


| Basic Information | |
|---|---|
| Family ID | F055000 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDALEAQLQEPAPS |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.61 % |
| % of genes near scaffold ends (potentially truncated) | 69.06 % |
| % of genes from short scaffolds (< 2000 bps) | 92.81 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.698 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.791 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.144 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.007 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.70% β-sheet: 0.00% Coil/Unstructured: 47.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF01610 | DDE_Tnp_ISL3 | 3.60 |
| PF06782 | UPF0236 | 2.16 |
| PF13751 | DDE_Tnp_1_6 | 2.16 |
| PF01609 | DDE_Tnp_1 | 1.44 |
| PF02661 | Fic | 1.44 |
| PF00239 | Resolvase | 1.44 |
| PF00072 | Response_reg | 0.72 |
| PF07603 | DUF1566 | 0.72 |
| PF12323 | HTH_OrfB_IS605 | 0.72 |
| PF13579 | Glyco_trans_4_4 | 0.72 |
| PF00535 | Glycos_transf_2 | 0.72 |
| PF13565 | HTH_32 | 0.72 |
| PF00128 | Alpha-amylase | 0.72 |
| PF01850 | PIN | 0.72 |
| PF13517 | FG-GAP_3 | 0.72 |
| PF00067 | p450 | 0.72 |
| PF09940 | DUF2172 | 0.72 |
| PF13414 | TPR_11 | 0.72 |
| PF08448 | PAS_4 | 0.72 |
| PF13546 | DDE_5 | 0.72 |
| PF13229 | Beta_helix | 0.72 |
| PF03100 | CcmE | 0.72 |
| PF01526 | DDE_Tnp_Tn3 | 0.72 |
| PF00574 | CLP_protease | 0.72 |
| PF13683 | rve_3 | 0.72 |
| PF11848 | DUF3368 | 0.72 |
| PF02518 | HATPase_c | 0.72 |
| PF02738 | MoCoBD_1 | 0.72 |
| PF08241 | Methyltransf_11 | 0.72 |
| PF13340 | DUF4096 | 0.72 |
| PF13238 | AAA_18 | 0.72 |
| PF02899 | Phage_int_SAM_1 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 3.60 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.44 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.44 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.44 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.44 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.44 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.44 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.44 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.44 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.44 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.44 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.72 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.72 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.72 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.72 |
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.72 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.72 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.72 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.70 % |
| Unclassified | root | N/A | 22.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_10921776 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300000955|JGI1027J12803_100845623 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300000955|JGI1027J12803_102290156 | Not Available | 1348 | Open in IMG/M |
| 3300000955|JGI1027J12803_109112542 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300004153|Ga0063455_100879407 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005167|Ga0066672_10133327 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300005167|Ga0066672_10646078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 683 | Open in IMG/M |
| 3300005178|Ga0066688_10203827 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300005180|Ga0066685_10462607 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300005294|Ga0065705_10004843 | All Organisms → cellular organisms → Bacteria | 5901 | Open in IMG/M |
| 3300005294|Ga0065705_10179772 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300005332|Ga0066388_108382464 | Not Available | 515 | Open in IMG/M |
| 3300005445|Ga0070708_100131518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2316 | Open in IMG/M |
| 3300005445|Ga0070708_100198259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1879 | Open in IMG/M |
| 3300005518|Ga0070699_100449406 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300005554|Ga0066661_10831438 | Not Available | 540 | Open in IMG/M |
| 3300005558|Ga0066698_10996088 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005568|Ga0066703_10870646 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005764|Ga0066903_101932595 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300005764|Ga0066903_107605685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300005840|Ga0068870_10481823 | Not Available | 823 | Open in IMG/M |
| 3300005983|Ga0081540_1141377 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300006058|Ga0075432_10047042 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300006194|Ga0075427_10105263 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300006844|Ga0075428_100257767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1878 | Open in IMG/M |
| 3300006871|Ga0075434_100221691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1911 | Open in IMG/M |
| 3300006903|Ga0075426_10078681 | Not Available | 2356 | Open in IMG/M |
| 3300006969|Ga0075419_10559877 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300007076|Ga0075435_100601462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
| 3300007255|Ga0099791_10362608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus | 695 | Open in IMG/M |
| 3300007265|Ga0099794_10346117 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300007265|Ga0099794_10417484 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300009012|Ga0066710_100668226 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300009012|Ga0066710_101190167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1181 | Open in IMG/M |
| 3300009038|Ga0099829_11786712 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300009090|Ga0099827_10216395 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300009100|Ga0075418_10421671 | Not Available | 1428 | Open in IMG/M |
| 3300009137|Ga0066709_100353661 | Not Available | 2020 | Open in IMG/M |
| 3300009137|Ga0066709_101587216 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300009147|Ga0114129_10399778 | Not Available | 1811 | Open in IMG/M |
| 3300009147|Ga0114129_10650364 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1361 | Open in IMG/M |
| 3300009162|Ga0075423_12349781 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300009818|Ga0105072_1098006 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300009822|Ga0105066_1060764 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8 | 802 | Open in IMG/M |
| 3300009836|Ga0105068_1076359 | Not Available | 631 | Open in IMG/M |
| 3300010029|Ga0105074_1099406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300010038|Ga0126315_10161378 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300010042|Ga0126314_11316810 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300010042|Ga0126314_11439932 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300010045|Ga0126311_10343193 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300010046|Ga0126384_11785961 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300010329|Ga0134111_10334722 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300010333|Ga0134080_10055765 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300010333|Ga0134080_10086127 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300010359|Ga0126376_12240867 | Not Available | 592 | Open in IMG/M |
| 3300010359|Ga0126376_12535900 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300010361|Ga0126378_10150438 | All Organisms → cellular organisms → Bacteria | 2369 | Open in IMG/M |
| 3300010361|Ga0126378_11638631 | Not Available | 731 | Open in IMG/M |
| 3300010362|Ga0126377_10853046 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300010362|Ga0126377_11048785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300010366|Ga0126379_10637851 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300010366|Ga0126379_11038662 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300010397|Ga0134124_11592629 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 683 | Open in IMG/M |
| 3300011406|Ga0137454_1096801 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012199|Ga0137383_10939818 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012212|Ga0150985_102865435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300012354|Ga0137366_10227166 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300012361|Ga0137360_10257937 | Not Available | 1434 | Open in IMG/M |
| 3300012361|Ga0137360_11163345 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300012380|Ga0134047_1053236 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300012384|Ga0134036_1097287 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012469|Ga0150984_121818293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 885 | Open in IMG/M |
| 3300012685|Ga0137397_11253611 | Not Available | 530 | Open in IMG/M |
| 3300012927|Ga0137416_11138108 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 701 | Open in IMG/M |
| 3300012975|Ga0134110_10129981 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300014488|Ga0182001_10376055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 608 | Open in IMG/M |
| 3300015241|Ga0137418_10342832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1235 | Open in IMG/M |
| 3300015242|Ga0137412_10512777 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300015264|Ga0137403_11283771 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 578 | Open in IMG/M |
| 3300015356|Ga0134073_10209226 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300015358|Ga0134089_10337779 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300015374|Ga0132255_100435818 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
| 3300016270|Ga0182036_11161119 | Not Available | 641 | Open in IMG/M |
| 3300016319|Ga0182033_10365963 | Not Available | 1210 | Open in IMG/M |
| 3300016357|Ga0182032_11713023 | Not Available | 548 | Open in IMG/M |
| 3300016387|Ga0182040_10064011 | All Organisms → cellular organisms → Bacteria | 2352 | Open in IMG/M |
| 3300016387|Ga0182040_10923102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Caldilineae → unclassified Caldilineae → Caldilineae bacterium | 725 | Open in IMG/M |
| 3300016422|Ga0182039_10760977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 858 | Open in IMG/M |
| 3300018052|Ga0184638_1040006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulforapulum → Desulforapulum autotrophicum | 1702 | Open in IMG/M |
| 3300018077|Ga0184633_10348320 | Not Available | 748 | Open in IMG/M |
| 3300018078|Ga0184612_10215834 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300018079|Ga0184627_10033953 | All Organisms → cellular organisms → Bacteria | 2587 | Open in IMG/M |
| 3300019259|Ga0184646_1429394 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300019867|Ga0193704_1048228 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300020083|Ga0194111_10584700 | Not Available | 703 | Open in IMG/M |
| 3300020109|Ga0194112_10657635 | Not Available | 706 | Open in IMG/M |
| 3300021081|Ga0210379_10181323 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300021476|Ga0187846_10327212 | Not Available | 633 | Open in IMG/M |
| 3300022195|Ga0222625_1284014 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300025910|Ga0207684_10265801 | Not Available | 1480 | Open in IMG/M |
| 3300025918|Ga0207662_11241501 | Not Available | 530 | Open in IMG/M |
| 3300025923|Ga0207681_10187217 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300025942|Ga0207689_10339245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1248 | Open in IMG/M |
| 3300026331|Ga0209267_1086108 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300026540|Ga0209376_1078702 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300027671|Ga0209588_1265470 | Not Available | 521 | Open in IMG/M |
| 3300027873|Ga0209814_10103040 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300027874|Ga0209465_10011444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3942 | Open in IMG/M |
| 3300027880|Ga0209481_10004526 | All Organisms → cellular organisms → Bacteria | 5861 | Open in IMG/M |
| 3300027880|Ga0209481_10667463 | Not Available | 539 | Open in IMG/M |
| 3300027907|Ga0207428_10143869 | Not Available | 1818 | Open in IMG/M |
| 3300027957|Ga0209857_1025187 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300027961|Ga0209853_1088707 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8 | 798 | Open in IMG/M |
| 3300028589|Ga0247818_11279695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 526 | Open in IMG/M |
| 3300028716|Ga0307311_10101400 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300028755|Ga0307316_10245380 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300028771|Ga0307320_10082126 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300028819|Ga0307296_10223418 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300030902|Ga0308202_1050793 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300030903|Ga0308206_1073371 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300031092|Ga0308204_10061099 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300031092|Ga0308204_10110762 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300031093|Ga0308197_10192072 | Not Available | 688 | Open in IMG/M |
| 3300031114|Ga0308187_10146891 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300031114|Ga0308187_10151124 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 774 | Open in IMG/M |
| 3300031719|Ga0306917_11065748 | Not Available | 630 | Open in IMG/M |
| 3300031744|Ga0306918_10387009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1088 | Open in IMG/M |
| 3300031820|Ga0307473_10065758 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
| 3300031820|Ga0307473_10781423 | Not Available | 679 | Open in IMG/M |
| 3300031821|Ga0318567_10077950 | Not Available | 1761 | Open in IMG/M |
| 3300031897|Ga0318520_10776018 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031942|Ga0310916_11522539 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031995|Ga0307409_100084617 | All Organisms → cellular organisms → Bacteria | 2576 | Open in IMG/M |
| 3300032004|Ga0307414_11370529 | Not Available | 657 | Open in IMG/M |
| 3300032159|Ga0268251_10210420 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300032159|Ga0268251_10604935 | Not Available | 505 | Open in IMG/M |
| 3300034673|Ga0314798_146864 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300034678|Ga0314803_133986 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300034680|Ga0370541_061754 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.76% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.88% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.16% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.44% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.44% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.44% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.44% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.44% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_109217761 | 3300000550 | Soil | MRAAEIISFEEARARKQWDALRRHLHARFDQWLDTLEQQWHEL |
| JGI1027J12803_1008456231 | 3300000955 | Soil | MGTAEVISFEEVRARKQWTIVRQQLHERFDQWCDALEERLSEPQPALAEVTQVVG |
| JGI1027J12803_1022901564 | 3300000955 | Soil | MGAAEVIAFEEVRASKQWDTLRQPLHARFDQWLDTLEQQW |
| JGI1027J12803_1091125422 | 3300000955 | Soil | IACEAVRASKQWDDLRGQLPTRFEQWRDAWAAQRQEPAPS* |
| Ga0063455_1008794071 | 3300004153 | Soil | MGAAEVISFEEVRARKQWRTLRHQLHERFDQGLDTLEQQWHEPPSTLMEVTA |
| Ga0066672_101333271 | 3300005167 | Soil | MGCAEIISLPEVRARKQSDALRQQLHARFDQWLDGLEEQFQEPEPT* |
| Ga0066672_106460783 | 3300005167 | Soil | MGYAEIISLPEVRARKQWDLLRQQLHSRFDQWLDGLEEQLPEPESTLAEVTEAVWN* |
| Ga0066688_102038271 | 3300005178 | Soil | MGAAEVISFEEVRARKQWDALRGQLPTRFDQWLDALEAQLQEPAPS* |
| Ga0066685_104626071 | 3300005180 | Soil | MGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDALEAQLQEPAPS* |
| Ga0065705_100048435 | 3300005294 | Switchgrass Rhizosphere | MGCAEIISIDEVRARKRWESLRQQLHTRFDQWLDQLEEQWPESEPTLAVVTETV* |
| Ga0065705_101797721 | 3300005294 | Switchgrass Rhizosphere | MGAAEVISFEEVRASKQWSTLRQQLHERFDQWLDTLEQAWHEPP |
| Ga0066388_1083824642 | 3300005332 | Tropical Forest Soil | MGAAKLISCDEVRARKQWASLRQQLHACFDQWRDRLEEQWPEAEPTLAAVTETVWDLRQALTRS |
| Ga0070708_1001315183 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAAEVISFEEVRARKQCDALRRQLHTHFDQWLDGLEAQLQEPAPT* |
| Ga0070708_1001982592 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDGLEAQLREPAST* |
| Ga0070699_1004494064 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGATEVIAFEEVRARKQWATLRQRLHERFDQWLDRLEERLQEPAPPLSAVTETVWH |
| Ga0066661_108314382 | 3300005554 | Soil | MGYAEIISLPEVRARKQWDLLRQQLHSRFDQWLDGLEEQLPEPESTLAEV |
| Ga0066698_109960882 | 3300005558 | Soil | HEESPMGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDALEAQLQEPAPS* |
| Ga0066703_108706462 | 3300005568 | Soil | MGAAEVISFEEVRARKQWSTLRQQLHERFDQWLDTLEQAWHEPPATLSEV |
| Ga0066903_1019325952 | 3300005764 | Tropical Forest Soil | MGGAEIIALSAVRARKQWEVLRPQLHERFDRWLDALAQQWPAPPST* |
| Ga0066903_1076056851 | 3300005764 | Tropical Forest Soil | MGAAEVIAFEEVRARKQWDTLRHQLHERFDQWLDTL |
| Ga0068870_104818232 | 3300005840 | Miscanthus Rhizosphere | MGAAEVVSFEDVRASKQWDALRHQLYERFDSSAMAQEQRHESKPTLAQVAETVWDLRHTLTGDMTEAI |
| Ga0081540_11413772 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MGCAEVIALDEVRASKQWESLRQQLHARFDPWLARLEDQWPESEPTLAAVTESV* |
| Ga0075432_100470422 | 3300006058 | Populus Rhizosphere | MGAAEVIAFEEVRARRQWDTLRHQLHERFDQWLDTLETQWHEPPST* |
| Ga0075427_101052632 | 3300006194 | Populus Rhizosphere | MGAAEIISFEEVRARKQWDTLRQALHTRFDEWLDRLEIQLPGAAPTLA |
| Ga0075428_1002577674 | 3300006844 | Populus Rhizosphere | MGQAEVISLDEVRASKQWVSLRQQLHDYFDQWLDALQAQLPEPETTLE |
| Ga0075434_1002216915 | 3300006871 | Populus Rhizosphere | MGCAEIISFDEVRARKQWESRRQQRHARFDQWLDQLEEQWPESEPTLAAVTET |
| Ga0075426_100786811 | 3300006903 | Populus Rhizosphere | VGCAEVISLDEVRARKQWDALRQQRHARFDQWLDTLETQWPEPPATLPEV |
| Ga0075419_105598773 | 3300006969 | Populus Rhizosphere | MGAAEVISFEEVRARKQWSALRQQLHERFDQWLDTLE |
| Ga0075435_1006014621 | 3300007076 | Populus Rhizosphere | HEESPMGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDRLEAQ* |
| Ga0099791_103626082 | 3300007255 | Vadose Zone Soil | MGAAEVISFEEVRARKQWSTLRHQLHERFDQWLDTLEQQWHEPPS |
| Ga0099794_103461172 | 3300007265 | Vadose Zone Soil | MGCAEVISLTEVRASKQWDALRQQLHQRFDQWLDTLE |
| Ga0099794_104174841 | 3300007265 | Vadose Zone Soil | MGYAEIISLPEVRARKHWDLLRQQLHARFDQWLDGLEEQ |
| Ga0066710_1006682263 | 3300009012 | Grasslands Soil | FILPHEESPMGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDALEAQLQEPTPS |
| Ga0066710_1011901672 | 3300009012 | Grasslands Soil | MGAAKVISFEEVRARKQWNALRHQLHDRFDQWLYGLEAELQEHE |
| Ga0099829_117867122 | 3300009038 | Vadose Zone Soil | MGAAEVIAFAAVRASKQWDTLRHQLHERFDQWLDTLE |
| Ga0099827_102163952 | 3300009090 | Vadose Zone Soil | MGYAEIISLPEVRARKQWDLLRQQLHSRFDQWLDGLEEQLPEPEST* |
| Ga0075418_104216713 | 3300009100 | Populus Rhizosphere | VGCPEVISFPEVRASKQWEALHQQLHARFDQWLDTLEQQW |
| Ga0066709_1003536613 | 3300009137 | Grasslands Soil | MGCAAEVISLGEVRARQQWETLRQRLHDRFDQWLDGLETQLPEAEPTVAQV |
| Ga0066709_1015872162 | 3300009137 | Grasslands Soil | FILPHEESPMGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDALEAQLQEPAPS* |
| Ga0114129_103997781 | 3300009147 | Populus Rhizosphere | AEVIAFEDVRARKQWDTLRQQLHERFDQWLDTLE* |
| Ga0114129_106503643 | 3300009147 | Populus Rhizosphere | MGPAEGISFEEVRARKQRTILRQQLHERFDQWRDALEER |
| Ga0075423_123497813 | 3300009162 | Populus Rhizosphere | MGAAEVIAFEEVRARKQWDTLRHQLHERFDQWLDTLETQWH |
| Ga0105072_10980062 | 3300009818 | Groundwater Sand | MGYAEIISLPEVRARKQWDLLRQQLHSRFDQWLDGLERSIR* |
| Ga0105066_10607641 | 3300009822 | Groundwater Sand | MGCAAEVISLPEVRASKQWDSLREQLHTRFDQWLDRLEEHLQEPAPTLAA |
| Ga0105068_10763592 | 3300009836 | Groundwater Sand | MGAAEVISFEEVRARKQWDALRHQLHDRFDQWLDGLEEQLHEPEPTLA |
| Ga0105074_10994062 | 3300010029 | Groundwater Sand | MGAAEIISFEEVRARKQWDALRQELHTRFDQWLDALETQLPGPAPTLAQV |
| Ga0126315_101613782 | 3300010038 | Serpentine Soil | MGAAEVLSFEEVRARQQWDALRHQLHERFDQWLDGVEEQLHEPKPT* |
| Ga0126314_113168101 | 3300010042 | Serpentine Soil | AAEVLSFEEVRARQQWDALRHQLHERFDQWLDGLEEQLHEPVVFQTWI* |
| Ga0126314_114399322 | 3300010042 | Serpentine Soil | MGAAEVLSFEEVRARQQWDALRHQLHERFDQWLDGLEEQLHE |
| Ga0126311_103431931 | 3300010045 | Serpentine Soil | MGAAEIISFEEVRARKQREALRQELHTRFDEWLDRLEIQLPGSTPTLAQVTETVWN |
| Ga0126384_117859611 | 3300010046 | Tropical Forest Soil | VGCAEGIAFDEVRARKQWDTLRHQLHAHFDQWLDTLETQ |
| Ga0134111_103347222 | 3300010329 | Grasslands Soil | SPMGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDALEAQLQEPAPS* |
| Ga0134080_100557651 | 3300010333 | Grasslands Soil | HYFILPYEESPMGTAEIISFEEVRARKQWDALRGQLHTRFDQWLDALEAQLQEPAPS* |
| Ga0134080_100861272 | 3300010333 | Grasslands Soil | MGAAEVISFEEVRARKQWDALRHQLHDRFDQWLDGLEAQLQEPEPTLTQVTETV* |
| Ga0126376_122408672 | 3300010359 | Tropical Forest Soil | IAFEEVRARQQWDALRRQLYTRFDQWLAGLEAPLQEPPPT* |
| Ga0126376_125359001 | 3300010359 | Tropical Forest Soil | VGCAEIISLPEVRARKQWEALRQQLHARFDQWLDTLAQQWPEPPSTFPEVT |
| Ga0126378_101504382 | 3300010361 | Tropical Forest Soil | MGAAEVIAFEEVRARKHWDTLRHQLHERFDQWLDTLETQWHEPPATLPDNSVIFQRL* |
| Ga0126378_116386311 | 3300010361 | Tropical Forest Soil | MGAAELISFEEVRARKQWDALRRQLHTRFDQWLDELEDQLPEPAPSLAQVTET |
| Ga0126377_108530461 | 3300010362 | Tropical Forest Soil | MGAAEVISFEEVRARKPWDTLRQQLHARFDHWLDTLEQQWYEPPST |
| Ga0126377_110487851 | 3300010362 | Tropical Forest Soil | MGAAEVIAFEEVRARKPWDTLRHQLHARFDQWLDTLE |
| Ga0126379_106378512 | 3300010366 | Tropical Forest Soil | MGAAEVIAFEEVRARKQWDTLRHQLHERFDQWLDTLETQW |
| Ga0126379_110386621 | 3300010366 | Tropical Forest Soil | MGAAEVIAFEEVRARKQWDSLRHQLHERFDQWLDTLETQWHEPPSTL |
| Ga0134124_115926292 | 3300010397 | Terrestrial Soil | MGAAEVIAFEEVRARKQWDALRGQLHNRFDQWLDRLEAQLQEPAATL |
| Ga0137454_10968012 | 3300011406 | Soil | MGSAEIISFEEVRARKQWDTLRRQLHARFDQWLDGLEAQLPEPAPT* |
| Ga0137383_109398181 | 3300012199 | Vadose Zone Soil | MGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDELEAQLQEPAPS* |
| Ga0150985_1028654352 | 3300012212 | Avena Fatua Rhizosphere | MGVAEVIAFEEVRARKQWDALRRQLHTRFDQWLD* |
| Ga0137366_102271662 | 3300012354 | Vadose Zone Soil | MGAAEVISFEEVRARKQWDALRHQLHDRFDQWLDGLGAHL* |
| Ga0137360_102579371 | 3300012361 | Vadose Zone Soil | MGAAEIISFEEVRARKQWSTLRQQLHKRFDQWLDTLEQQ |
| Ga0137360_111633451 | 3300012361 | Vadose Zone Soil | MGCAAEVISLGDVRARKQWETLRQRLHDRFDQWLDGLETQLPESEPTLAQV |
| Ga0134047_10532362 | 3300012380 | Grasslands Soil | MGAPEVISFEEVRARKQWDALRGRLHTRFDQWLDALEAQLQEPAPS* |
| Ga0134036_10972871 | 3300012384 | Grasslands Soil | MGCAELISFDEVRARKQWESLRQQLHVRFDHWLDRLEEQWPEPAST |
| Ga0150984_1218182933 | 3300012469 | Avena Fatua Rhizosphere | MGCAAKVISLDEVRARQHWDTLRQHLHDRFDQWLDGLEAQLPEPKPTLV |
| Ga0137397_112536112 | 3300012685 | Vadose Zone Soil | MGAAEVIAFEEVRARKQWSTLRQQLHERLAQWRDTLEQAWHEPPAT* |
| Ga0137416_111381081 | 3300012927 | Vadose Zone Soil | MGAAEVISCEEIRARQQWSTLRQQLHERFDHWLETLEQAWHAPPAT |
| Ga0134110_101299811 | 3300012975 | Grasslands Soil | MGAAEVISFEEVRARKQWDALRGQLPTRFDQWLDALEAQLQEPTPS* |
| Ga0182001_103760552 | 3300014488 | Soil | MGAAEVIAFEEVRARKQWDALRHQLHDRFDQWLDSLEAQLQEPMPGRVPAQCG* |
| Ga0137418_103428321 | 3300015241 | Vadose Zone Soil | GERHFILPHEESPMGAAEIISFEEIRARKQWDALRGQLHTRFDQWLDALEAQLQEPAPS* |
| Ga0137412_105127772 | 3300015242 | Vadose Zone Soil | MGAAEVISFEEVRARKQWDALRHQLHDRFDQWLDGLQEQLPEPEPTVAQVTETGW |
| Ga0137403_112837711 | 3300015264 | Vadose Zone Soil | MGAAEVISFEEVRARKQWDALRRQLHTRFDQGLDGLEAQLQEPA |
| Ga0134073_102092261 | 3300015356 | Grasslands Soil | MGAAEVIAFEEVRARKQWDALRGQLHTRFDQWLDALEAQLQEPAPS* |
| Ga0134089_103377792 | 3300015358 | Grasslands Soil | MGAAEVISFEEVRARKQWSTLRQQLHARFDQWLDTLEQAWHEPPAT* |
| Ga0132255_1004358182 | 3300015374 | Arabidopsis Rhizosphere | MGAAEVIAFEEVRARKQWDTLRQQLHARFDQWLDTLEQQWH* |
| Ga0182036_111611191 | 3300016270 | Soil | MGTAEVITFEEVRARKHWDTLRHQLHERFDRWLDTLETQWHEPPSTLPEVTA |
| Ga0182033_103659631 | 3300016319 | Soil | MGAAEIISFEDVRARKQWDTLRQALHIRFDEWLDKLEIQLPGAAPTLAQVTEAMWN |
| Ga0182032_117130232 | 3300016357 | Soil | MGAAEVISFEEVRARKQWSTLRQQLHERFDQWLDTLEQAWPEPPATLS |
| Ga0182040_100640114 | 3300016387 | Soil | MGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDAL |
| Ga0182040_109231021 | 3300016387 | Soil | MGAAEVIEFEEVRARKQWDALRGQLHTRFDQWLNALEAELQEPAPSLAQVTET |
| Ga0182039_107609771 | 3300016422 | Soil | MGAAEVIAFEEVRARKQWDTLRHQLHERFDQWLDTLETQWHEPPST |
| Ga0184638_10400061 | 3300018052 | Groundwater Sediment | MGCAAEVISLGEVRTRQQWETLRQHLHDRFDQWLDGLETQLPESEPT |
| Ga0184633_103483202 | 3300018077 | Groundwater Sediment | MGAAEVISFEEVRASKQWDALRRQLHTRFDQWLDGLEAHLQEP |
| Ga0184612_102158342 | 3300018078 | Groundwater Sediment | MGCAEIISLPEVRARKQWDALRQQLHARFDQWLDGLEEQF |
| Ga0184627_100339532 | 3300018079 | Groundwater Sediment | MGCAEIISLPEVRARKQWDALRQQLHARFDQWLDGLEEQFQEPDPT |
| Ga0184646_14293942 | 3300019259 | Groundwater Sediment | MGWAEMISLPEVRARKQWDALRQQLHARFDQWLDGLEEPFQEPEPP |
| Ga0193704_10482282 | 3300019867 | Soil | MGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDELEAQLQEPAPS |
| Ga0194111_105847001 | 3300020083 | Freshwater Lake | ILPHEESPRGTAELISFEEARASTQWDTLRHQLHERFDQWRDTLETPWHELPAT |
| Ga0194112_106576351 | 3300020109 | Freshwater Lake | RGTAELISFEEARASTQWDTLRHQLHERFDQWRDTLETPWHELPAT |
| Ga0210379_101813231 | 3300021081 | Groundwater Sediment | KGLPMGWAEMISLPEVRARKQWDALRQQLHARFDQWLDGLEEQFQEPAPP |
| Ga0187846_103272121 | 3300021476 | Biofilm | MGAAEVIAFEEVRASKQWDTLRHQLHARFDQWLDTLETQWHEP |
| Ga0222625_12840142 | 3300022195 | Groundwater Sediment | MGAAEVISFEEVRARKQWDALRHQLHDRFDQWLDGLQEQLLEPAPTLAQVTETVWHLRHA |
| Ga0207684_102658012 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAAEVISFEEVRARKQCDALRRQLHTHFDQWLDGLEAQLQEPAPT |
| Ga0207662_112415011 | 3300025918 | Switchgrass Rhizosphere | MGAAEIISFEEVRASKQWDTLRQQLHARFDHWLDTLEQQWHEPPSTLMEVTAT |
| Ga0207681_101872173 | 3300025923 | Switchgrass Rhizosphere | MGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDRL |
| Ga0207689_103392451 | 3300025942 | Miscanthus Rhizosphere | MGAAEIISFEEVRARKQWRTLRQQLHERFDQWLDTLEQAWHEPPATLSE |
| Ga0209267_10861082 | 3300026331 | Soil | MGCAEIISLPEVRARKQSDALRQQLHARFDQWLDGLEEQFQEPEPT |
| Ga0209376_10787022 | 3300026540 | Soil | MGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDALEAQLQEPAPS |
| Ga0209588_12654702 | 3300027671 | Vadose Zone Soil | MGAAEIISFEEIRARKQWDALRGQLHTRFDQWLDAL |
| Ga0209814_101030403 | 3300027873 | Populus Rhizosphere | MGCAEIISFDEVRARKQWESRRQQRHARFDQWLDQLEEQWPESEPTLAAVTETVWD |
| Ga0209465_100114442 | 3300027874 | Tropical Forest Soil | MGGAEIIALSAVRARKQWEVLRPQLHERFDRWLDALAQQWPAPPST |
| Ga0209481_100045264 | 3300027880 | Populus Rhizosphere | MGAAEVIAFEEVRARRQWDTLRHQLHERFDQWLDTLETQWHEPPST |
| Ga0209481_106674631 | 3300027880 | Populus Rhizosphere | MGQAEVISLDEVRASKQWVSLRQQLHDYFDQWLDALQAQLP |
| Ga0207428_101438691 | 3300027907 | Populus Rhizosphere | MGAAEVIAFEEVRARKHWDTLRHQLHACFDQWLDMLE |
| Ga0209857_10251871 | 3300027957 | Groundwater Sand | MGAAEIISFEEVRARKQWATLRQQLHERFDQWLDTLEQQW |
| Ga0209853_10887071 | 3300027961 | Groundwater Sand | MGCAAEVISLPEVRASKQWDSLREQLHTRFDQWLDRLEEHLQEPAPTLA |
| Ga0247818_112796952 | 3300028589 | Soil | MGAAEVIAFEEVRARKQWDALRGQLHTRFDQWLDALEA |
| Ga0307311_101014001 | 3300028716 | Soil | TGECHFILPHEESPMGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDELEAQLQEPAPS |
| Ga0307316_102453801 | 3300028755 | Soil | ECHFILPHEESPMGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDELEAQLQEPAPS |
| Ga0307320_100821261 | 3300028771 | Soil | EVRARKQWDALRGQLHTRFDQWLDELEAQLQEPAPS |
| Ga0307296_102234181 | 3300028819 | Soil | HEESPMGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDELEAQLQEPAPS |
| Ga0308202_10507931 | 3300030902 | Soil | MRAAEIISIEEVRARKQWDTLRQQLHKRFDQWLDTLETQWPEPPSTVS |
| Ga0308206_10733712 | 3300030903 | Soil | MGAAEVISFEEVRARKQWDALRHQLHERFDQWLDGLEEQLHEPKPTLAQVTETVWN |
| Ga0308204_100610992 | 3300031092 | Soil | GERHFILPHEESPMGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDALEAQLQEPAPSLAQVTTL |
| Ga0308204_101107622 | 3300031092 | Soil | ISFEEVRARKQWDALRGQLHTRFDQWLDELEAQLQEPAPS |
| Ga0308197_101920721 | 3300031093 | Soil | MGYAEIISLPEVRARKQWDLLRQQLHSRFDQWLDGLEEQLPEPEST |
| Ga0308187_101468912 | 3300031114 | Soil | MGAAEVIAFEEVRARKQWDALRHQLHERFDQWLDGLEEQLHEPKPTLAQVTETVWN |
| Ga0308187_101511241 | 3300031114 | Soil | MGAAEVISFEEVRARQQWDTLRHQLHERFDQWLDTLETQWHEPPATLS |
| Ga0306917_110657482 | 3300031719 | Soil | VGCAEIIALAEVRASKQWEVLRQQLHARFDQWLDTLEQQWPEPPSSLPE |
| Ga0306918_103870092 | 3300031744 | Soil | MGAAEVISFEEVRARKQWDALRGQLHTRFDQWLDALETQLQEPAPS |
| Ga0307473_100657582 | 3300031820 | Hardwood Forest Soil | MGAAEVLAFEEVRARKQWDALRGRLHTRCDQWLDALEAPLQEPAPS |
| Ga0307473_107814232 | 3300031820 | Hardwood Forest Soil | MGAAEVISFEEVRASKQWDALRGQLHTRFDQWLDELEAQLRAPAPT |
| Ga0318567_100779503 | 3300031821 | Soil | MGCAAEVISLGEVRAGKQRETLRQHLHDRFDEWLDGLETQLPEAELTLAQVSAT |
| Ga0318520_107760181 | 3300031897 | Soil | MGAAEVIVCEEVGARKPWSTLRQQLHERFDQGLDSLEQR |
| Ga0310916_115225391 | 3300031942 | Soil | MGCAAEVISLGEVRARKQGETLRQHLHDRFDQWLDGLETHLPEA |
| Ga0307409_1000846171 | 3300031995 | Rhizosphere | MGAAEVIAFEEARARKQWTTLRQQLHERFDQWLDTL |
| Ga0307414_113705291 | 3300032004 | Rhizosphere | MGAAEVIAFEEVRARKQWEALRGQLHIRFDQWLDRWEEQLQEPAPS |
| Ga0268251_102104201 | 3300032159 | Agave | MGAAEVIAFEEVRARKQWDALRGQLHTRFDQWLDALEAQLQEPAPS |
| Ga0268251_106049351 | 3300032159 | Agave | VGCAEIIALAEVRASKQWEVLRHQLHERFDQWLDTLEQQWPEPPSTLPEVTA |
| Ga0314798_146864_390_536 | 3300034673 | Soil | MGAAEVISFEEVRARKQWSTLRQQRHERFDQWLDTLERAWPEPPATVSE |
| Ga0314803_133986_2_145 | 3300034678 | Soil | MGCAAKVISLDEVRARQHWDTLRQHLHDRFDQWLDGLEAQLPEPKPTL |
| Ga0370541_061754_3_134 | 3300034680 | Soil | MGCAEIISLPEVRARKQWDTLRQQLHERFDQWIDTLEKQLREPP |
| ⦗Top⦘ |