


| Basic Information | |
|---|---|
| Family ID | F054695 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGIVI |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.51 % |
| % of genes near scaffold ends (potentially truncated) | 98.56 % |
| % of genes from short scaffolds (< 2000 bps) | 94.96 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.367 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.496 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.849 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.640 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF01568 | Molydop_binding | 18.71 |
| PF13519 | VWA_2 | 5.04 |
| PF04879 | Molybdop_Fe4S4 | 1.44 |
| PF07683 | CobW_C | 0.72 |
| PF05050 | Methyltransf_21 | 0.72 |
| PF05168 | HEPN | 0.72 |
| PF00296 | Bac_luciferase | 0.72 |
| PF03308 | MeaB | 0.72 |
| PF13193 | AMP-binding_C | 0.72 |
| PF13472 | Lipase_GDSL_2 | 0.72 |
| PF00067 | p450 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG0523 | Zinc metallochaperone YeiR/ZagA and related GTPases, G3E family | General function prediction only [R] | 0.72 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.72 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.72 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.72 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.37 % |
| Unclassified | root | N/A | 8.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100205222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1863 | Open in IMG/M |
| 3300005167|Ga0066672_11033372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae | 500 | Open in IMG/M |
| 3300005174|Ga0066680_10793483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 571 | Open in IMG/M |
| 3300005181|Ga0066678_10762394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 642 | Open in IMG/M |
| 3300005434|Ga0070709_11568807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 536 | Open in IMG/M |
| 3300005445|Ga0070708_101326212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 672 | Open in IMG/M |
| 3300005552|Ga0066701_10638286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 645 | Open in IMG/M |
| 3300005575|Ga0066702_10502004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 738 | Open in IMG/M |
| 3300005764|Ga0066903_101091085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1470 | Open in IMG/M |
| 3300005764|Ga0066903_101720562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1195 | Open in IMG/M |
| 3300005902|Ga0075273_10039517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 835 | Open in IMG/M |
| 3300006028|Ga0070717_10165050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1923 | Open in IMG/M |
| 3300006032|Ga0066696_10651834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 680 | Open in IMG/M |
| 3300006032|Ga0066696_11096922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 506 | Open in IMG/M |
| 3300006797|Ga0066659_10714294 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300006800|Ga0066660_10687672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 842 | Open in IMG/M |
| 3300007258|Ga0099793_10126577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1198 | Open in IMG/M |
| 3300009038|Ga0099829_11172424 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300009038|Ga0099829_11551609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300009038|Ga0099829_11766952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 507 | Open in IMG/M |
| 3300009088|Ga0099830_11241753 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300009137|Ga0066709_104262536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300010046|Ga0126384_11640838 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300010046|Ga0126384_11887776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Magnetovibrio → Magnetovibrio blakemorei | 569 | Open in IMG/M |
| 3300010152|Ga0126318_10667599 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300010322|Ga0134084_10127952 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300010360|Ga0126372_10423062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1224 | Open in IMG/M |
| 3300010361|Ga0126378_10340498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1608 | Open in IMG/M |
| 3300011269|Ga0137392_10401945 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1137 | Open in IMG/M |
| 3300011271|Ga0137393_10676302 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300012004|Ga0120134_1107438 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012202|Ga0137363_10929902 | Not Available | 738 | Open in IMG/M |
| 3300012203|Ga0137399_10319304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1286 | Open in IMG/M |
| 3300012205|Ga0137362_10579518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 968 | Open in IMG/M |
| 3300012361|Ga0137360_11173594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
| 3300012922|Ga0137394_11361652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 571 | Open in IMG/M |
| 3300012948|Ga0126375_10529501 | Not Available | 885 | Open in IMG/M |
| 3300012951|Ga0164300_10872723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 566 | Open in IMG/M |
| 3300012958|Ga0164299_10855940 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300012971|Ga0126369_10270093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1685 | Open in IMG/M |
| 3300012977|Ga0134087_10167903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 965 | Open in IMG/M |
| 3300014501|Ga0182024_10540606 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300016270|Ga0182036_10874840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 735 | Open in IMG/M |
| 3300016294|Ga0182041_11069632 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300016294|Ga0182041_11783464 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300016319|Ga0182033_12217603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium | 501 | Open in IMG/M |
| 3300016341|Ga0182035_11253160 | Not Available | 663 | Open in IMG/M |
| 3300016357|Ga0182032_10005158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 6562 | Open in IMG/M |
| 3300016357|Ga0182032_11128471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 673 | Open in IMG/M |
| 3300016387|Ga0182040_11484008 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300016422|Ga0182039_11362643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
| 3300017823|Ga0187818_10560311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300017933|Ga0187801_10372894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300017972|Ga0187781_10735137 | Not Available | 715 | Open in IMG/M |
| 3300018090|Ga0187770_11269786 | Not Available | 596 | Open in IMG/M |
| 3300018482|Ga0066669_12043452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium | 538 | Open in IMG/M |
| 3300020199|Ga0179592_10488213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300020580|Ga0210403_10278539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1371 | Open in IMG/M |
| 3300021086|Ga0179596_10543058 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300021171|Ga0210405_10189504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1630 | Open in IMG/M |
| 3300021377|Ga0213874_10154989 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300021377|Ga0213874_10260032 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300021433|Ga0210391_10988013 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300021439|Ga0213879_10280414 | Not Available | 509 | Open in IMG/M |
| 3300021444|Ga0213878_10198887 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300021475|Ga0210392_10620088 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300021476|Ga0187846_10443960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300021478|Ga0210402_11646171 | Not Available | 569 | Open in IMG/M |
| 3300022717|Ga0242661_1046340 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300025906|Ga0207699_10291831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1137 | Open in IMG/M |
| 3300025918|Ga0207662_10327828 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300025939|Ga0207665_10437172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1002 | Open in IMG/M |
| 3300025939|Ga0207665_10852613 | Not Available | 721 | Open in IMG/M |
| 3300026035|Ga0207703_11690066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300026304|Ga0209240_1178753 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300026319|Ga0209647_1278812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300026508|Ga0257161_1073459 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300026530|Ga0209807_1013316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4048 | Open in IMG/M |
| 3300027545|Ga0209008_1023011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1455 | Open in IMG/M |
| 3300027576|Ga0209003_1110404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium | 522 | Open in IMG/M |
| 3300027603|Ga0209331_1136721 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300027729|Ga0209248_10062545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1136 | Open in IMG/M |
| 3300027768|Ga0209772_10129520 | Not Available | 786 | Open in IMG/M |
| 3300027812|Ga0209656_10263925 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300027874|Ga0209465_10373575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 714 | Open in IMG/M |
| 3300028536|Ga0137415_10687026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 836 | Open in IMG/M |
| 3300030969|Ga0075394_11953620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 769 | Open in IMG/M |
| 3300031546|Ga0318538_10146370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1246 | Open in IMG/M |
| 3300031572|Ga0318515_10647647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium | 560 | Open in IMG/M |
| 3300031573|Ga0310915_11226282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 518 | Open in IMG/M |
| 3300031573|Ga0310915_11254009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300031679|Ga0318561_10795718 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031680|Ga0318574_10349162 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300031713|Ga0318496_10827684 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031723|Ga0318493_10166607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1148 | Open in IMG/M |
| 3300031747|Ga0318502_10195665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1168 | Open in IMG/M |
| 3300031747|Ga0318502_10261497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1012 | Open in IMG/M |
| 3300031751|Ga0318494_10721959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Magnetovibrio → Magnetovibrio blakemorei | 583 | Open in IMG/M |
| 3300031764|Ga0318535_10374350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300031765|Ga0318554_10352221 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300031768|Ga0318509_10808755 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031770|Ga0318521_10090140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1670 | Open in IMG/M |
| 3300031771|Ga0318546_10188398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1405 | Open in IMG/M |
| 3300031777|Ga0318543_10126636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1112 | Open in IMG/M |
| 3300031797|Ga0318550_10496199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 589 | Open in IMG/M |
| 3300031797|Ga0318550_10563605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium | 548 | Open in IMG/M |
| 3300031805|Ga0318497_10143087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1305 | Open in IMG/M |
| 3300031805|Ga0318497_10435414 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300031805|Ga0318497_10731854 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300031846|Ga0318512_10030253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2316 | Open in IMG/M |
| 3300031879|Ga0306919_11367899 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031890|Ga0306925_12023578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300031890|Ga0306925_12061910 | Not Available | 536 | Open in IMG/M |
| 3300031890|Ga0306925_12103762 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031890|Ga0306925_12159957 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031893|Ga0318536_10444381 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300031910|Ga0306923_10041090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5051 | Open in IMG/M |
| 3300031912|Ga0306921_10093191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3482 | Open in IMG/M |
| 3300031912|Ga0306921_11042568 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300031942|Ga0310916_10345767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1263 | Open in IMG/M |
| 3300031946|Ga0310910_10339195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1186 | Open in IMG/M |
| 3300031947|Ga0310909_11276052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300031954|Ga0306926_11096489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 942 | Open in IMG/M |
| 3300031954|Ga0306926_11169456 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300031962|Ga0307479_11233667 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300032051|Ga0318532_10334997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium | 537 | Open in IMG/M |
| 3300032051|Ga0318532_10369646 | Not Available | 509 | Open in IMG/M |
| 3300032055|Ga0318575_10388665 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300032059|Ga0318533_10183282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1493 | Open in IMG/M |
| 3300032067|Ga0318524_10775336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium | 507 | Open in IMG/M |
| 3300032076|Ga0306924_10560237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1296 | Open in IMG/M |
| 3300032261|Ga0306920_101750628 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300032515|Ga0348332_11656057 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300032896|Ga0335075_11235477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium | 645 | Open in IMG/M |
| 3300032898|Ga0335072_11486651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300033134|Ga0335073_10104343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3659 | Open in IMG/M |
| 3300033289|Ga0310914_11295655 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300033977|Ga0314861_0233140 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.16% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.44% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.44% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.44% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.44% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.72% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.72% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.72% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.72% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.72% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1002052223 | 3300002245 | Forest Soil | VLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTG |
| Ga0066672_110333722 | 3300005167 | Soil | MLYLLGGFVILCGVLLLGYLFVNTEPARLARTLKWTGITKPPSR* |
| Ga0066680_107934831 | 3300005174 | Soil | MLYLLGGFAVLSGFLLLVYLFINADPARLARGLKVTGIVIAVLA |
| Ga0066678_107623942 | 3300005181 | Soil | MPLLSLFGGLAILCGLLLLAYLFVNADPARLAQRLKWIGIGV |
| Ga0070709_115688071 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLYLLGGFAVLSGLLLLVYLFVNADPARLARGLKVTGIVIAVVAVATLAV |
| Ga0070708_1013262121 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLYLLGGFAILCGVLLLGYLFVNTEPARLVRTLKWTGIVI |
| Ga0066701_106382862 | 3300005552 | Soil | MLYLVGGFAILGGLLLLVYLFVNADPARLARGLEVTGIVVAVAAVATL |
| Ga0066702_105020042 | 3300005575 | Soil | MPLLSLFGGLAILCGLLLLAYLFVNADPARLAQRLKWIGIG |
| Ga0066903_1010910851 | 3300005764 | Tropical Forest Soil | VLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGIVI |
| Ga0066903_1017205622 | 3300005764 | Tropical Forest Soil | MLYLLGGFAILGGLLMLVYLFVNADPARLARNLKWT |
| Ga0075273_100395171 | 3300005902 | Rice Paddy Soil | MLFLVGGVAILVGLLLLGWLFVNADPARLARGAKWTGI |
| Ga0070717_101650501 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLLSLFGGLAVLGGLLLLAYLFVNADPARLAQRL |
| Ga0066696_106518342 | 3300006032 | Soil | MLLLLGGFAILCGLLLLGYLFVNADPAKLARGLKWG |
| Ga0066696_110969221 | 3300006032 | Soil | MLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGIVMGVLAVATLAIS |
| Ga0066659_107142942 | 3300006797 | Soil | MPLLSLFGGLAILCGLLLLAYLFVNADPARLAQRL |
| Ga0066659_118953741 | 3300006797 | Soil | LLSLFGGLAILCGLLLLAYLFVNADPARLAQRLKWIGIGVAALA |
| Ga0066660_106876722 | 3300006800 | Soil | MLYLLGGFAVLSGFLLLVYLFVNADPARLTRGLKFTGI |
| Ga0099793_101265773 | 3300007258 | Vadose Zone Soil | MLYLVGGFAILGGLLLLVYLFVNADPARLARGLKVTGIVVAVAAVATLAISGRLA |
| Ga0099829_111724241 | 3300009038 | Vadose Zone Soil | MLYLLGGFAILCGLLLLVYLFVNADPARLARIVKWAAVVAAIFAVVALIWSER |
| Ga0099829_115516091 | 3300009038 | Vadose Zone Soil | MLYLLGGFAILIGLLLLGYLFVNADPARLARIVKWAG |
| Ga0099829_117669522 | 3300009038 | Vadose Zone Soil | MIYLLGGFAVLSGFLLLIYLFVNADPARLARGLKVTGIIIAVAAVATLAI |
| Ga0099830_112417531 | 3300009088 | Vadose Zone Soil | MLYLLGGFAVLGGFLLLIYLFVNADPARLARGLKVTGIVIAVV |
| Ga0066709_1042625361 | 3300009137 | Grasslands Soil | MLYLLGGFAILGGLLLLVYLFVNADPARLARGLKVSGIVVAIAAVATLAISGRL |
| Ga0126384_116408381 | 3300010046 | Tropical Forest Soil | MLYLFGGFAILGGLLLLVYLFVNADPARLARGLKVTGIVVAVAAVATLA |
| Ga0126384_118877761 | 3300010046 | Tropical Forest Soil | MLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGIVIAVVAV |
| Ga0126318_106675991 | 3300010152 | Soil | MLFLLGGVVLLGGLLLLVYLFVNADPMRLARNLKW |
| Ga0134084_101279521 | 3300010322 | Grasslands Soil | MPLLSLFGGLAILCGLLLLAYLFVNADPARLAQRLKWIGI |
| Ga0126372_104230623 | 3300010360 | Tropical Forest Soil | MLYLLGGFAILGGLLMLLYLFVNADPARLARNLKWTGITIAGVAIVLLILL |
| Ga0126378_103404981 | 3300010361 | Tropical Forest Soil | MIYVLGGFAVLSGFLMLIYLFVNADPARLARGLKVTGIVIAVLAVATLAV |
| Ga0137392_104019451 | 3300011269 | Vadose Zone Soil | MLYLLGGFAVLSGFLLLIYLFINADPARLARGLKVSGIVIAVLAVATL |
| Ga0137393_106763021 | 3300011271 | Vadose Zone Soil | MLPLLGGFAILIGLLLLGYLFVNADPARLARIVKWTAIVVAV |
| Ga0120134_11074381 | 3300012004 | Permafrost | MLSLLGGFAILIGLLLLGYLFVNADPARLAKIVKWAGIVLAVLAV |
| Ga0137363_109299022 | 3300012202 | Vadose Zone Soil | MLYLLGGFAVLSGFLLLIYLFINADPARLARGLKVSGIVIAV |
| Ga0137399_103193043 | 3300012203 | Vadose Zone Soil | MLYLLGGVAILCGFLLLGYLFVNADPARLAKIVKW |
| Ga0137362_105795181 | 3300012205 | Vadose Zone Soil | MLYLLGGFAVLSGFLLLVYLFINADPARLARGLKVTGIVIAV |
| Ga0137360_111735941 | 3300012361 | Vadose Zone Soil | MLYLLGGFAVLSGFLLLIYLFINADPARLARGLKVSGIVIAVLAVATLAVSGRLAAL |
| Ga0137394_113616522 | 3300012922 | Vadose Zone Soil | MLYLLGGFAVLSGFLLLIYLFINADPARLARGLKVSGIVIAVLAVATLA |
| Ga0126375_105295011 | 3300012948 | Tropical Forest Soil | MVYLLGGFAILGGLLMLVYLFVNADPARLARNLKWTG |
| Ga0164300_108727232 | 3300012951 | Soil | MLYLLGGFAVLSGSLMLVYVFVNADPARLARGLKATGVVIAILAVATLAISGRL |
| Ga0164299_108559402 | 3300012958 | Soil | MLYLLGGFAVLSGFLLLIYLFVNADPARLARGLKVTGIVIAVLAVA |
| Ga0126369_102700931 | 3300012971 | Tropical Forest Soil | MLYLLGGFAVLTGFLLLVYLFVNADPARLARGLKVTGIVIAV |
| Ga0134087_101679031 | 3300012977 | Grasslands Soil | MLFLLGGFAILCGLLLLGYLFVNAEPAKLARNLKWGGLAG |
| Ga0182024_105406063 | 3300014501 | Permafrost | MLYLIGGLAILGGLMLLLYLFINADPAKLATGTKWVLVGLAVAL |
| Ga0182036_108748402 | 3300016270 | Soil | MLYLLGGFALLSGFLMLVYLFVNADPARLARGLKVTGIVIAVLAVATLAIS |
| Ga0182041_110696321 | 3300016294 | Soil | MIYVLGGFAVIVGFLMLVYLFVNADPARLARGLKATGIVIAIFAV |
| Ga0182041_117834642 | 3300016294 | Soil | VLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGIV |
| Ga0182033_122176032 | 3300016319 | Soil | MLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGI |
| Ga0182035_112531602 | 3300016341 | Soil | MLYLVGGFAVLGGFLLLVHLFVNADPARLARNLKWAGIAIGAVAVVA |
| Ga0182032_100051587 | 3300016357 | Soil | MLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKV |
| Ga0182032_111284712 | 3300016357 | Soil | MLYLLGGFALLSGFLMLVYLFVNADPARLARGLKVTGIVIAVLAVATLAISG |
| Ga0182040_114840081 | 3300016387 | Soil | MLYLVGGFAVLGGFLLLVHLFVNADPARLARNLKWAGIAIGAAAIT |
| Ga0182039_113626431 | 3300016422 | Soil | MLYLVGGFAVLGGFLLLVHLFVNADPARLARNLKWAGIAIGAVA |
| Ga0187818_105603112 | 3300017823 | Freshwater Sediment | MLFLLGGVLLLGGFLLLVYLFVNADPVRLARNLKWA |
| Ga0187801_103728941 | 3300017933 | Freshwater Sediment | MLFLLGGVLLLGGFLLLVYLFVNADPVRLARNLKWTGI |
| Ga0187781_107351372 | 3300017972 | Tropical Peatland | MLALVGGVAILVGLLLLVYLFVNANPAKLARGLKW |
| Ga0187770_112697861 | 3300018090 | Tropical Peatland | MIYLLGGFAILSGFLMLIYLFVNADPARLARGLKVTGIVIAVLAVATL |
| Ga0066669_120434522 | 3300018482 | Grasslands Soil | MLYLLGGFAVLGGFLLLVYLFVNADPARLARGLKVTGIIIAVVA |
| Ga0179592_104882131 | 3300020199 | Vadose Zone Soil | MLYLVGGFALLSGFLLLVYLFVNADPARLARGLKVTGVVVAVAA |
| Ga0210403_102785393 | 3300020580 | Soil | MLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKATGIVIAVLAV |
| Ga0179596_105430581 | 3300021086 | Vadose Zone Soil | MPLLSLFGGLAILCGLLLLAYLFVNADPARLAQRLKWIG |
| Ga0210405_101895043 | 3300021171 | Soil | VLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGIVIAVAAVAT |
| Ga0213874_101549892 | 3300021377 | Plant Roots | MLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTAVIIGVVAVATLAI |
| Ga0213874_102600321 | 3300021377 | Plant Roots | MLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGIVI |
| Ga0210391_109880131 | 3300021433 | Soil | MLFLFGGVALLGGFLLLVYLFANADPVRLARNLKWTGIGLAAFAVI |
| Ga0213879_102804142 | 3300021439 | Bulk Soil | MIYLLGGFAILTGFLMLVYLFVNADPARLARGLKVTGI |
| Ga0213878_101988871 | 3300021444 | Bulk Soil | MLFLLGGVVLLVGFLLLVYLFVNADPAKLARNLKWT |
| Ga0210392_106200882 | 3300021475 | Soil | VLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGIVVAVAAFATLAIS |
| Ga0187846_104439602 | 3300021476 | Biofilm | MIYVLGGFAILGGFLMLVYLFVNADPARLARGLKVTGIVIAV |
| Ga0210402_116461712 | 3300021478 | Soil | MLYLLGGFAVLSGFLLLIYLFVNADPARLARGLKVSGIVIAVLAVA |
| Ga0242661_10463401 | 3300022717 | Soil | MLYLLGGFAILSGFLLLVYLFVNADPARLARGLKV |
| Ga0207699_102918313 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGI |
| Ga0207662_103278282 | 3300025918 | Switchgrass Rhizosphere | MLYFLGGFAILCGLLLLGWVFVNTSPARLARVLKWT |
| Ga0207665_104371723 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLYLLGGFAVLSGFLLLIYLFVNADPARLARGLKVTGI |
| Ga0207665_108526131 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVT |
| Ga0207703_116900662 | 3300026035 | Switchgrass Rhizosphere | MLQLRGGFGILCGLLLLGWVFVNTSPTVLARVLKWA |
| Ga0209240_11787532 | 3300026304 | Grasslands Soil | MLYLLGGFAILCGVLLLGYLFVNAEPARLARILKWSGIVVAGL |
| Ga0209647_12788121 | 3300026319 | Grasslands Soil | MLFLLGGFAILCGVLLLGYLFVNADPAKLARTVKWAGLGGGVV |
| Ga0257161_10734592 | 3300026508 | Soil | MLYLLGGFAILCGVLLLGYLFVNTEPARLARTLKWTG |
| Ga0209807_10133161 | 3300026530 | Soil | MPLLSLFGGLAILCGLLLLAYLFVNADPARLAQRLKWI |
| Ga0209008_10230113 | 3300027545 | Forest Soil | MLAVLGGVTILAGLLLLIYLFVNADPAKLARGLKWT |
| Ga0209003_11104041 | 3300027576 | Forest Soil | MLYLLGGFAVLSGFLLLVYLFVNADPARLARLLNDPAR |
| Ga0209331_11367212 | 3300027603 | Forest Soil | MLYLIGGFAILGGLLLLVYLFVNADPARLARGLKVSGIVVA |
| Ga0209248_100625453 | 3300027729 | Bog Forest Soil | MLYFLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGIVIAVLAVATLA |
| Ga0209772_101295202 | 3300027768 | Bog Forest Soil | MLPLLGGFAILCGLLLLGYLFVNANPTRLARIVKWGG |
| Ga0209656_102639252 | 3300027812 | Bog Forest Soil | MLYLLGGFAVLGGFLLLVYLFVNADPARLARGLKVTGIVIA |
| Ga0209465_103735751 | 3300027874 | Tropical Forest Soil | MIYVLGGFAILGGFLLLVYLFVNADPARLARGLKVTGIV |
| Ga0137415_106870262 | 3300028536 | Vadose Zone Soil | MLYLLGGFAVLSGFLLLIYLFVNADPARLARGLKVSGIVIAVLAVATLAVSG |
| Ga0075394_119536201 | 3300030969 | Soil | MLYLIGGFAILGGFLLLVYLFVNADPARLARGLKVTGIVIAVLAVVTLAIS |
| Ga0318538_101463703 | 3300031546 | Soil | MLYVLGGFALLSGFLMLVYLFVNADPARLARGLKVTGIVIAI |
| Ga0318515_106476471 | 3300031572 | Soil | MIYVLGGFAVLGGFLMLVYLFVNADPARLARGLKATGIVIAI |
| Ga0310915_112262821 | 3300031573 | Soil | MIYVLGGFAVLGGFLMLVYLFVNADPARLARGLKVTGIVIAVLAVATLAISGR |
| Ga0310915_112540092 | 3300031573 | Soil | MLYVLGGFALLSGFLMLVYLFVNADPARLARGLKVTGIVIA |
| Ga0318561_107957181 | 3300031679 | Soil | MLYLLGGFAILGGLLMLVYLFVNADPTRLARNLKWTG |
| Ga0318574_103491622 | 3300031680 | Soil | MLYLLGGFALLSGFLMLVYLFVNADPARLARGLKVTGIVIAV |
| Ga0318496_108276842 | 3300031713 | Soil | MIYVLGGFAVLGGFLMLVYLFVNADPARLARGLKATGIVIAILA |
| Ga0318493_101666071 | 3300031723 | Soil | MLYLLGGFALLSGFLMLVYLFVNADPARLARGLKVT |
| Ga0318502_101956651 | 3300031747 | Soil | MLFLLGGLAILGGFLLLVYLFANADPARLARNLKWAGIAVAAVAV |
| Ga0318502_102614973 | 3300031747 | Soil | MLYVLGGFALLSGFLMLVYLFVNADPARLARGLNV |
| Ga0318494_107219591 | 3300031751 | Soil | MLYLLGGFAILGGLLMLVYLFVNADPARLARNLKWTGITIAGVAIV |
| Ga0318535_103743501 | 3300031764 | Soil | MIYVLGGFAVLSGFLMLVYLFVNADPVRLARGLKVTGIVIAVLAVATLAIS |
| Ga0318554_103522212 | 3300031765 | Soil | MLYLIGGFAVLGGFLLLVHLFVNADPARLARNLKWAGIAVGAVAV |
| Ga0318509_108087552 | 3300031768 | Soil | MIYVLGGFAVLSGFLMLVYLFVNADPVRLARGLKVTG |
| Ga0318521_100901401 | 3300031770 | Soil | MLYVLGGFALLSGFLMLVYLFVNADPARLARGLKVTG |
| Ga0318546_101883983 | 3300031771 | Soil | MLYFLGGFAVLGGFLLLIYLFVNADPARLARGLKVTGIVIAVLAV |
| Ga0318543_101266361 | 3300031777 | Soil | MLYVLGGFALLSGFLMLVYLFVNADPARLARGLKVT |
| Ga0318550_104961991 | 3300031797 | Soil | MLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGVVIAVLAVATLAI |
| Ga0318550_105636052 | 3300031797 | Soil | MLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKVTGIVIAVVAVA |
| Ga0318497_101430873 | 3300031805 | Soil | MLYLLGGFAILGGLLMLVYLFVNADPTRLARNLKWTGIT |
| Ga0318497_104354142 | 3300031805 | Soil | MLYLLGGFAVLGGFLLLIYLFVNADPARLARGLKVTGIVIAVLA |
| Ga0318497_107318542 | 3300031805 | Soil | MLFLLGGLAILGGFLLLVYLFANADPARLARNLKWASIAVAAVA |
| Ga0318512_100302533 | 3300031846 | Soil | MLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGVVIAVLA |
| Ga0306919_113678991 | 3300031879 | Soil | MIYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGIVI |
| Ga0306925_120235782 | 3300031890 | Soil | MLYLVGGFAVLGGFLLLVYLFVNADPARLARNLKWAGIAVAAVVVIAVILL |
| Ga0306925_120619101 | 3300031890 | Soil | MIYLLGGFAILCGFLLLVYLFVNADPAHLEAAGEA |
| Ga0306925_121037622 | 3300031890 | Soil | MLYLLGGFALLGGFLLLVHLFVNADPARLARNLKWAGIAIG |
| Ga0306925_121599572 | 3300031890 | Soil | MIYVLGGFAVLSGFLMLVYLFVNADPVRLARGLKVTGI |
| Ga0318536_104443812 | 3300031893 | Soil | MLYVLGGFALLSGFLMLVYLFVNADPARLARGLKVTGIVI |
| Ga0306923_100410901 | 3300031910 | Soil | MLYVLGGFALLSGFLMLVYLFVNADPARLARGLKV |
| Ga0306921_100931911 | 3300031912 | Soil | MLYLLGGFAVLGGFLLLIYLFVNADPARLARGLKVTG |
| Ga0306921_110425683 | 3300031912 | Soil | MLYLLGGFAVLSGFLLLVYLFVNADPARLARGLKIT |
| Ga0310916_103457671 | 3300031942 | Soil | MIYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGIVIAVLAVATL |
| Ga0310910_103391953 | 3300031946 | Soil | MLYLLGGFALLSGFLMLVYLFVNADPARLARGLKVTGIV |
| Ga0310909_112760521 | 3300031947 | Soil | MLYLLGGFAVLGGFLLLIYLFVNADPARLARGLKVTGIVIAVL |
| Ga0306926_110964891 | 3300031954 | Soil | MLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGVVIA |
| Ga0306926_111694562 | 3300031954 | Soil | MLYLVGGFAVLGGFLLLVHLFVNADPARLARNLKWAAIAVGGVAV |
| Ga0307479_112336671 | 3300031962 | Hardwood Forest Soil | MLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGIVIAVA |
| Ga0318532_103349971 | 3300032051 | Soil | MIYVLGGFAVIVGFLMLVYLFVNADPARLARGLKATGIVIAIFAVAT |
| Ga0318532_103696462 | 3300032051 | Soil | LPELLLLGGFAILCGLLLLGYLFVNADPARLARVLKWTGIVLGA |
| Ga0318575_103886651 | 3300032055 | Soil | MLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVTGIVI |
| Ga0318533_101832823 | 3300032059 | Soil | MLYLLGGFAVLTGFLLLVYLFVNADPARLARGLKVSGI |
| Ga0318524_107753362 | 3300032067 | Soil | MIYVLGGFAVLSGFLMLVYLFVNADPVRLARGLKVTGIVIAVLAVATLA |
| Ga0306924_105602373 | 3300032076 | Soil | MLYLLGGFAVLSGFLMLVYLFVNADPARLARGLKVT |
| Ga0306920_1017506281 | 3300032261 | Soil | MLYLVGGIAVLAGFLLLVQVFVNADPAWLARHLKWTGIAVGAVAV |
| Ga0348332_116560572 | 3300032515 | Plant Litter | MLFLLGGFAVLGGVLLLVYLFANADPARLARNLKW |
| Ga0335075_112354771 | 3300032896 | Soil | MPELALLGGVLILGGLLLLVYLFVNTDPAKLARALKW |
| Ga0335072_114866512 | 3300032898 | Soil | MLALLGGLLVLAGLLLLVYLFVNADPAKLASGLKWVAIGLA |
| Ga0335073_101043434 | 3300033134 | Soil | MLFLLGGVALLAGFLLLVYSFVNADPVRLARNLKWTGIGIAAVA |
| Ga0310914_112956552 | 3300033289 | Soil | MLYLLGGFAVLSGLLLLVYLFVNADPARLARGLRVTGIVIAVAAVAT |
| Ga0314861_0233140_723_854 | 3300033977 | Peatland | MLALVGGVAILVGLLLLVYLFVNADPAKLARALKWTAIGAAGLI |
| ⦗Top⦘ |