ga0307322_102137241 | 3300028710 | Soil | KAQLEIEPLTGDEIDNLLATAYSTPKPIVHKAAALVEPSTRAP |
| Ga0307309_101782502 | 3300028714 | Soil | EPLTGNEIDNLLATAYSTPKPIVHKAAALVEPSTRAP |
| Ga0307280_102716962 | 3300028768 | Soil | LEIEPLTGNEIDNLLATAYSTPKPIVHKAAALVEPSTRAP |
| Ga0307287_102065162 | 3300028796 | Soil | FRSDAAKAQLEIEPLTGEEIDRLLATAYTTPKPIVQKAAALVEPSTRAP |
| Ga0307294_102738122 | 3300028810 | Soil | LEVEPLTAAEINALLATAYGAPKPIVQKAATLVEPSVRAP |
| Ga0307310_102325662 | 3300028824 | Soil | TLEDTEFRADAAKAQLEIEPLTAAKIDGLLATAYGAPKPIVQKAAALVEPSVRAP |
| Ga0318516_101068753 | 3300031543 | Soil | KAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0318516_105712901 | 3300031543 | Soil | ADADKAQLEVEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPSGRAP |
| Ga0318541_102864692 | 3300031545 | Soil | DKAQLEVEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPPGRAP |
| Ga0318541_105376222 | 3300031545 | Soil | FRADADKAQLEVEPLTATEIDTLLAKAYAAPKTIVQKAAALIEPGRAP |
| Ga0318538_103725641 | 3300031546 | Soil | ADGEFRADADKAQLEIEPLTAAEIEALLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0318528_101050453 | 3300031561 | Soil | ADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP |
| Ga0318573_104226772 | 3300031564 | Soil | ADKAQLEVEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPPGRAP |
| Ga0318542_106222892 | 3300031668 | Soil | LEVEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPSGRAP |
| Ga0318574_103220871 | 3300031680 | Soil | VEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPPGRAP |
| Ga0318572_100344861 | 3300031681 | Soil | PLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP |
| Ga0318496_100596131 | 3300031713 | Soil | KAQLEIEPLTAAEIEALLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0318496_101196443 | 3300031713 | Soil | PLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP |
| Ga0307474_110305082 | 3300031718 | Hardwood Forest Soil | PLTGQEIETMLAKAYAAPKPIVQRAAALVEPSAMKAK |
| Ga0306917_106423562 | 3300031719 | Soil | DADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP |
| Ga0318493_104624822 | 3300031723 | Soil | EFRADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0318500_104371932 | 3300031724 | Soil | EKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP |
| Ga0318502_102957251 | 3300031747 | Soil | DADKAQLEVEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPSGRAP |
| Ga0318535_100061085 | 3300031764 | Soil | RADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP |
| Ga0318535_103341832 | 3300031764 | Soil | KAQLEVEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPPGRAP |
| Ga0318498_100813732 | 3300031778 | Soil | LDDLEFRGEAEKAQLEIEPLTGAEIEKLLATAYSAPKSIVQQAAGLVEPGGRAN |
| Ga0318547_101258763 | 3300031781 | Soil | IEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP |
| Ga0318557_100752903 | 3300031795 | Soil | IEPLTGAEIEKLLATAYSAPKSIVQQAAGLVEPGGRAN |
| Ga0318497_100161001 | 3300031805 | Soil | TLADGEFRADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0310917_102171641 | 3300031833 | Soil | GEFRADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP |
| Ga0310917_104057761 | 3300031833 | Soil | QKAQLEIEPLAAVEIETLLATAYGAPSAIVQRAAALVEPSGRTP |
| Ga0318512_103929211 | 3300031846 | Soil | KAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP |
| Ga0318544_104464471 | 3300031880 | Soil | GEFRADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0318536_100699013 | 3300031893 | Soil | LTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP |
| Ga0318522_103511001 | 3300031894 | Soil | VEPLTAAEIDTLLAKAYAAPKTIVKKAAALIEPSGRAP |
| Ga0306921_111028902 | 3300031912 | Soil | ADGEFRADADKAQLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP |
| Ga0306921_112576112 | 3300031912 | Soil | DKAQLEIEPLTAGEIETLLALAYGTPKAIVQKAAALVEPSGRAP |
| Ga0310916_101007983 | 3300031942 | Soil | LKIEPLTAAEIEALLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0310910_106151611 | 3300031946 | Soil | AQLEIEPLAAVEIETLLATAYGAPSAIVQRAAALVEPSGRTP |
| Ga0310909_101152761 | 3300031947 | Soil | EIEPLMAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0306926_106313381 | 3300031954 | Soil | EFRADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP |
| Ga0318531_100407155 | 3300031981 | Soil | LEIEPLAAVEIETLLATAYGAPSAIVQRAAALVEPSGRTP |
| Ga0318531_104248412 | 3300031981 | Soil | ADADKAQLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP |
| Ga0306922_103490111 | 3300032001 | Soil | DGEFRADADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0318562_104095991 | 3300032008 | Soil | EIEPLTAAEIETLLAKAYGAPRTIVQKAAALIEPPGRAP |
| Ga0318569_100844601 | 3300032010 | Soil | DADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0318507_101703552 | 3300032025 | Soil | GEFRADADKAQLEIEPLTAAEIEALLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0318507_104942372 | 3300032025 | Soil | AQLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP |
| Ga0318549_105786801 | 3300032041 | Soil | LEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP |
| Ga0318570_100807163 | 3300032054 | Soil | LEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0318575_100668143 | 3300032055 | Soil | QLEIEPLTAGEIETLLALAYGAPKAIVQKAAALVEPSGRAP |
| Ga0318510_103958341 | 3300032064 | Soil | DEFRADAQKAQLEIEPLAAVEIETLLATAYGAPSAIVQRAAALVEPSGRTP |
| Ga0318513_101546961 | 3300032065 | Soil | ADKAQLEIEPLTAAEIETLLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0306924_112378212 | 3300032076 | Soil | EPLTAGEIETLLALAYGTPKAIVQKAAALVEPSGRAP |
| Ga0318518_101921091 | 3300032090 | Soil | LEIEPLTATEIEALLAKAYGAPRTIVQKAAALVEPSGRAP |
| Ga0307472_1003770642 | 3300032205 | Hardwood Forest Soil | EADKAQLEIEPLTAREIETFLARAYGAPRTTVQKAAALVEPSARAP |
| ⦗Top⦘ |