


| Basic Information | |
|---|---|
| Family ID | F054898 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKAKLKIEETSAGFRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVER |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 68.46 % |
| % of genes near scaffold ends (potentially truncated) | 39.57 % |
| % of genes from short scaffolds (< 2000 bps) | 81.29 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.942 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (41.727 % of family members) |
| Environment Ontology (ENVO) | Unclassified (89.928 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.237 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.67% β-sheet: 13.33% Coil/Unstructured: 64.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF00145 | DNA_methylase | 6.52 |
| PF00808 | CBFD_NFYB_HMF | 2.17 |
| PF01507 | PAPS_reduct | 2.17 |
| PF08401 | ArdcN | 1.45 |
| PF00239 | Resolvase | 0.72 |
| PF01555 | N6_N4_Mtase | 0.72 |
| PF13479 | AAA_24 | 0.72 |
| PF14359 | DUF4406 | 0.72 |
| PF13489 | Methyltransf_23 | 0.72 |
| PF00589 | Phage_integrase | 0.72 |
| PF01170 | UPF0020 | 0.72 |
| PF05731 | TROVE | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 6.52 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.45 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 1.45 |
| COG0116 | 23S rRNA G2445 N2-methylase RlmL | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0286 | Type I restriction-modification system, DNA methylase subunit | Defense mechanisms [V] | 0.72 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.72 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.72 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.72 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.72 |
| COG2263 | Predicted RNA methylase | General function prediction only [R] | 0.72 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.72 |
| COG2813 | 16S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmG | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.94 % |
| All Organisms | root | All Organisms | 28.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111018|Meso_c559990 | Not Available | 546 | Open in IMG/M |
| 3300000032|Draft_c0013876 | All Organisms → cellular organisms → Bacteria | 3097 | Open in IMG/M |
| 3300001975|Draft_10559990 | Not Available | 550 | Open in IMG/M |
| 3300001975|Draft_11108472 | Not Available | 520 | Open in IMG/M |
| 3300002170|JGI24711J26586_10076077 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → unclassified Thermoprotei → Thermoprotei archaeon | 981 | Open in IMG/M |
| 3300002174|JGI24710J26742_10184473 | Not Available | 611 | Open in IMG/M |
| 3300002837|bg3kmer60_1078163 | Not Available | 672 | Open in IMG/M |
| 3300006387|Ga0079069_1383822 | Not Available | 559 | Open in IMG/M |
| 3300006388|Ga0079062_1007685 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 837 | Open in IMG/M |
| 3300006395|Ga0079066_1004953 | Not Available | 637 | Open in IMG/M |
| 3300006398|Ga0079067_1010806 | Not Available | 1060 | Open in IMG/M |
| 3300006398|Ga0079067_1026119 | Not Available | 528 | Open in IMG/M |
| 3300006398|Ga0079067_1056225 | Not Available | 617 | Open in IMG/M |
| 3300006591|Ga0079071_1262088 | Not Available | 1120 | Open in IMG/M |
| 3300006592|Ga0079076_1277962 | Not Available | 643 | Open in IMG/M |
| 3300006601|Ga0079100_1032599 | Not Available | 502 | Open in IMG/M |
| 3300006801|Ga0079223_10719157 | Not Available | 632 | Open in IMG/M |
| 3300009095|Ga0079224_100635204 | Not Available | 1531 | Open in IMG/M |
| 3300009095|Ga0079224_103905780 | Not Available | 590 | Open in IMG/M |
| 3300009121|Ga0118671_1019869 | Not Available | 2170 | Open in IMG/M |
| 3300009121|Ga0118671_1067579 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 980 | Open in IMG/M |
| 3300009121|Ga0118671_1100217 | Not Available | 760 | Open in IMG/M |
| 3300009122|Ga0118674_1052141 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 980 | Open in IMG/M |
| 3300009122|Ga0118674_1066826 | Not Available | 833 | Open in IMG/M |
| 3300009360|Ga0118672_1063064 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1020 | Open in IMG/M |
| 3300009360|Ga0118672_1072098 | Not Available | 936 | Open in IMG/M |
| 3300009362|Ga0118673_1131711 | Not Available | 672 | Open in IMG/M |
| 3300009607|Ga0123327_1107020 | Not Available | 998 | Open in IMG/M |
| 3300009642|Ga0123331_1082363 | Not Available | 1058 | Open in IMG/M |
| 3300009647|Ga0123326_1053055 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1494 | Open in IMG/M |
| 3300009647|Ga0123326_1269312 | Not Available | 509 | Open in IMG/M |
| 3300009666|Ga0116182_1043692 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 2599 | Open in IMG/M |
| 3300009666|Ga0116182_1321955 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 630 | Open in IMG/M |
| 3300009669|Ga0116148_1095563 | Not Available | 1468 | Open in IMG/M |
| 3300009669|Ga0116148_1339058 | Not Available | 606 | Open in IMG/M |
| 3300009669|Ga0116148_1386377 | Not Available | 556 | Open in IMG/M |
| 3300009670|Ga0116183_1122272 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
| 3300009670|Ga0116183_1283328 | Not Available | 728 | Open in IMG/M |
| 3300009671|Ga0123334_1425659 | Not Available | 554 | Open in IMG/M |
| 3300009674|Ga0116173_1038847 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 2738 | Open in IMG/M |
| 3300009680|Ga0123335_1230004 | Not Available | 934 | Open in IMG/M |
| 3300009681|Ga0116174_10196783 | Not Available | 1019 | Open in IMG/M |
| 3300009681|Ga0116174_10526023 | Not Available | 536 | Open in IMG/M |
| 3300009682|Ga0116172_10482175 | Not Available | 572 | Open in IMG/M |
| 3300009685|Ga0116142_10116686 | Not Available | 1433 | Open in IMG/M |
| 3300009690|Ga0116143_10380860 | Not Available | 713 | Open in IMG/M |
| 3300009708|Ga0116194_1059177 | Not Available | 903 | Open in IMG/M |
| 3300009715|Ga0116160_1066843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 1654 | Open in IMG/M |
| 3300009715|Ga0116160_1387986 | Not Available | 506 | Open in IMG/M |
| 3300009720|Ga0116159_1246863 | Not Available | 707 | Open in IMG/M |
| 3300009767|Ga0116161_1217197 | Not Available | 810 | Open in IMG/M |
| 3300009783|Ga0116158_10334576 | Not Available | 835 | Open in IMG/M |
| 3300009783|Ga0116158_10442365 | Not Available | 696 | Open in IMG/M |
| 3300010310|Ga0116235_1415873 | Not Available | 693 | Open in IMG/M |
| 3300010344|Ga0116243_10247261 | Not Available | 1162 | Open in IMG/M |
| 3300010344|Ga0116243_10373098 | Not Available | 892 | Open in IMG/M |
| 3300010346|Ga0116239_10765269 | Not Available | 611 | Open in IMG/M |
| 3300010355|Ga0116242_10564340 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon HGW-Methanomicrobiales-2 | 1031 | Open in IMG/M |
| 3300010355|Ga0116242_11327170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Anaerotruncus → Anaerotruncus colihominis | 597 | Open in IMG/M |
| 3300010356|Ga0116237_10111739 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.Bin520 | 2761 | Open in IMG/M |
| 3300010356|Ga0116237_10589740 | Not Available | 964 | Open in IMG/M |
| 3300010356|Ga0116237_10969821 | Not Available | 715 | Open in IMG/M |
| 3300010356|Ga0116237_11667038 | Not Available | 520 | Open in IMG/M |
| 3300010365|Ga0116251_10176887 | All Organisms → Viruses → Predicted Viral | 1310 | Open in IMG/M |
| 3300014203|Ga0172378_10403109 | Not Available | 1034 | Open in IMG/M |
| 3300014203|Ga0172378_10455662 | Not Available | 959 | Open in IMG/M |
| 3300014203|Ga0172378_10704463 | Not Available | 736 | Open in IMG/M |
| 3300014203|Ga0172378_10957014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Megasphaera → Megasphaera massiliensis | 613 | Open in IMG/M |
| 3300014204|Ga0172381_10032947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 4580 | Open in IMG/M |
| 3300014204|Ga0172381_10048462 | All Organisms → Viruses → Predicted Viral | 3664 | Open in IMG/M |
| 3300014204|Ga0172381_10603075 | Not Available | 839 | Open in IMG/M |
| 3300014204|Ga0172381_10745581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 738 | Open in IMG/M |
| 3300014204|Ga0172381_10833264 | Not Available | 690 | Open in IMG/M |
| 3300014204|Ga0172381_10870148 | Not Available | 672 | Open in IMG/M |
| 3300014205|Ga0172380_10454749 | Not Available | 952 | Open in IMG/M |
| 3300014205|Ga0172380_11003844 | Not Available | 591 | Open in IMG/M |
| 3300014206|Ga0172377_10047011 | All Organisms → Viruses → Predicted Viral | 4112 | Open in IMG/M |
| 3300014206|Ga0172377_10232333 | Not Available | 1593 | Open in IMG/M |
| 3300014206|Ga0172377_10664723 | Not Available | 830 | Open in IMG/M |
| 3300014206|Ga0172377_11152394 | Not Available | 591 | Open in IMG/M |
| 3300014206|Ga0172377_11325012 | Not Available | 544 | Open in IMG/M |
| 3300015214|Ga0172382_10539714 | Not Available | 845 | Open in IMG/M |
| 3300015214|Ga0172382_10833866 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 628 | Open in IMG/M |
| 3300020812|Ga0214071_1088788 | All Organisms → cellular organisms → Archaea | 4726 | Open in IMG/M |
| 3300025451|Ga0208426_1070820 | Not Available | 537 | Open in IMG/M |
| 3300025682|Ga0209718_1158787 | Not Available | 652 | Open in IMG/M |
| 3300025708|Ga0209201_1066464 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1427 | Open in IMG/M |
| 3300025708|Ga0209201_1177663 | Not Available | 672 | Open in IMG/M |
| 3300025713|Ga0208195_1134416 | Not Available | 836 | Open in IMG/M |
| 3300025713|Ga0208195_1203243 | Not Available | 609 | Open in IMG/M |
| 3300025714|Ga0208458_1041351 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 1888 | Open in IMG/M |
| 3300025714|Ga0208458_1057492 | Not Available | 1510 | Open in IMG/M |
| 3300025737|Ga0208694_1068562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_57_9 | 1478 | Open in IMG/M |
| 3300025737|Ga0208694_1197460 | Not Available | 651 | Open in IMG/M |
| 3300025762|Ga0208040_1072688 | Not Available | 1480 | Open in IMG/M |
| 3300025784|Ga0209200_1116747 | Not Available | 990 | Open in IMG/M |
| 3300025859|Ga0209096_1232538 | Not Available | 684 | Open in IMG/M |
| 3300025871|Ga0209311_1050682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_57_9 | 2019 | Open in IMG/M |
| 3300025871|Ga0209311_1378137 | Not Available | 513 | Open in IMG/M |
| 3300026194|Ga0209509_1024161 | Not Available | 1888 | Open in IMG/M |
| 3300026194|Ga0209509_1027787 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1697 | Open in IMG/M |
| 3300026194|Ga0209509_1064462 | Not Available | 918 | Open in IMG/M |
| 3300026195|Ga0209312_1006771 | Not Available | 5711 | Open in IMG/M |
| 3300026195|Ga0209312_1024165 | Not Available | 2094 | Open in IMG/M |
| 3300026195|Ga0209312_1101637 | Not Available | 736 | Open in IMG/M |
| 3300026198|Ga0209313_1003466 | All Organisms → cellular organisms → Bacteria | 7778 | Open in IMG/M |
| 3300026198|Ga0209313_1015346 | Not Available | 2410 | Open in IMG/M |
| 3300026198|Ga0209313_1061429 | Not Available | 904 | Open in IMG/M |
| 3300026250|Ga0209612_1093127 | Not Available | 855 | Open in IMG/M |
| 3300026255|Ga0209613_1042114 | Not Available | 1460 | Open in IMG/M |
| 3300026255|Ga0209613_1076915 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 962 | Open in IMG/M |
| 3300026290|Ga0209510_1109845 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 977 | Open in IMG/M |
| 3300026290|Ga0209510_1229043 | Not Available | 569 | Open in IMG/M |
| 3300027711|Ga0209075_1307739 | Not Available | 610 | Open in IMG/M |
| 3300028601|Ga0265295_1105992 | Not Available | 1372 | Open in IMG/M |
| 3300028601|Ga0265295_1273724 | Not Available | 623 | Open in IMG/M |
| 3300028602|Ga0265294_10019724 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Lewinellaceae → Lewinella → unclassified Lewinella → Lewinella sp. W8 | 7002 | Open in IMG/M |
| 3300028602|Ga0265294_10019724 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Lewinellaceae → Lewinella → unclassified Lewinella → Lewinella sp. W8 | 7002 | Open in IMG/M |
| 3300028602|Ga0265294_10050212 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanocalculaceae → Methanocalculus → unclassified Methanocalculus → Methanocalculus sp. 52_23 | 3729 | Open in IMG/M |
| 3300028602|Ga0265294_10183548 | All Organisms → Viruses → Predicted Viral | 1526 | Open in IMG/M |
| 3300028602|Ga0265294_10462569 | Not Available | 782 | Open in IMG/M |
| 3300028603|Ga0265293_10196986 | All Organisms → Viruses → Predicted Viral | 1399 | Open in IMG/M |
| 3300028603|Ga0265293_10216778 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
| 3300028603|Ga0265293_10431350 | Not Available | 782 | Open in IMG/M |
| 3300028627|Ga0302243_1031519 | Not Available | 1334 | Open in IMG/M |
| 3300028635|Ga0302245_1098641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 620 | Open in IMG/M |
| 3300028638|Ga0302240_1124106 | Not Available | 522 | Open in IMG/M |
| 3300028640|Ga0302237_1046826 | Not Available | 1142 | Open in IMG/M |
| 3300028640|Ga0302237_1088419 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 701 | Open in IMG/M |
| 3300028644|Ga0302238_1130348 | Not Available | 576 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 41.73% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 17.99% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 14.39% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 6.47% |
| Anaerobic Wastewater Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge | 5.76% |
| Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 4.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 2.88% |
| Biogas Fermenter | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Biogas Fermenter | 1.44% |
| Biogas Fermentantion | Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion | 1.44% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.72% |
| Solid Waste From Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Solid Waste From Bioreactor | 0.72% |
| Hydrocarbon Resource Environments | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments | 0.72% |
| Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 0.72% |
| Biogas Reactor | Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111018 | Mesophilic bioreactor microbial communities at Bielefeld, Germany | Engineered | Open in IMG/M |
| 3300000032 | Oil sands microbial community from Northern Alberta which degrade Naphthaline | Engineered | Open in IMG/M |
| 3300001975 | Biogas fermenter microbial communities from the University of Hamburg, Germany | Engineered | Open in IMG/M |
| 3300002170 | Biogas fermentation microbial communities from Germany - Plant 3 DNA1 | Engineered | Open in IMG/M |
| 3300002174 | Biogas fermentation microbial communities from Germany - Plant 2 DNA2 | Engineered | Open in IMG/M |
| 3300002837 | Biogas reactor microbial communities from SLU, Sweden, that are enriched on cellulose - Sample No3 60kmer | Engineered | Open in IMG/M |
| 3300006387 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Oil_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006388 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006395 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006398 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006591 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Ile_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006592 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Leu_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006601 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_H2B_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006801 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 | Environmental | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009121 | Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C12.But.A IDBA | Engineered | Open in IMG/M |
| 3300009122 | Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C13.But.B IBDA | Engineered | Open in IMG/M |
| 3300009360 | Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C12.But.B IBDA | Engineered | Open in IMG/M |
| 3300009362 | Syntrophic microbial communities from biogas reactors - R1.C13.But.A IBDA | Engineered | Open in IMG/M |
| 3300009607 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009642 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009647 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009656 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
| 3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
| 3300009671 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009674 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG | Engineered | Open in IMG/M |
| 3300009680 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009681 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG | Engineered | Open in IMG/M |
| 3300009682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG | Engineered | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300009690 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG | Engineered | Open in IMG/M |
| 3300009696 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG | Engineered | Open in IMG/M |
| 3300009708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU001_MetaG | Engineered | Open in IMG/M |
| 3300009715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG | Engineered | Open in IMG/M |
| 3300009720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG | Engineered | Open in IMG/M |
| 3300009767 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG | Engineered | Open in IMG/M |
| 3300009783 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG | Engineered | Open in IMG/M |
| 3300010310 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B SIP RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300010344 | AD_JPASca | Engineered | Open in IMG/M |
| 3300010346 | AD_USMOca | Engineered | Open in IMG/M |
| 3300010355 | AD_USDVca | Engineered | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010365 | AD_USDIca | Engineered | Open in IMG/M |
| 3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
| 3300015214 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG | Engineered | Open in IMG/M |
| 3300020812 | Anaerobic digester digestate microbial community, University of Toronto, Ontario, Canada - DG074 megahit | Engineered | Open in IMG/M |
| 3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025714 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025737 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025762 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025784 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025859 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025871 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300026194 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026195 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026198 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026250 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026252 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C12 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026255 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026290 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026311 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027711 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300028601 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Methane capture system biofilm | Engineered | Open in IMG/M |
| 3300028602 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 | Environmental | Open in IMG/M |
| 3300028603 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R | Engineered | Open in IMG/M |
| 3300028627 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Met | Engineered | Open in IMG/M |
| 3300028635 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Thr | Engineered | Open in IMG/M |
| 3300028638 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_His | Engineered | Open in IMG/M |
| 3300028640 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Ala | Engineered | Open in IMG/M |
| 3300028644 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Asn | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Meso_5599901 | 2209111018 | Solid Waste From Bioreactor | MKVKQKIIETRAGFRCRVCDRRFRTEEAAFVHQSDDCSPD |
| Draft_00138765 | 3300000032 | Hydrocarbon Resource Environments | MKAKLKIEETRAGYRCRVCGRRFRTEEAAFVHQSYNCSRDGRTLI* |
| Draft_105599901 | 3300001975 | Biogas Fermenter | MKVKQKIIETRAGFRCRVCDRRFRTEEAAFVHQSDDCSPDL |
| Draft_111084721 | 3300001975 | Biogas Fermenter | VKAKLKIEELPAGYRCRVCGRRFSTEEAAFVHQSYDCSRGVRTMVER* |
| JGI24711J26586_100760772 | 3300002170 | Biogas Fermentantion | MKVKQKIIEARAGFRCRVCGRRFGTEEAAFVHQSYDCSQMKLVEV* |
| JGI24710J26742_101844731 | 3300002174 | Biogas Fermentantion | MKVKQKIIETRAGFRCRVCGRRFRTEEAAFVHQSYDCSQMKLVED* |
| bg3kmer60_10781632 | 3300002837 | Biogas Reactor | MKAKLKIEETSAGFRCRVCGRRFRSEEAAFIHQSYDCSPDLRPLE* |
| Ga0079069_13838222 | 3300006387 | Anaerobic Digestor Sludge | MKAKLKIEELPAGYRCRVCGRRFRAEEAAFVHQSYDCSQNVRTMVERW* |
| Ga0079062_10076851 | 3300006388 | Anaerobic Digestor Sludge | KAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVES* |
| Ga0079066_10049533 | 3300006395 | Anaerobic Digestor Sludge | MKAKLKIIETSTGSRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVEE |
| Ga0079067_10108061 | 3300006398 | Anaerobic Digestor Sludge | MKAKLKIEETSAGFRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVER |
| Ga0079067_10261192 | 3300006398 | Anaerobic Digestor Sludge | VKAKLKIEELPAGYRCRVCGRRFRAEEAAFVHQSYDCSQNVRTMVERW* |
| Ga0079067_10562251 | 3300006398 | Anaerobic Digestor Sludge | MKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDC |
| Ga0079071_12620883 | 3300006591 | Anaerobic Digestor Sludge | KAKLKIEELPAGYRCRVCGRRFRAEEAAFVHQSYDCSQNVRTMVERW* |
| Ga0079076_12779621 | 3300006592 | Anaerobic Digestor Sludge | VKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMV |
| Ga0079100_10325992 | 3300006601 | Anaerobic Digestor Sludge | MKAKLKIEELPAGYRCRVCGRRFRAEEAAFVHQSYDCSQNV |
| Ga0079223_107191572 | 3300006801 | Agricultural Soil | MKAKPKIGETRAGFRCRVCGRRFRTEEAAFVHQSYDCSKCPQRSEG* |
| Ga0079224_1006352046 | 3300009095 | Agricultural Soil | MKAKPKIGETRAGFRCRVCGRRFRTEEAAFVHQSYDCSQMKLVED* |
| Ga0079224_1039057801 | 3300009095 | Agricultural Soil | MKVKQKIIETRAGFRCRVCDRRFRTEEAAFVHQSYDCSPDLRPLAI |
| Ga0118671_10198697 | 3300009121 | Anaerobic Wastewater Sludge | MKAKLKIIETSTGFRCRVCGRRFSTEEAAFVHQSYDCSRDVRTRS* |
| Ga0118671_10675791 | 3300009121 | Anaerobic Wastewater Sludge | MKAKLKIEELPAGYRCRVCGRRFRTEKAAFVHQSYDCVRPVRGMVEE* |
| Ga0118671_11002171 | 3300009121 | Anaerobic Wastewater Sludge | MKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVEER* |
| Ga0118674_10521411 | 3300009122 | Anaerobic Wastewater Sludge | KAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVERW* |
| Ga0118674_10668261 | 3300009122 | Anaerobic Wastewater Sludge | VKAKLKIEELPAGYRCRVCGRRFRTEKAAFVHQSYDCVRPVRGMVEE* |
| Ga0118672_10630641 | 3300009360 | Anaerobic Wastewater Sludge | LNIEELPAGYRCRVCGRRFSTEEAAFVHQSYDCVRPVRGMVEE* |
| Ga0118672_10720983 | 3300009360 | Anaerobic Wastewater Sludge | MKVKQKIIETRAGFRCRVCDRRFRTEEAAFVHQSYNCSRDGRTLI* |
| Ga0118673_11317111 | 3300009362 | Anaerobic Wastewater Sludge | MKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVERW* |
| Ga0123327_11070201 | 3300009607 | Anaerobic Biogas Reactor | MKAKLKIEELPAGYRCRVCGRRFSTEEAAFVHQSYDCSQNVRTMVEER* |
| Ga0123327_11420682 | 3300009607 | Anaerobic Biogas Reactor | VRGKMKAKMKIVETRSGYRCRVCGRRFSTGEAAFTHQSYDCSADVKTRSKEKGE* |
| Ga0123331_10823632 | 3300009642 | Anaerobic Biogas Reactor | MKAKPKIGETRAGFRCRVCGRRFSTEEAAFVHQSYDCSQNVRTMVEER* |
| Ga0123326_10530554 | 3300009647 | Anaerobic Biogas Reactor | MKAKPKIGETRAGFRCRVCGRRFRTEEAAFVHQSYDCSQMKLVEKR* |
| Ga0123326_12693123 | 3300009647 | Anaerobic Biogas Reactor | MRAKLKIEETRAGYRCRVCGRRFRAEEAAFVHQSYDCSQNVRTMVEER* |
| Ga0123329_12628751 | 3300009656 | Anaerobic Biogas Reactor | VRGKMKAKMKIVETRSGYRCRVCGRRFSTGEAAFTHQSYDCSAD |
| Ga0116182_10436928 | 3300009666 | Anaerobic Digestor Sludge | VKAKLKIEELPAGYRCRVCGRRFRTEKAAFVHQSYDCSQNVRTMVENREMD* |
| Ga0116182_13219552 | 3300009666 | Anaerobic Digestor Sludge | MKAKLKIIETSTGFRCRVCGRRFRTEEAAFVHQSYDCVRPVRGMEW* |
| Ga0116148_10955631 | 3300009669 | Anaerobic Digestor Sludge | AKLKIEETRAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVEE* |
| Ga0116148_13390582 | 3300009669 | Anaerobic Digestor Sludge | MKAKLKIEETRAGYRCRVCGRRFRTEEAAFVHQSYDCSQMKLVED* |
| Ga0116148_13863773 | 3300009669 | Anaerobic Digestor Sludge | VKAKLKIEETRAGYRCRVCGRRFRAEEAAFVHQSYDCSQNVRTMVEER* |
| Ga0116183_11080753 | 3300009670 | Anaerobic Digestor Sludge | MGKMKAKMKIVETRSGYRCRVCGRRFSTGEAAFTHQSYDCSADVKTRSKEKGE* |
| Ga0116183_11222725 | 3300009670 | Anaerobic Digestor Sludge | RRRTRSAGCERMKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQGARTLVENRKED* |
| Ga0116183_12833281 | 3300009670 | Anaerobic Digestor Sludge | MKAKLKIEVTRAGFRCRVCGRRFRAEEAAFVHQSYDCVRPVRGM |
| Ga0123334_14256593 | 3300009671 | Anaerobic Biogas Reactor | MKAKLKIIETSTGFRCRVCGRRFRAEEAAFVHQSYDCSQNV |
| Ga0116173_10388474 | 3300009674 | Anaerobic Digestor Sludge | MKAKLKIEELPAGFRCRVCGRRFRTEEAAFVHQSYDCSQGARTLVEE* |
| Ga0123335_12300041 | 3300009680 | Anaerobic Biogas Reactor | MRSTGCERMKAKLKIEELPAGYRCRVCGRRFRTEKAAFVHQSYDCVRPVRGMVEE* |
| Ga0116174_101967833 | 3300009681 | Anaerobic Digestor Sludge | MKAKLKIEELPAGFRCRVCGRRFRAEEAAFVHQSYDCSQNVRTMVENREMD* |
| Ga0116174_105260231 | 3300009681 | Anaerobic Digestor Sludge | VKAKLKIEELPAGYRCRVCGRRFRTGEAAFVHQSYDCVRPVRGMVEE* |
| Ga0116172_104821752 | 3300009682 | Anaerobic Digestor Sludge | MKAKPKIGETRAGFRCRICGRRFRTEEAAFVHQSYNCT |
| Ga0116142_101166864 | 3300009685 | Anaerobic Digestor Sludge | LKVKQKIIETRAGFRCRVCDRRFRTEEAAFVHQSYNCSRDGRTLI* |
| Ga0116143_100198288 | 3300009690 | Anaerobic Digestor Sludge | VRGKMKAKMKIVETRSGYRCRVCGRRFSPGEAAFTHQSYDCSADVKTRSKEKGE* |
| Ga0116143_103808604 | 3300009690 | Anaerobic Digestor Sludge | KVKQKIIETRAGFRCRVCDRRFRTEEAAFVHQSYDCSQNVRTMVEEG* |
| Ga0116177_102570971 | 3300009696 | Anaerobic Digestor Sludge | KMKAKMKIVETRSGYRCRVCGRRFSTGEAAFTHQSYDCSADVKTRSKEKGE* |
| Ga0116194_10591772 | 3300009708 | Anaerobic Digestor Sludge | MKAKLKIEETRAGFRCRVCGRRFRTEEAAFVHQSYDCVRPVRGMEW* |
| Ga0116160_10668433 | 3300009715 | Anaerobic Digestor Sludge | MKAKLKIIETSTGFRCRVCGRRFRTEEAAFVHQSYDCSQGVRTLVGED* |
| Ga0116160_13879861 | 3300009715 | Anaerobic Digestor Sludge | KAKLKIEVTRAGFRCRVCGRRFSTEEAAFVHQSYDCSRDVRTLS* |
| Ga0116159_12468632 | 3300009720 | Anaerobic Digestor Sludge | MKAKLKIIETSTGFRCRVCGRRFRTEEAAFVHQSYNCSRDGR* |
| Ga0116161_12171974 | 3300009767 | Anaerobic Digestor Sludge | MKAKLKIEETRAGFRCRVCGRRFRTEEAAFVHQSYDC |
| Ga0116158_103345763 | 3300009783 | Anaerobic Digestor Sludge | MKAKLKIIETSTGFRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVEE* |
| Ga0116158_104423654 | 3300009783 | Anaerobic Digestor Sludge | MKAKLKIAETPSGYRCQVCGRRFRTEEAAFVHQSYDC |
| Ga0116235_14158733 | 3300010310 | Anaerobic Biogas Reactor | MKAKLKIEELPAGYRCRVCGRRFRAEEAAFVHQSYDCSQNVRTMVEER* |
| Ga0116243_102472613 | 3300010344 | Anaerobic Digestor Sludge | MKAKLKIEETRAGFRCRVCGRRFRTEEAAFVHQSYDCSPPVRGMEW* |
| Ga0116243_103730981 | 3300010344 | Anaerobic Digestor Sludge | MKAKLKIEETRAGFRCRVCGRRFSTEEAAFVHQSYDCSRDVRTLS* |
| Ga0116239_107652692 | 3300010346 | Anaerobic Digestor Sludge | MKAKLKIAETPSGYRCQVCGRRFATEEAAFVHQSYDCSRDVRTRS* |
| Ga0116242_100711571 | 3300010355 | Anaerobic Digestor Sludge | MKVKLKIEETSAGFRCRVCGRRFRTEEAAFVHQSYDCSPDLRPLAIQ |
| Ga0116242_105643403 | 3300010355 | Anaerobic Digestor Sludge | MKAKLKIIETSTGSRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVEE* |
| Ga0116242_113271702 | 3300010355 | Anaerobic Digestor Sludge | MKAKLKIEETSAGFRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVEER* |
| Ga0116237_101117397 | 3300010356 | Anaerobic Digestor Sludge | MKAKLKIAETPSGYRCQVCGRRFRTEEAAFVHQSYDCSRD |
| Ga0116237_105897404 | 3300010356 | Anaerobic Digestor Sludge | KIIETSTGFRCRVCDRRFRTEEAAFVHQSYDCSQNVRTMVEEG* |
| Ga0116237_109698213 | 3300010356 | Anaerobic Digestor Sludge | MKAKLKIEETRAGFRCRVCGRRFRTEEAAFVHQSRDCSQDV |
| Ga0116237_116670382 | 3300010356 | Anaerobic Digestor Sludge | MKAKLKIIETSTGFRCRVCGRRFRTEEAAFVHQSYDCSQNV |
| Ga0116251_101768875 | 3300010365 | Anaerobic Digestor Sludge | MKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQGARTLVENRKED* |
| Ga0172378_104031092 | 3300014203 | Groundwater | MKAKLKIIETSTGFRCRVCGRRFRTEEAAFVHQSYDCSQMKGRKG* |
| Ga0172378_104556624 | 3300014203 | Groundwater | MKAKLKIEELPAGFRCRVCGRRFRTEEAAFVHQSYDCSQGARTLVENRKED* |
| Ga0172378_107044633 | 3300014203 | Groundwater | MKAKPKIGETRAGFRCRVCGRRFSTEEAAFVHQSYDCSQMKLVED* |
| Ga0172378_109570141 | 3300014203 | Groundwater | MKAKLKIEELPAGYRCRVCGRRFSTEEAAFVHQSYDCSQNVRTMVEE* |
| Ga0172381_100329472 | 3300014204 | Landfill Leachate | MKAKLKIEETSAGYRCRVCGRRFSTEEAAFVHQARDCSRDVRTLVETRKE* |
| Ga0172381_100484624 | 3300014204 | Landfill Leachate | MCVGDEMKTKSKIEETSFRHFRCRVCGRTFTTEEAAFVHQSYDCSQGVRTRW* |
| Ga0172381_106030753 | 3300014204 | Landfill Leachate | MKAKLKIEETQTGYRCRVCGRRFRTEEAAFVHQSYDCSQGVRTLVGED* |
| Ga0172381_107455812 | 3300014204 | Landfill Leachate | MEAKLKIEETRAGFRCRICGRRFRTEEAAFYHQARDCSQERASPRKEGT* |
| Ga0172381_108332642 | 3300014204 | Landfill Leachate | MKAKLKVEETSTGFRCRICGRRFRTEEAAFVHQSYDCVRPVRGMEW* |
| Ga0172381_108701482 | 3300014204 | Landfill Leachate | MKAKLKIIETPTGFRCRVCGRRFRAEEAASVHQSYDCSQNVRTMVENRKEE* |
| Ga0172380_104547491 | 3300014205 | Landfill Leachate | MKAKLKIEETRAGFRCRVCGRRFRTEEAAFVHQSYDCSQMKVVK* |
| Ga0172380_110038442 | 3300014205 | Landfill Leachate | MKAKLKIEETRAGFRCRVCGRRFRTEEAAFVHQSYNCSRDGRTLI* |
| Ga0172377_100470117 | 3300014206 | Landfill Leachate | MKTKSKIEETSFRHFRCRVCGRTFTTEEAAFVHQSYDCSQGVRTRW* |
| Ga0172377_102323331 | 3300014206 | Landfill Leachate | IIETSTGFRCRVCGRRFRAEEAAFVHQSYDCSQNVRTMVEDR* |
| Ga0172377_106647233 | 3300014206 | Landfill Leachate | VKAKLKIEELPAGYRCRVCGRRFSTEEAAFVHQSWDC |
| Ga0172377_111523941 | 3300014206 | Landfill Leachate | MKAKLKIEETRAGFRCRVCGRRFRTEEAAFVHQSYDCS |
| Ga0172377_113250121 | 3300014206 | Landfill Leachate | KIEETRAGFRCRVCGRRFSTEEAAFVHQSYDCSRDVRTMVEG* |
| Ga0172382_105397141 | 3300015214 | Landfill Leachate | MKAKLKIIETSTGFRCRVCGRRFRAEEAAFVHQSYDCSQNVRTMVEE* |
| Ga0172382_108338663 | 3300015214 | Landfill Leachate | MKVKQKIIETRAGFRCRVCGRRFGTEEAAFVHQSYDCSQMKLVGD* |
| Ga0214071_10887882 | 3300020812 | Anaerobic Digester Digestate | MKAKLKIAETPSGYRCRVCGRRFSTEEAAFVHQSYDCSRDVRTLS |
| Ga0208426_10708201 | 3300025451 | Aqueous | VKAKLKIEELPAGYRCRVCGRRFRTEKAAFVHQSYDCS |
| Ga0209718_11587871 | 3300025682 | Anaerobic Digestor Sludge | MKAKLKIEETRAGFRCRVCGRRFRTEEAAFVHQSYDCSPDLRPLAI |
| Ga0209201_10664642 | 3300025708 | Anaerobic Digestor Sludge | MKAKLKIEETRAGYRCRVCGRRFRTEEAAFVHQSYDCSQMKLVED |
| Ga0209201_11776631 | 3300025708 | Anaerobic Digestor Sludge | VKAKLKIEETRAGYRCRVCGRRFRAEEAAFVHQSYDCSQNVRTMVEER |
| Ga0208195_11344161 | 3300025713 | Anaerobic Digestor Sludge | VKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVENREMD |
| Ga0208195_12032431 | 3300025713 | Anaerobic Digestor Sludge | VKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVRLVDERGLLRP |
| Ga0208195_12432503 | 3300025713 | Anaerobic Digestor Sludge | VRGKMKAKMKIVETRSGYRCRVCGRRFSTGEAAFTHQSYDCSADVKTRSKEKGE |
| Ga0208458_10413515 | 3300025714 | Anaerobic Digestor Sludge | MKAKLKIEELPAGFRCRVCGRRFRTEEAAFVHQSYDCSQGARTLVEE |
| Ga0208458_10574926 | 3300025714 | Anaerobic Digestor Sludge | IEVTRAGFRCRVCGRRFRTEKAAFVHQSYDCSQNVRTMVEER |
| Ga0208694_10685622 | 3300025737 | Anaerobic Digestor Sludge | VKAKLKIEELPAGFRCRVCGRRFRTEKAAFVHQSYDCVRPVRGMVEE |
| Ga0208694_11974601 | 3300025737 | Anaerobic Digestor Sludge | RRRTRSAGCERMKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQGARTLVENRKED |
| Ga0208040_10726881 | 3300025762 | Anaerobic Digestor Sludge | LKIIETSTGFRCRVCGRRFRTEKAAFVHQSYDCSQNVRTMVEER |
| Ga0209200_11167474 | 3300025784 | Anaerobic Digestor Sludge | MKAKLKIIETSTGFRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVEE |
| Ga0209096_12325384 | 3300025859 | Anaerobic Digestor Sludge | LKVKQKIIETRAGFRCRVCDRRFRTEEAAFVHQSYDCSQNVRTMVEEG |
| Ga0209311_10506821 | 3300025871 | Anaerobic Digestor Sludge | MKVKLKIEETSAGFRCRVCGRRFRTEEAAFVHQSYDCSPDLRPLA |
| Ga0209311_13781372 | 3300025871 | Anaerobic Digestor Sludge | RVKAKLKIEELPAGYRCRVCGRRFRMEEAAFVHQSYDCSQNVRTMVEER |
| Ga0209509_10241611 | 3300026194 | Anaerobic Biogas Reactor | MKAKLKIIETSTGFRCRVCGRRFSTEEAAFVHQSYDCSRDVRTRS |
| Ga0209509_10277872 | 3300026194 | Anaerobic Biogas Reactor | MKAKPKIGETRAGFRCRVCGRRFRTEEAAFVHQSYDCSQMKLVEKR |
| Ga0209509_10644623 | 3300026194 | Anaerobic Biogas Reactor | MKVKQKIIETRAGFRCRVCDRRFRTEEAAFVHQSYNCSRDGRTLI |
| Ga0209312_10067711 | 3300026195 | Anaerobic Biogas Reactor | VKAKLKIEELPAGYRCRVCGRRFRTEKAAFVHQSYDCVRPVRGMVEE |
| Ga0209312_10241658 | 3300026195 | Anaerobic Biogas Reactor | MKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVR |
| Ga0209312_11016372 | 3300026195 | Anaerobic Biogas Reactor | VKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVR |
| Ga0209313_10034668 | 3300026198 | Anaerobic Biogas Reactor | MKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVERW |
| Ga0209313_10153465 | 3300026198 | Anaerobic Biogas Reactor | MKAKPKIGETRAGFRCRVCGRRFSTEEAAFVHQSYDCSQNVRTMVEER |
| Ga0209313_10614294 | 3300026198 | Anaerobic Biogas Reactor | MKAKLKIEELPAGYRCRVCGRRFRTEKAAFVHQSYDCVRPVRGMVEE |
| Ga0209612_10931274 | 3300026250 | Anaerobic Biogas Reactor | MKAKPKIGETRAGFRCRVCGRRFRTEEAAFVHQSYDCSQMKLVED |
| Ga0209722_11853711 | 3300026252 | Anaerobic Biogas Reactor | KMKAKMKIVETRSGYRCRVCGRRFSTGEAAFTHQSYDCSADVKTRSKEKGE |
| Ga0209613_10421143 | 3300026255 | Anaerobic Biogas Reactor | MKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVEER |
| Ga0209613_10769154 | 3300026255 | Anaerobic Biogas Reactor | RSAGCERMKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVERW |
| Ga0209510_11098451 | 3300026290 | Anaerobic Biogas Reactor | IEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVERW |
| Ga0209510_12290431 | 3300026290 | Anaerobic Biogas Reactor | MKAKLKIEELPAGYRCRVCGRRFSTEEAAFVHQSYDCSQNVRTMVEER |
| Ga0209723_10206375 | 3300026311 | Anaerobic Biogas Reactor | MKAKMKIVETRSGYRCRVCGRRFSTGEAAFTHQSYDCSADVKTRSKEKGE |
| Ga0209075_13077392 | 3300027711 | Agricultural Soil | MKAKPKIGETRAGFRCRVCGRRFRTEEAAFVHQSYDCSKCPQRSEG |
| Ga0265295_11059921 | 3300028601 | Landfill Leachate | VKAKLKIEELPAGYRCRVCGRRFSTEEAAFVHQSWDCSKTVRR |
| Ga0265295_12737242 | 3300028601 | Landfill Leachate | VKAKLKIEELPAGYRCRVCGRRFSTEEAAFVHQSWDCSKTVRE |
| Ga0265294_100197241 | 3300028602 | Groundwater | MKAKLKIIETSTGFRCRVCGRRFRAEEAAFVHQSYD |
| Ga0265294_100197245 | 3300028602 | Groundwater | MKAKLKIIETPTGFRCRVCGRRFRAEEAASVHQSYDCSQNVRTMVENRKEE |
| Ga0265294_100502127 | 3300028602 | Groundwater | MKAKLKIIETSTGFRCRVCGRRFRAEEAAFVHQSYDCSQNVRTMVEDR |
| Ga0265294_101835482 | 3300028602 | Groundwater | MKAKLKIEELPAGFRCRVCGRRFRTEEAAFVHQSYDCSQGARTLVENRKED |
| Ga0265294_104625692 | 3300028602 | Groundwater | MKAKLKIEELPAGYRCRVCGRRFSTEEAAFVHQSYDCSQNVRTMVEE |
| Ga0265293_101969865 | 3300028603 | Landfill Leachate | GVGMKVKQKIIETRAGFRCRVCGRRFGTEEAAFVHQSYDCSQMKLVGD |
| Ga0265293_102167782 | 3300028603 | Landfill Leachate | MKAKLKIEETRAGFRCRVCGRRFRAEEAAFVHQSYDCSQNVRTMVEE |
| Ga0265293_104313502 | 3300028603 | Landfill Leachate | MKAKPKIGETRAGFRCRVCGRRFSTEEAAFVHQSYDCSQMKLVGD |
| Ga0302243_10315191 | 3300028627 | Activated Sludge | AGCERMKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCSQNVRTMVERW |
| Ga0302245_10986411 | 3300028635 | Activated Sludge | MKAKLKIEETRAGYRCRVCGRRFRAEEAAFVHQSYDCS |
| Ga0302240_11241061 | 3300028638 | Activated Sludge | RMKAKLKIEETRAGYRCRVCGRRFRAEEAAFVHQSYDCSQNVRTMVEER |
| Ga0302237_10468261 | 3300028640 | Activated Sludge | MKAKLKIIETSTGFRCRVCGRRFRTEEAAFVHQSYDCSQN |
| Ga0302237_10884193 | 3300028640 | Activated Sludge | MKAKLKIEELPAGYRCRVCGRRFRTEEAAFVHQSYDCS |
| Ga0302238_11303483 | 3300028644 | Activated Sludge | MKVKQKIIETRAGFRCRVCDRRFRTEEAAFYHQARDC |
| ⦗Top⦘ |