


| Basic Information | |
|---|---|
| Family ID | F054757 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 47 residues |
| Representative Sequence | GYRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.72 % |
| % of genes near scaffold ends (potentially truncated) | 99.28 % |
| % of genes from short scaffolds (< 2000 bps) | 88.49 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.281 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (36.691 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.029 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (69.065 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 57.78% Coil/Unstructured: 42.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF09969 | DUF2203 | 67.63 |
| PF05635 | 23S_rRNA_IVP | 16.55 |
| PF13424 | TPR_12 | 2.88 |
| PF13174 | TPR_6 | 1.44 |
| PF13181 | TPR_8 | 1.44 |
| PF13414 | TPR_11 | 0.72 |
| PF01134 | GIDA | 0.72 |
| PF00730 | HhH-GPD | 0.72 |
| PF13176 | TPR_7 | 0.72 |
| PF10576 | EndIII_4Fe-2S | 0.72 |
| PF00005 | ABC_tran | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.72 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.72 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.72 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.72 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.28 % |
| Unclassified | root | N/A | 0.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10200432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 534 | Open in IMG/M |
| 3300002908|JGI25382J43887_10345862 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 632 | Open in IMG/M |
| 3300005174|Ga0066680_10204581 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300005174|Ga0066680_10253906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1118 | Open in IMG/M |
| 3300005175|Ga0066673_10191652 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1161 | Open in IMG/M |
| 3300005176|Ga0066679_10156269 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300005178|Ga0066688_10018456 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3640 | Open in IMG/M |
| 3300005179|Ga0066684_10004527 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 6129 | Open in IMG/M |
| 3300005179|Ga0066684_10797577 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 624 | Open in IMG/M |
| 3300005180|Ga0066685_10156089 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1554 | Open in IMG/M |
| 3300005186|Ga0066676_10139175 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300005187|Ga0066675_10039772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2828 | Open in IMG/M |
| 3300005187|Ga0066675_10516982 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 893 | Open in IMG/M |
| 3300005406|Ga0070703_10170937 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 832 | Open in IMG/M |
| 3300005434|Ga0070709_10255385 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300005446|Ga0066686_11084390 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 515 | Open in IMG/M |
| 3300005450|Ga0066682_10313255 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300005451|Ga0066681_10338292 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 924 | Open in IMG/M |
| 3300005468|Ga0070707_102009867 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 545 | Open in IMG/M |
| 3300005518|Ga0070699_100197480 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1788 | Open in IMG/M |
| 3300005540|Ga0066697_10187759 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300005552|Ga0066701_10398749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 851 | Open in IMG/M |
| 3300005553|Ga0066695_10412075 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 836 | Open in IMG/M |
| 3300005553|Ga0066695_10859692 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
| 3300005555|Ga0066692_10443037 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005560|Ga0066670_10824565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 563 | Open in IMG/M |
| 3300005560|Ga0066670_11030217 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
| 3300005568|Ga0066703_10678188 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 594 | Open in IMG/M |
| 3300005574|Ga0066694_10399655 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 646 | Open in IMG/M |
| 3300005574|Ga0066694_10444598 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 607 | Open in IMG/M |
| 3300005575|Ga0066702_10962315 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
| 3300005576|Ga0066708_10425957 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 851 | Open in IMG/M |
| 3300005586|Ga0066691_10249767 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1041 | Open in IMG/M |
| 3300005586|Ga0066691_10699894 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 599 | Open in IMG/M |
| 3300005598|Ga0066706_10361910 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300005598|Ga0066706_10931452 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 674 | Open in IMG/M |
| 3300005895|Ga0075277_1028709 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 803 | Open in IMG/M |
| 3300006034|Ga0066656_10757227 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 623 | Open in IMG/M |
| 3300006046|Ga0066652_100721715 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300006755|Ga0079222_10848158 | Not Available | 756 | Open in IMG/M |
| 3300006791|Ga0066653_10130117 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300006794|Ga0066658_10805422 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
| 3300006796|Ga0066665_11088389 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 609 | Open in IMG/M |
| 3300006797|Ga0066659_10748172 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 803 | Open in IMG/M |
| 3300006797|Ga0066659_11496429 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006854|Ga0075425_101582747 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 739 | Open in IMG/M |
| 3300006903|Ga0075426_11372898 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006954|Ga0079219_10063754 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1652 | Open in IMG/M |
| 3300006954|Ga0079219_10427608 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 892 | Open in IMG/M |
| 3300009012|Ga0066710_100868080 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1387 | Open in IMG/M |
| 3300009012|Ga0066710_103267460 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 620 | Open in IMG/M |
| 3300009012|Ga0066710_104477040 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009012|Ga0066710_104488250 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300009038|Ga0099829_10608893 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300009137|Ga0066709_100883991 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1301 | Open in IMG/M |
| 3300009137|Ga0066709_101314703 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1059 | Open in IMG/M |
| 3300010140|Ga0127456_1170352 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
| 3300010304|Ga0134088_10030223 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2441 | Open in IMG/M |
| 3300010304|Ga0134088_10250963 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 851 | Open in IMG/M |
| 3300010304|Ga0134088_10299196 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 777 | Open in IMG/M |
| 3300010304|Ga0134088_10369703 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 697 | Open in IMG/M |
| 3300010326|Ga0134065_10165754 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 780 | Open in IMG/M |
| 3300010329|Ga0134111_10251589 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 725 | Open in IMG/M |
| 3300010329|Ga0134111_10392849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 593 | Open in IMG/M |
| 3300010335|Ga0134063_10009143 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3823 | Open in IMG/M |
| 3300010371|Ga0134125_12598233 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 550 | Open in IMG/M |
| 3300010401|Ga0134121_11462582 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 697 | Open in IMG/M |
| 3300011271|Ga0137393_10747336 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300012189|Ga0137388_11512659 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 608 | Open in IMG/M |
| 3300012198|Ga0137364_11188997 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 571 | Open in IMG/M |
| 3300012199|Ga0137383_10489963 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300012202|Ga0137363_11640041 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
| 3300012203|Ga0137399_10521823 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 997 | Open in IMG/M |
| 3300012206|Ga0137380_10025239 | All Organisms → cellular organisms → Bacteria | 5475 | Open in IMG/M |
| 3300012206|Ga0137380_10461833 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1122 | Open in IMG/M |
| 3300012206|Ga0137380_11757716 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
| 3300012207|Ga0137381_10379803 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1232 | Open in IMG/M |
| 3300012207|Ga0137381_11501500 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 565 | Open in IMG/M |
| 3300012211|Ga0137377_10096931 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2789 | Open in IMG/M |
| 3300012211|Ga0137377_11273989 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 665 | Open in IMG/M |
| 3300012211|Ga0137377_11824818 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
| 3300012211|Ga0137377_11924954 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 508 | Open in IMG/M |
| 3300012285|Ga0137370_10876285 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 556 | Open in IMG/M |
| 3300012356|Ga0137371_11133606 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 587 | Open in IMG/M |
| 3300012357|Ga0137384_11245766 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 590 | Open in IMG/M |
| 3300012360|Ga0137375_10991107 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300012683|Ga0137398_10361054 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300012685|Ga0137397_10498784 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300012917|Ga0137395_10391696 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300012922|Ga0137394_10589409 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300012923|Ga0137359_11204637 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300012925|Ga0137419_10608017 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300012930|Ga0137407_12417623 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 502 | Open in IMG/M |
| 3300012944|Ga0137410_10488274 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300012975|Ga0134110_10002805 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 6308 | Open in IMG/M |
| 3300012975|Ga0134110_10154703 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 948 | Open in IMG/M |
| 3300014154|Ga0134075_10358608 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300014157|Ga0134078_10090812 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1127 | Open in IMG/M |
| 3300014166|Ga0134079_10137719 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 972 | Open in IMG/M |
| 3300014166|Ga0134079_10677127 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 523 | Open in IMG/M |
| 3300015358|Ga0134089_10250602 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 724 | Open in IMG/M |
| 3300015359|Ga0134085_10231203 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300015359|Ga0134085_10268228 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 746 | Open in IMG/M |
| 3300017654|Ga0134069_1075944 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1078 | Open in IMG/M |
| 3300017659|Ga0134083_10337323 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 646 | Open in IMG/M |
| 3300018071|Ga0184618_10340556 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 640 | Open in IMG/M |
| 3300018431|Ga0066655_10103144 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300018431|Ga0066655_10508198 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 799 | Open in IMG/M |
| 3300018433|Ga0066667_10637608 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 890 | Open in IMG/M |
| 3300018433|Ga0066667_11702019 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 566 | Open in IMG/M |
| 3300018482|Ga0066669_11234355 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
| 3300020004|Ga0193755_1084267 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300021086|Ga0179596_10273251 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300025922|Ga0207646_10022316 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5833 | Open in IMG/M |
| 3300026296|Ga0209235_1137188 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 999 | Open in IMG/M |
| 3300026301|Ga0209238_1097854 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 998 | Open in IMG/M |
| 3300026301|Ga0209238_1187962 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300026305|Ga0209688_1113685 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 512 | Open in IMG/M |
| 3300026307|Ga0209469_1004075 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 6390 | Open in IMG/M |
| 3300026310|Ga0209239_1131281 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300026313|Ga0209761_1182799 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 948 | Open in IMG/M |
| 3300026314|Ga0209268_1016953 | All Organisms → cellular organisms → Bacteria | 2748 | Open in IMG/M |
| 3300026314|Ga0209268_1170919 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
| 3300026316|Ga0209155_1201459 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 627 | Open in IMG/M |
| 3300026327|Ga0209266_1025673 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3190 | Open in IMG/M |
| 3300026328|Ga0209802_1086165 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1445 | Open in IMG/M |
| 3300026331|Ga0209267_1197052 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 774 | Open in IMG/M |
| 3300026335|Ga0209804_1001563 | All Organisms → cellular organisms → Bacteria | 14758 | Open in IMG/M |
| 3300026342|Ga0209057_1028569 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2972 | Open in IMG/M |
| 3300026343|Ga0209159_1191458 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300026523|Ga0209808_1188459 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 711 | Open in IMG/M |
| 3300026524|Ga0209690_1014022 | All Organisms → cellular organisms → Bacteria | 4194 | Open in IMG/M |
| 3300026524|Ga0209690_1164237 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 785 | Open in IMG/M |
| 3300026528|Ga0209378_1005654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 8090 | Open in IMG/M |
| 3300026537|Ga0209157_1157914 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300027169|Ga0209897_1048326 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300027882|Ga0209590_10273636 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300027882|Ga0209590_10494020 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 791 | Open in IMG/M |
| 3300032180|Ga0307471_102313611 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 36.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.30% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 14.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 12.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.16% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.72% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.72% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_102004322 | 3300002558 | Grasslands Soil | VVTLDTELEGYRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| JGI25382J43887_103458622 | 3300002908 | Grasslands Soil | TPETELTGFKIEQLEETDAHIRSTIVVVDGSKRVVGFIPHPEFIQGIVIVRG* |
| Ga0066680_102045813 | 3300005174 | Soil | TELEGYKIERLDDKDTHIRSTIVVVDGNKRAVGFIPHPEFIQGILIVRE* |
| Ga0066680_102539063 | 3300005174 | Soil | LTGFRIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0066673_101916521 | 3300005175 | Soil | KDTHIRSTIVVVNEDKRVVGFIPHPEFIQGIVIVREVDG* |
| Ga0066679_101562693 | 3300005176 | Soil | GFKIEQLDEKDTHIRSTIVVINPDKRVVGFIPHPEFIQGIVIVRE* |
| Ga0066688_100184564 | 3300005178 | Soil | TGFRIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0066684_100045271 | 3300005179 | Soil | ELTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRG* |
| Ga0066684_107975772 | 3300005179 | Soil | GFKIEQLDEKDTHIRSTIVVVNEDKRVVGFIPHPEFIQGIVIVRGVDG* |
| Ga0066685_101560894 | 3300005180 | Soil | TVVVTPETELTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIARG* |
| Ga0066676_101391751 | 3300005186 | Soil | RIERLDASDSHIRSTIVVVNSDKRVVGFIPHPELIHGIVIVRE* |
| Ga0066675_100397725 | 3300005187 | Soil | PETELTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0066675_105169821 | 3300005187 | Soil | PETELEGFRIEQLDEKDTHIRSTIVVVNQDKRVVGFIPHPEFIQGIVIVRE* |
| Ga0070703_101709371 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LEGYRIERLDEKDTHIRSTIVVVDGNRRVVGFIPHPEFIQGIVIVRE* |
| Ga0070709_102553851 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VVTGETELTGYKIEQLDEKDTHIRSTIVVVDGNKKVIGFIPHPEFIQGIVIVRE* |
| Ga0066686_110843901 | 3300005446 | Soil | TGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIARG* |
| Ga0066682_103132551 | 3300005450 | Soil | EGYRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0066681_103382923 | 3300005451 | Soil | QLDEKDTHIRSTIVVVNEDKRVVGFIPHPEFIQGIVIVRGVDG* |
| Ga0070707_1020098672 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GYRIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0070699_1001974801 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | TLDTELEGYRIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0066697_101877593 | 3300005540 | Soil | ELTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0066701_103987492 | 3300005552 | Soil | DMELDGFRIERLDERDSHIRSTIVVVDHTRRVVGFIPHPEQVEGIKVG* |
| Ga0066695_104120751 | 3300005553 | Soil | VVLTLDTELEGYKIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0066695_108596922 | 3300005553 | Soil | LDTELEGYKIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0066692_104430373 | 3300005555 | Soil | FRIERLDAKDTHIRSTIVVVDGTRRVIGFIPHPEQIDGIVIG* |
| Ga0066670_108245652 | 3300005560 | Soil | GFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRG* |
| Ga0066670_110302171 | 3300005560 | Soil | ELGGFKIEQLDEKDTHIRSTIVVVNEDKRVVGFIPHPEFIQGIVIVREVDG* |
| Ga0066703_106781881 | 3300005568 | Soil | AVVTPDTELDGFRIERLDAKDTHIRSTIVVVDGTRRVIGFIPHPEQVAGIVIG* |
| Ga0066694_103996551 | 3300005574 | Soil | EKDTHIRSTIVVINQDKRVVGFIPHPEFIQGIVIVRGVDG* |
| Ga0066694_104445983 | 3300005574 | Soil | RDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0066702_109623152 | 3300005575 | Soil | LEGYKIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIIIVRE* |
| Ga0066708_104259573 | 3300005576 | Soil | TEVVTLDTELEGYKIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIIIVRE* |
| Ga0066691_102497671 | 3300005586 | Soil | VVTPDTELAGFKIERLDDADTHIRSTIVVVNQDKRVVGFIPHPEFIQGIAIVRE* |
| Ga0066691_106998941 | 3300005586 | Soil | GFRIERLDEHDSHIRSTIVVVDHTRRVVGFIPHPEQIEGIKVG* |
| Ga0066706_103619103 | 3300005598 | Soil | SDSHIRSTIVVVNSDKRVVGFIPHPEFIHGIVIVRE* |
| Ga0066706_109314521 | 3300005598 | Soil | VRTDTAVVTPDTELDGFRIERLDERDSHIRSTIVVVDHTRRVVGFIPHPEQVEGIKVG* |
| Ga0075277_10287093 | 3300005895 | Rice Paddy Soil | EADTHIRATIVVVDGNKRVMGFIPHPEFIQGIVILRK* |
| Ga0066656_107572271 | 3300006034 | Soil | RIERLDEKDTHIRSTIVVVDHTRRVVGFIPHPEQVEGIKVG* |
| Ga0066652_1007217151 | 3300006046 | Soil | LDTELEGYRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0079222_108481581 | 3300006755 | Agricultural Soil | QLDEKDTHIRSTIVVVDGNKKVIGFIPHPEFIQGIVIIRE* |
| Ga0066653_101301173 | 3300006791 | Soil | ELEGYRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0066658_108054221 | 3300006794 | Soil | KIEQLEATDAHIRSTIVVVDGNKKVVGFIPHPEFIQGIVIVRG* |
| Ga0066665_110883893 | 3300006796 | Soil | DTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0066659_107481723 | 3300006797 | Soil | ETHIRSTIVVVNSDKRVVGFIPHPELIHGIVIVRE* |
| Ga0066659_114964292 | 3300006797 | Soil | DEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0075425_1015827473 | 3300006854 | Populus Rhizosphere | DTHIRSTIVVVDGNKKVIGFIPHPEFIQGIVIVRE* |
| Ga0075426_113728982 | 3300006903 | Populus Rhizosphere | ERLDEKDTHIRSTIVVVDGNRRVVGFIPHPEFIQGIVIVRE* |
| Ga0079219_100637541 | 3300006954 | Agricultural Soil | HIRSTIVVVNQDKRVVGFIPHPEFIQGIVIVREPSTNLP* |
| Ga0079219_104276081 | 3300006954 | Agricultural Soil | TVVSPETELAGFKIEQLDEKDTHIRSTIVVVNQDKRVVGFIPHPEFIQGIVIVRE* |
| Ga0066710_1008680801 | 3300009012 | Grasslands Soil | RDTVVVTPETELTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRG |
| Ga0066710_1032674601 | 3300009012 | Grasslands Soil | TLDTELEGYKIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIIIVRE |
| Ga0066710_1044770402 | 3300009012 | Grasslands Soil | EVVMLDTELEGYRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0066710_1044882501 | 3300009012 | Grasslands Soil | EKDTHIRSTIVVVNQDKRVVGFIPHPEFIQGIVIVRE |
| Ga0099829_106088932 | 3300009038 | Vadose Zone Soil | EKDTHIRSTIVVVDENRRVLGFIPHPEFIQGIVIVRESGPSEE* |
| Ga0066709_1008839911 | 3300009137 | Grasslands Soil | KIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIARG* |
| Ga0066709_1013147031 | 3300009137 | Grasslands Soil | TLDTELEGYKIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIIIVRE* |
| Ga0127456_11703521 | 3300010140 | Grasslands Soil | ETELTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0134088_100302231 | 3300010304 | Grasslands Soil | EKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0134088_102509633 | 3300010304 | Grasslands Soil | ETELTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRG* |
| Ga0134088_102991962 | 3300010304 | Grasslands Soil | LDEKDTHIRSTIVVVDGNRRVVAFIPHPEFIQGIVIVRE* |
| Ga0134088_103697031 | 3300010304 | Grasslands Soil | TDTAVVTPDTELDGFRIERLDAKDTHIRSTIVVVDGTRRVIGFIPHPEQVAGIVIG* |
| Ga0134065_101657541 | 3300010326 | Grasslands Soil | THIRSSIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0134111_102515892 | 3300010329 | Grasslands Soil | YRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0134111_103928492 | 3300010329 | Grasslands Soil | TLDTELEGYRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0134063_100091434 | 3300010335 | Grasslands Soil | VVVTPETELTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIARG* |
| Ga0134125_125982332 | 3300010371 | Terrestrial Soil | DKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0134121_114625823 | 3300010401 | Terrestrial Soil | GYRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137393_107473362 | 3300011271 | Vadose Zone Soil | VTLDTELEGYRIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137388_115126592 | 3300012189 | Vadose Zone Soil | LEGYRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137364_111889972 | 3300012198 | Vadose Zone Soil | ERDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137383_104899631 | 3300012199 | Vadose Zone Soil | DTHIRSTIVVLDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137363_116400412 | 3300012202 | Vadose Zone Soil | ELEGYRIERLDDRDTHIRSTLVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137399_105218231 | 3300012203 | Vadose Zone Soil | DTVVMTLDTELEGYRIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137380_100252396 | 3300012206 | Vadose Zone Soil | FRIERLDEKDTHIRSTIVVVDGTRRVVGFIPHPEQVEGIIIG* |
| Ga0137380_104618331 | 3300012206 | Vadose Zone Soil | KDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137380_117577161 | 3300012206 | Vadose Zone Soil | TELEGYRIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPELIQGIVIVRE* |
| Ga0137381_103798033 | 3300012207 | Vadose Zone Soil | VTPETELTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRG* |
| Ga0137381_115015002 | 3300012207 | Vadose Zone Soil | EQLEESDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137377_100969311 | 3300012211 | Vadose Zone Soil | EQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRG* |
| Ga0137377_112739892 | 3300012211 | Vadose Zone Soil | TELTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137377_118248182 | 3300012211 | Vadose Zone Soil | RLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137377_119249542 | 3300012211 | Vadose Zone Soil | TAVVTPDTELDGFRIERLDAKDTHIRSTIVVVDGTRRVIGFIPHPEQVAGIVIG* |
| Ga0137370_108762851 | 3300012285 | Vadose Zone Soil | ERLDEKDTHIRSTIVVVDGNKKVVGFIPHPEFIQGIVIVRE* |
| Ga0137371_111336062 | 3300012356 | Vadose Zone Soil | DTELVGYRIERLDASDTHIRSTIVVVNSDKRVVGFIPHPELIHGIVIVRE* |
| Ga0137384_112457662 | 3300012357 | Vadose Zone Soil | DEKDTHIRSTIVAVNQDKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137375_109911072 | 3300012360 | Vadose Zone Soil | ELTGFRIERLDASDTHIRSTIVVVDRNKRVVGFIPHPELIEGIKIDMG* |
| Ga0137398_103610543 | 3300012683 | Vadose Zone Soil | EGYRIERLDDRDTHIRSTLVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137397_104987841 | 3300012685 | Vadose Zone Soil | EGYRIERLDDKDTHIRSTIVVVDGNKKVVGFIPHPEFIQGIVIVRE* |
| Ga0137395_103916963 | 3300012917 | Vadose Zone Soil | DTELEGYRIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137394_105894093 | 3300012922 | Vadose Zone Soil | DTVVMTLDTELEGYRIERLDDKDTHIRSTIVVVDGNKKVVGFIPHPEFIQGIVIVRE* |
| Ga0137359_112046372 | 3300012923 | Vadose Zone Soil | YRIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137419_106080171 | 3300012925 | Vadose Zone Soil | DTVVLTLDTELEGYRIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0137407_124176231 | 3300012930 | Vadose Zone Soil | VVVTLDTELEGYRIERLDEKDTHIRSTIVVVDGNKKVVGFIPHPEFIQGIVIVRE* |
| Ga0137410_104882741 | 3300012944 | Vadose Zone Soil | LDTELEGYRIERLDDKDTHIRSTIVVVDGNKKVVGFIPHPEFIQGIVIVRE* |
| Ga0134110_100028051 | 3300012975 | Grasslands Soil | EQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGVVIVRG* |
| Ga0134110_101547033 | 3300012975 | Grasslands Soil | RSTIVVVNEDKRVVGFIPHPEFIQGIVIVRGVDG* |
| Ga0134075_103586081 | 3300014154 | Grasslands Soil | YRIERLDEKDTHIRSTIVVVDGNRRVVGFIPHPELIQGIVIVRE* |
| Ga0134078_100908121 | 3300014157 | Grasslands Soil | LDEKDTHIRSTIVVVNEDKRVVGFIPHPEFIQGIVIVREVDG* |
| Ga0134079_101377193 | 3300014166 | Grasslands Soil | DTHIRSTIVVVNQDKRVVGFIPHPEFIQGIVIVRE* |
| Ga0134079_106771271 | 3300014166 | Grasslands Soil | ELGGFRIEQLDEKDTHIRSTIVVINQDKRVVGFIPHPEFIQGIVIVRE* |
| Ga0134089_102506021 | 3300015358 | Grasslands Soil | IEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRG* |
| Ga0134085_102312033 | 3300015359 | Grasslands Soil | RIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0134085_102682283 | 3300015359 | Grasslands Soil | IERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE* |
| Ga0134069_10759441 | 3300017654 | Grasslands Soil | TGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGVVIVRG |
| Ga0134083_103373233 | 3300017659 | Grasslands Soil | TGFRIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0184618_103405561 | 3300018071 | Groundwater Sediment | VVVTLDTELEGYRIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIIIVRE |
| Ga0066655_101031441 | 3300018431 | Grasslands Soil | TGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRG |
| Ga0066655_105081983 | 3300018431 | Grasslands Soil | IERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0066667_106376081 | 3300018433 | Grasslands Soil | TAVVTPDTELDGFRIERLDAKDTHIRSTIVVVDATRRVIGFIPHPEEVAGIVVER |
| Ga0066667_117020191 | 3300018433 | Grasslands Soil | LDEKDTHIRSTIVVVNEDKRVVGFIPHPEFIQGIVIVRGVDG |
| Ga0066669_112343552 | 3300018482 | Grasslands Soil | VTLDTELEGYRIERLDDKDTHIRSTLVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0193755_10842671 | 3300020004 | Soil | TLDTELEGYRIERLDDKDTHIRSTIVVVDGNRKVVGFIPHPEFIQGIVIVRE |
| Ga0179596_102732512 | 3300021086 | Vadose Zone Soil | GYRIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0207646_100223161 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TEVVTLDTELEGYRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0209235_11371883 | 3300026296 | Grasslands Soil | EGYRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0209238_10978543 | 3300026301 | Grasslands Soil | ELTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGVVIVRG |
| Ga0209238_11879622 | 3300026301 | Grasslands Soil | VVVTLETELTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVVVRGVVGKADSKGLRC |
| Ga0209688_11136851 | 3300026305 | Soil | ELEGYKIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0209469_10040757 | 3300026307 | Soil | KIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRT |
| Ga0209239_11312811 | 3300026310 | Grasslands Soil | DTEVVTLETELEGYRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0209761_11827993 | 3300026313 | Grasslands Soil | DTELDGFRIERLDAKDTHIRSTIVVVDGTRRVIGFIPHPEQIDGIVIG |
| Ga0209268_10169535 | 3300026314 | Soil | DTELEGYRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0209268_11709191 | 3300026314 | Soil | EKDTHIRSTIVVINQDKRVVGFIPHPEFIQGIVIVRGVDG |
| Ga0209155_12014592 | 3300026316 | Soil | EVVTLDTELEGYRIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0209266_10256735 | 3300026327 | Soil | LTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRG |
| Ga0209802_10861654 | 3300026328 | Soil | TADTQLTGFRIERLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0209267_11970521 | 3300026331 | Soil | QLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRG |
| Ga0209804_100156316 | 3300026335 | Soil | FKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRG |
| Ga0209057_10285691 | 3300026342 | Soil | DASDSHIRSTIVVVNSDKRVVGFIPHPELIHGIVIVRE |
| Ga0209159_11914582 | 3300026343 | Soil | TPETELTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRG |
| Ga0209808_11884591 | 3300026523 | Soil | EKDTHIRSTIVVINQDKRVVGFIPHPEFIQGIVIVRE |
| Ga0209690_10140225 | 3300026524 | Soil | DEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0209690_11642372 | 3300026524 | Soil | DMELDGFRIERLDERDSHIRSTIVVVDHTRRVVGFIPHPEQVEGIKVG |
| Ga0209378_10056546 | 3300026528 | Soil | ELTGFKIEQLEETDAHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRG |
| Ga0209157_11579141 | 3300026537 | Soil | EVVTLDTELEGYKIERLDEKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0209897_10483261 | 3300027169 | Groundwater Sand | RLDDKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0209590_102736363 | 3300027882 | Vadose Zone Soil | VTLDTELEGYKIERLDDKDTHIRSTIVVVDGNKKVVGFIPHPEFIQGIIIVRE |
| Ga0209590_104940203 | 3300027882 | Vadose Zone Soil | EKDTHIRSTIVVVDGNKRVVGFIPHPEFIQGIVIVRE |
| Ga0307471_1023136112 | 3300032180 | Hardwood Forest Soil | LDDADTHIRSTIVVVNQDKRVVGFIPHPEFIQGIVIVRG |
| ⦗Top⦘ |