


| Basic Information | |
|---|---|
| Family ID | F054286 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MATAEAKLHVSEFTNEPFIDFSNAENRKRMEAALAKV |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.14 % |
| % of genes near scaffold ends (potentially truncated) | 99.29 % |
| % of genes from short scaffolds (< 2000 bps) | 89.29 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.286 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.286 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.08% β-sheet: 0.00% Coil/Unstructured: 76.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF03544 | TonB_C | 5.71 |
| PF00202 | Aminotran_3 | 5.71 |
| PF05899 | Cupin_3 | 4.29 |
| PF03551 | PadR | 2.86 |
| PF05960 | DUF885 | 2.86 |
| PF04255 | DUF433 | 2.14 |
| PF10077 | DUF2314 | 2.14 |
| PF00583 | Acetyltransf_1 | 2.14 |
| PF08238 | Sel1 | 1.43 |
| PF00903 | Glyoxalase | 1.43 |
| PF00578 | AhpC-TSA | 1.43 |
| PF06146 | PsiE | 1.43 |
| PF00753 | Lactamase_B | 1.43 |
| PF01878 | EVE | 1.43 |
| PF01925 | TauE | 0.71 |
| PF00072 | Response_reg | 0.71 |
| PF11146 | DUF2905 | 0.71 |
| PF13432 | TPR_16 | 0.71 |
| PF13376 | OmdA | 0.71 |
| PF12680 | SnoaL_2 | 0.71 |
| PF01593 | Amino_oxidase | 0.71 |
| PF13545 | HTH_Crp_2 | 0.71 |
| PF08388 | GIIM | 0.71 |
| PF01850 | PIN | 0.71 |
| PF01571 | GCV_T | 0.71 |
| PF04140 | ICMT | 0.71 |
| PF12852 | Cupin_6 | 0.71 |
| PF13289 | SIR2_2 | 0.71 |
| PF13444 | Acetyltransf_5 | 0.71 |
| PF02517 | Rce1-like | 0.71 |
| PF07719 | TPR_2 | 0.71 |
| PF01268 | FTHFS | 0.71 |
| PF00069 | Pkinase | 0.71 |
| PF13442 | Cytochrome_CBB3 | 0.71 |
| PF07927 | HicA_toxin | 0.71 |
| PF10518 | TAT_signal | 0.71 |
| PF01476 | LysM | 0.71 |
| PF00561 | Abhydrolase_1 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 5.71 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.86 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 2.86 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.86 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.86 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 2.86 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 2.14 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 1.43 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 1.43 |
| COG3223 | Phosphate starvation-inducible membrane PsiE (function unknown) | General function prediction only [R] | 1.43 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.71 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.71 |
| COG2759 | Formyltetrahydrofolate synthetase | Nucleotide transport and metabolism [F] | 0.71 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.29 % |
| Unclassified | root | N/A | 20.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0957920 | Not Available | 649 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101160953 | Not Available | 630 | Open in IMG/M |
| 3300001174|JGI12679J13547_1005205 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101117244 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300004152|Ga0062386_100164963 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300004152|Ga0062386_101547848 | Not Available | 553 | Open in IMG/M |
| 3300005179|Ga0066684_10590242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 746 | Open in IMG/M |
| 3300005447|Ga0066689_10570928 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005537|Ga0070730_10648083 | Not Available | 672 | Open in IMG/M |
| 3300005541|Ga0070733_10607990 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005556|Ga0066707_10503335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 786 | Open in IMG/M |
| 3300005557|Ga0066704_10825242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Ectobacillus → Ectobacillus panaciterrae | 576 | Open in IMG/M |
| 3300005602|Ga0070762_10748342 | Not Available | 658 | Open in IMG/M |
| 3300005610|Ga0070763_10953265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → unclassified Paenibacillus → Paenibacillus sp. A9 | 512 | Open in IMG/M |
| 3300005921|Ga0070766_11224227 | Not Available | 520 | Open in IMG/M |
| 3300005993|Ga0080027_10028625 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
| 3300006034|Ga0066656_10805429 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300006173|Ga0070716_100556660 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300006791|Ga0066653_10614591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 553 | Open in IMG/M |
| 3300006797|Ga0066659_11414193 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300006852|Ga0075433_11468795 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300007265|Ga0099794_10350359 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300009038|Ga0099829_10064534 | All Organisms → cellular organisms → Bacteria | 2759 | Open in IMG/M |
| 3300009088|Ga0099830_10281946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1322 | Open in IMG/M |
| 3300009088|Ga0099830_11509600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300009089|Ga0099828_11211273 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300009143|Ga0099792_10480016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300010159|Ga0099796_10586371 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010321|Ga0134067_10005362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3419 | Open in IMG/M |
| 3300010358|Ga0126370_10125553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1828 | Open in IMG/M |
| 3300010360|Ga0126372_11695283 | Not Available | 673 | Open in IMG/M |
| 3300010361|Ga0126378_10571000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
| 3300010366|Ga0126379_11890207 | Not Available | 700 | Open in IMG/M |
| 3300010376|Ga0126381_103495346 | Not Available | 617 | Open in IMG/M |
| 3300011269|Ga0137392_10612216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
| 3300011271|Ga0137393_10238103 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300012096|Ga0137389_10973924 | Not Available | 727 | Open in IMG/M |
| 3300012096|Ga0137389_11615997 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012200|Ga0137382_11168969 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012202|Ga0137363_11036159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300012203|Ga0137399_10983782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300012206|Ga0137380_11182262 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300012349|Ga0137387_11017736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300012351|Ga0137386_10373242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
| 3300012357|Ga0137384_10148721 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300012361|Ga0137360_10880576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 772 | Open in IMG/M |
| 3300012363|Ga0137390_11315185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 668 | Open in IMG/M |
| 3300012923|Ga0137359_11714080 | Not Available | 516 | Open in IMG/M |
| 3300012927|Ga0137416_10554537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300012929|Ga0137404_10298042 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300012930|Ga0137407_10589204 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300012930|Ga0137407_10786511 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300012960|Ga0164301_11874423 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012961|Ga0164302_11902037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300012975|Ga0134110_10049713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1653 | Open in IMG/M |
| 3300014153|Ga0181527_1213669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300014164|Ga0181532_10185206 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300014169|Ga0181531_10119863 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300015264|Ga0137403_11329287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300016294|Ga0182041_11798675 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300016422|Ga0182039_12258717 | Not Available | 502 | Open in IMG/M |
| 3300017928|Ga0187806_1313894 | Not Available | 555 | Open in IMG/M |
| 3300017974|Ga0187777_11397102 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300017975|Ga0187782_11208296 | Not Available | 592 | Open in IMG/M |
| 3300018043|Ga0187887_10844508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300018088|Ga0187771_11549355 | Not Available | 562 | Open in IMG/M |
| 3300018090|Ga0187770_10886444 | Not Available | 716 | Open in IMG/M |
| 3300018090|Ga0187770_11623048 | Not Available | 528 | Open in IMG/M |
| 3300020579|Ga0210407_10943954 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300020580|Ga0210403_10005493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10745 | Open in IMG/M |
| 3300020582|Ga0210395_10089437 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300020583|Ga0210401_10006449 | All Organisms → cellular organisms → Bacteria | 11894 | Open in IMG/M |
| 3300020583|Ga0210401_10018116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6792 | Open in IMG/M |
| 3300021088|Ga0210404_10581457 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300021088|Ga0210404_10611638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300021088|Ga0210404_10625384 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300021168|Ga0210406_10029147 | All Organisms → cellular organisms → Bacteria | 5012 | Open in IMG/M |
| 3300021168|Ga0210406_10157412 | All Organisms → cellular organisms → Bacteria | 1904 | Open in IMG/M |
| 3300021170|Ga0210400_10294552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
| 3300021170|Ga0210400_10451530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1060 | Open in IMG/M |
| 3300021170|Ga0210400_10646782 | Not Available | 871 | Open in IMG/M |
| 3300021171|Ga0210405_10544885 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300021178|Ga0210408_10171039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1725 | Open in IMG/M |
| 3300021406|Ga0210386_11119556 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300021407|Ga0210383_11794267 | Not Available | 500 | Open in IMG/M |
| 3300021475|Ga0210392_10126599 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300021478|Ga0210402_11851608 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300021560|Ga0126371_10134802 | Not Available | 2513 | Open in IMG/M |
| 3300021560|Ga0126371_10603202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1247 | Open in IMG/M |
| 3300024330|Ga0137417_1311699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4518 | Open in IMG/M |
| 3300024330|Ga0137417_1479689 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300025419|Ga0208036_1041117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300025914|Ga0207671_10302652 | Not Available | 1263 | Open in IMG/M |
| 3300025916|Ga0207663_11268435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300025929|Ga0207664_11641550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300025939|Ga0207665_10012435 | All Organisms → cellular organisms → Bacteria | 5591 | Open in IMG/M |
| 3300026281|Ga0209863_10046369 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300026309|Ga0209055_1055303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1697 | Open in IMG/M |
| 3300026317|Ga0209154_1166727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300026318|Ga0209471_1143012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| 3300026331|Ga0209267_1066120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1591 | Open in IMG/M |
| 3300026475|Ga0257147_1016228 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300026551|Ga0209648_10477379 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300026557|Ga0179587_11053691 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300027071|Ga0209214_1038571 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300027512|Ga0209179_1116686 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300027574|Ga0208982_1134646 | Not Available | 507 | Open in IMG/M |
| 3300027591|Ga0209733_1006812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2952 | Open in IMG/M |
| 3300027643|Ga0209076_1101601 | Not Available | 816 | Open in IMG/M |
| 3300027671|Ga0209588_1013999 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
| 3300027671|Ga0209588_1023719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1935 | Open in IMG/M |
| 3300027674|Ga0209118_1206687 | Not Available | 527 | Open in IMG/M |
| 3300027768|Ga0209772_10160909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300027795|Ga0209139_10240602 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300027842|Ga0209580_10208495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300027846|Ga0209180_10460469 | Not Available | 716 | Open in IMG/M |
| 3300027846|Ga0209180_10779796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300027857|Ga0209166_10340798 | Not Available | 784 | Open in IMG/M |
| 3300028906|Ga0308309_11459284 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300029636|Ga0222749_10443657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300030862|Ga0265753_1127111 | Not Available | 538 | Open in IMG/M |
| 3300031057|Ga0170834_105337650 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300031057|Ga0170834_105636922 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031231|Ga0170824_117647054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300031561|Ga0318528_10809473 | Not Available | 501 | Open in IMG/M |
| 3300031564|Ga0318573_10279256 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300031682|Ga0318560_10363102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 783 | Open in IMG/M |
| 3300031715|Ga0307476_10076884 | All Organisms → cellular organisms → Bacteria | 2324 | Open in IMG/M |
| 3300031744|Ga0306918_11078605 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300031753|Ga0307477_10206045 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300031754|Ga0307475_11493855 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031770|Ga0318521_10468913 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300031890|Ga0306925_11232289 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300032001|Ga0306922_10048728 | All Organisms → cellular organisms → Bacteria | 4379 | Open in IMG/M |
| 3300032076|Ga0306924_10168251 | All Organisms → cellular organisms → Bacteria | 2514 | Open in IMG/M |
| 3300032091|Ga0318577_10160140 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300032205|Ga0307472_102757618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300032782|Ga0335082_11135620 | Not Available | 648 | Open in IMG/M |
| 3300032783|Ga0335079_10663344 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300033290|Ga0318519_10188339 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.29% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.57% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.43% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027574 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_09579202 | 2228664022 | Soil | MATAEPRLQKPEFVNEPFVDFSKQENRAAMEAALGKVA |
| INPhiseqgaiiFebDRAFT_1011609531 | 3300000364 | Soil | MATAETKLHKTEFTNEPFVDFSRPENRTAMEGALKKV |
| JGI12679J13547_10052051 | 3300001174 | Forest Soil | MATAEAKLHVPEFTNEPFIDFSNAENRKRMETALAKVKAEFG |
| JGIcombinedJ26739_1011172442 | 3300002245 | Forest Soil | MATAEAKLQVPEFTNEPFIDFSNADNRKKMEEALKKVH |
| Ga0062386_1001649633 | 3300004152 | Bog Forest Soil | MATAKAKLKVKEFTNERFIDFSTAANRKKMEQALAKVKAEFG |
| Ga0062386_1015478482 | 3300004152 | Bog Forest Soil | MATAKAKLKVKEFTNEPFIDFSNAANRKKMEQALAKVKAEFG |
| Ga0066684_105902422 | 3300005179 | Soil | MATAEIRLQKPEFVNEAFVDFTRPENRTAMEGALKKVASEFGRE |
| Ga0066689_105709282 | 3300005447 | Soil | MVTVERKIQRGEFSNEPFVNFSMPENRKAMEDALKKVAGE |
| Ga0070730_106480831 | 3300005537 | Surface Soil | MATAEAKLHVAEFTNEPFIDFSNAENRKRMEAALAKVK |
| Ga0070733_106079902 | 3300005541 | Surface Soil | MATAEAKLQVAEFTNEPFVDFSKPENKKAMEEALK |
| Ga0066707_105033352 | 3300005556 | Soil | MATAEVKLKKTEFTNEPFVDFSKPENRAAMEAALKKVAS |
| Ga0066704_108252421 | 3300005557 | Soil | MATAESTIRHTEFTNEPFIDFSKPENRRAMEAALKKVA |
| Ga0070762_107483421 | 3300005602 | Soil | MATAERFHLTEFTNEAFVDFSRPENKSAMEAALAK |
| Ga0070763_109532651 | 3300005610 | Soil | MATAEKTVHVSEFTNETFIDFSKPENRKRMEDALK |
| Ga0070766_112242271 | 3300005921 | Soil | MATAETTLRVGDFINEAFVDFSRPENKAAMEAALK |
| Ga0080027_100286251 | 3300005993 | Prmafrost Soil | MATAGQLQITEFSNEAFVDFTRPENRTAMEAALAKV |
| Ga0066656_108054292 | 3300006034 | Soil | MATAEQKLRVSEFTNEPFVDFSKAENRKAMEEALKKVAGEF |
| Ga0070716_1005566602 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAEAKVQVGEFTNEPFVDFSKAENRVSMEAALKKV |
| Ga0066653_106145912 | 3300006791 | Soil | VATAEQKLPISEFTNEPFIDFSKPENRKRMEDALKK |
| Ga0066659_114141932 | 3300006797 | Soil | MATAEQTVHVSEFTNELFIDFSKPENRSRMEDALKKV |
| Ga0075433_114687952 | 3300006852 | Populus Rhizosphere | MATAEIKLKKTEFTNEPFVDFSKSENRAAMEAALKKVA |
| Ga0099794_103503591 | 3300007265 | Vadose Zone Soil | MATAEQVVHVSEFTNEPFIDFTKPENRARMEEALKKVR |
| Ga0099829_100645343 | 3300009038 | Vadose Zone Soil | MATAEQKLRLPEFSNEPFIDFSEPENRKRMEEALKK |
| Ga0099830_102819462 | 3300009088 | Vadose Zone Soil | MATAETKVQVSEFVNEAFIDFSRPENRKRMEEALA |
| Ga0099830_115096001 | 3300009088 | Vadose Zone Soil | MATAEQIVHVSEFTNEPFIDFTKAENRGRMEEALKKVKAE |
| Ga0099828_112112731 | 3300009089 | Vadose Zone Soil | MATAEQKIHVTEFTNEPFIDFSEPENRKHMEDALKKVPSEFG |
| Ga0099792_104800162 | 3300009143 | Vadose Zone Soil | MATAETKPQVSEFLNEPFIDFSRAENKTRMEEALKKV |
| Ga0099796_105863712 | 3300010159 | Vadose Zone Soil | MATAETKPQVSEFLNEPFIDFSRAENKTRMEEALKKVAAELG |
| Ga0134067_100053621 | 3300010321 | Grasslands Soil | VATAEQKLHLTEFTNEPFIDFSKPENRKRMEDALKK |
| Ga0126370_101255532 | 3300010358 | Tropical Forest Soil | LRRDFTVATAEQKLHISEFTNEPFIDFSKPENRKRMEEALK |
| Ga0126372_116952831 | 3300010360 | Tropical Forest Soil | MATAEAKLHKSDFTKEPYVDCTKAENRASMEAALR |
| Ga0126378_105710002 | 3300010361 | Tropical Forest Soil | MATAEQKLHISEFTNEPFIDFSKPENRKRMEEALKQV |
| Ga0126379_118902071 | 3300010366 | Tropical Forest Soil | MATAEAKLHKTEFTNEPFVDFTTAENRAAMEAALKTV |
| Ga0126381_1034953462 | 3300010376 | Tropical Forest Soil | MATAEVKLQKPEFVNEPFVDFSKSENRAAMEAALKKAAEEF |
| Ga0137392_106122161 | 3300011269 | Vadose Zone Soil | MATAEQVVHVSEFTNEPFIDFTKAENRGRMEEALKKVRG |
| Ga0137393_102381032 | 3300011271 | Vadose Zone Soil | MATAEAKLHVAEFANEPFIDFSNAENRKRMEAALAKVK |
| Ga0137389_109739242 | 3300012096 | Vadose Zone Soil | MVTAEVKIQRGEFANEPFVDFSKPENRKAMEDALKKVA |
| Ga0137389_116159971 | 3300012096 | Vadose Zone Soil | MATAETKLHLLEFTNEPYVDFSKPENRKKMVDALKKVA |
| Ga0137382_111689692 | 3300012200 | Vadose Zone Soil | MATAEQVVHVSEFTNEAFIDFTKADNRARMQEVLKKV |
| Ga0137363_110361591 | 3300012202 | Vadose Zone Soil | LEIEEEGVMATAEQVVHVSEFTNEPFIDFMKAENRARMEEALKKVKAEF |
| Ga0137399_109837822 | 3300012203 | Vadose Zone Soil | MATAEKTLHVSEFTNEPFIDFSKPENRKRMEDALK |
| Ga0137380_111822621 | 3300012206 | Vadose Zone Soil | MATAEQKIHVTEFTNEPFTDFSKPENRARMEEALKKV |
| Ga0137387_110177362 | 3300012349 | Vadose Zone Soil | LQDEEGSVMATAEQVVHVSEFTNEAFIDFTKAENRARMEAAL |
| Ga0137386_103732421 | 3300012351 | Vadose Zone Soil | MATAEQTVHVSEFTNELFIDFSKPENRSRMEDALKKVK |
| Ga0137384_101487213 | 3300012357 | Vadose Zone Soil | MATAETRLQKPEFVNEPFVDFTKAENRAAMEAALKKVAS |
| Ga0137360_108805762 | 3300012361 | Vadose Zone Soil | LEIEEEGVMATAEQVVHVSEFTNEAFIDFTKAENRARMEEALKKVKAEFG |
| Ga0137390_113151852 | 3300012363 | Vadose Zone Soil | MATAEAKLHVAEFANEPFIDFSNAENRKRMEAALAK |
| Ga0137359_117140802 | 3300012923 | Vadose Zone Soil | MATAETRLQKAEFGNEAFMDFTKGENRAAMEATLKKVAAEFGRE |
| Ga0137416_105545371 | 3300012927 | Vadose Zone Soil | MATAEKIVHVSEFTNEPFIDFTKAENRTRMQEALKKVKAE |
| Ga0137404_102980423 | 3300012929 | Vadose Zone Soil | MATAEAKLHVAEFTNEPFIDFSNAENRKRMEAALAKVKA |
| Ga0137407_105892043 | 3300012930 | Vadose Zone Soil | MATAEAKLHVSEFTNEPFIDFSNAENRKRMEAALAKV |
| Ga0137407_107865111 | 3300012930 | Vadose Zone Soil | MATAEQIVHVSEFTNEPFIDFTKAENRTRMQEALKKVKAE |
| Ga0164301_118744231 | 3300012960 | Soil | MATADAKVRVSEFTNEPFVDFSRPENRAAMEAALKKV |
| Ga0164302_119020371 | 3300012961 | Soil | MMATAETKVQVSEFTNEPFLDFSKAENRVPMEAALKKVASE |
| Ga0134110_100497134 | 3300012975 | Grasslands Soil | MATAEKIVHVSEFTNEPFIDFTKPENRTRMEEALKK |
| Ga0181527_12136691 | 3300014153 | Bog | MATAKAKLKVREFTNEPLTDFSNAVNRKKMEKALKK |
| Ga0181532_101852061 | 3300014164 | Bog | MATSKAKLHGHVAEFTNEPFIDFSKPENKKKMEAALKRVRAE |
| Ga0181531_101198631 | 3300014169 | Bog | MLGGNRAMATAEAKLHMSEFANEPFVDFSVPENKRAMEAALAKVAG |
| Ga0137403_113292871 | 3300015264 | Vadose Zone Soil | MATAETKPQVSEFVNEPFIDFSRPENKARMEEALKKVAAE |
| Ga0182041_117986751 | 3300016294 | Soil | MATAEAKITVPEFSNEPFIDFSNADNRKKMEEALKKVAS |
| Ga0182039_122587171 | 3300016422 | Soil | MATAEAKLHKPDFANEPFVDFSKPENRRAMEAALKKVA |
| Ga0187806_13138942 | 3300017928 | Freshwater Sediment | MATAEAKLHVPEFTNEPFIDFSNAENRKRMEAALAK |
| Ga0187777_113971021 | 3300017974 | Tropical Peatland | MATAEAKLHVPEFTNEPFIDFSTPENQKKMEEALKKV |
| Ga0187782_112082961 | 3300017975 | Tropical Peatland | MATSKAKLRGHAREFTNEPFIDFSKPENKKKMEAA |
| Ga0187887_108445082 | 3300018043 | Peatland | MATAKAKLKVKAFTNEPFIDFSNPTNKKKMEQALAKV |
| Ga0187771_115493551 | 3300018088 | Tropical Peatland | MASVDTKVQLPEFTNEPFINFSGAENRKRMEDALKKVA |
| Ga0187770_108864441 | 3300018090 | Tropical Peatland | MATAKGKVQVREFRNEPLTDFSNVANRKKMEKALKKVA |
| Ga0187770_116230482 | 3300018090 | Tropical Peatland | MATVEPKVQRPEFANEPFIDFSSAENRKRMEEALKKV |
| Ga0210407_109439541 | 3300020579 | Soil | MGTAEAKLHVAEFTNEPFIDFSNAENRKRMEAALAKVK |
| Ga0210403_100054931 | 3300020580 | Soil | MATAEAKIHVSEFSNEPFIDFSKPENRKAMEDALKKVAS |
| Ga0210395_100894371 | 3300020582 | Soil | MATAEAKIHVSEFSNEPFIDFSKPENRKAMEDALKKV |
| Ga0210401_100064491 | 3300020583 | Soil | MATAEAKLHVPEFTNEPFIDFSNAENRKRMEAALAKVKA |
| Ga0210401_100181167 | 3300020583 | Soil | MATAEAKLHVPEFTNEPFIDFSKPDNRKKMEEALK |
| Ga0210404_105814572 | 3300021088 | Soil | MATAETKPQASEFVNEPFIDFSRPENRKRMEEALKKVAG |
| Ga0210404_106116382 | 3300021088 | Soil | MATAEQIVHVSEFANEAFIDFTKAENRSHMEAALKKVKAEFG |
| Ga0210404_106253841 | 3300021088 | Soil | MATAETKVQASEFVNEPFIDFSQPANRSRMEEALKKV |
| Ga0210406_100291477 | 3300021168 | Soil | MATAEAKLHVPEFTNEPFIDFSNAENRKRMEAALAKVK |
| Ga0210406_101574123 | 3300021168 | Soil | MATAEAKLHVAEFTNEPFIDFSNAENRKRMEVALA |
| Ga0210400_102945522 | 3300021170 | Soil | MATAEQIVHVSEFANEAFIDFTKAENRSHMEAALKKVKAEF |
| Ga0210400_104515303 | 3300021170 | Soil | MATAEQVVHVSEFTNEPFIDFTKAENRARMEEALKKVRG |
| Ga0210400_106467821 | 3300021170 | Soil | MATAEAKIHVSEFTNEPFIDFSKPENRKAMEDALKKVATE |
| Ga0210405_105448852 | 3300021171 | Soil | MATAESKLRISEFTNEPFVDFSRRENKRAMEAALKKVEA |
| Ga0210408_101710394 | 3300021178 | Soil | MATAETKIQVSEFTNEPFIDFSKPENRAAMEAALKKVA |
| Ga0210386_111195561 | 3300021406 | Soil | MATAETTVRVSDFANEPFVDFSRPENQAAMAAALKKVAA |
| Ga0210383_117942672 | 3300021407 | Soil | MATAETTIKRPEFTNEAFVDFSRPENKAAMEAALAK |
| Ga0210392_101265991 | 3300021475 | Soil | MATAEAKLHVAEFTNEPFIDFSNAENRKRMEAALVKVKAE |
| Ga0210402_118516082 | 3300021478 | Soil | MATAESKPHVSEFVNEPFIDFSRPENRKRMQEALTKVAG |
| Ga0126371_101348024 | 3300021560 | Tropical Forest Soil | MATADAKVHVTEFTNEPFIDFSNAENRKKMEEALKKVRG |
| Ga0126371_106032021 | 3300021560 | Tropical Forest Soil | MATAEAKITVPEFTNEPFIDFSNAENRKKMEEALKKVA |
| Ga0137417_13116998 | 3300024330 | Vadose Zone Soil | MATAEQTVHVSEFTNEPFIDFSKPENRSRMEAALKKAK |
| Ga0137417_14796891 | 3300024330 | Vadose Zone Soil | MATAEQTVHVSEFTNEPFIDFTKPENRSRMEEALK |
| Ga0208036_10411172 | 3300025419 | Peatland | MATAKAKLKVKEFTNEPFIDFSTAANRKKMEAALAKVKA |
| Ga0207671_103026522 | 3300025914 | Corn Rhizosphere | MGAIMATAEAKLHKTEFTNETFVDFTKAENKAAMEAAL |
| Ga0207663_112684351 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAEAKVQVSEFTNEPFVDFSKAENRASMEAALKKVADELG |
| Ga0207664_116415501 | 3300025929 | Agricultural Soil | MATAETRLQKPEFVNEAFIDFAKAENRAAMEAALKKVASE |
| Ga0207665_100124355 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAETRLQKPEFVNEPFVDFTKAENHAAMEAALKKVA |
| Ga0209863_100463693 | 3300026281 | Prmafrost Soil | MATAGQLQITEFSNEAFVDFTRPENRTAMEAALAKVA |
| Ga0209055_10553031 | 3300026309 | Soil | MATAEKIVHVSEFTNEPFIDFSKPENRTRMQEALK |
| Ga0209154_11667271 | 3300026317 | Soil | MATAEKIVHVSEFTNEPFIDFSKPENRTRMQEALKQGKAEF |
| Ga0209471_11430123 | 3300026318 | Soil | MATAEKIVHVSEFTNEPFIDFSKPENRTRMQEALKK |
| Ga0209267_10661204 | 3300026331 | Soil | MATAEKIVHVSEFTNEPFIDFTKPENRTRMEEALKKV |
| Ga0257147_10162283 | 3300026475 | Soil | MATAETRLQKPEFVNEAFIDFTKAENRAAMEAALKKVAAEF |
| Ga0209648_104773791 | 3300026551 | Grasslands Soil | MATAETKPQVSEFVNEPFIDFSRPENHKRMEEALKKV |
| Ga0179587_110536912 | 3300026557 | Vadose Zone Soil | MATAETRLQKPEFVNEAFIDFTKAENRAAMEAALKKVAA |
| Ga0209214_10385712 | 3300027071 | Forest Soil | MATAETRLQKPEFVNEAFIDFTKAENRAAMEAALK |
| Ga0209179_11166862 | 3300027512 | Vadose Zone Soil | MATAETKPQFSEFVNEPFLDFSRPENRKRMEDALAKVAAEFG |
| Ga0208982_11346462 | 3300027574 | Forest Soil | MATAETTIKRPEFTNEAFVDFSRPENKAAMDAALAKVK |
| Ga0209733_10068121 | 3300027591 | Forest Soil | MATAETKPQVSEFVNEPFIDFSRPENRARMEEALKKVA |
| Ga0209076_11016012 | 3300027643 | Vadose Zone Soil | MATAEQIVHVSEFANEAFIDFTKAENRSHMEAALKKV |
| Ga0209588_10139996 | 3300027671 | Vadose Zone Soil | MATAEQVVHVSEFTNEPFIDFSKAENRGRMEEALKKV |
| Ga0209588_10237195 | 3300027671 | Vadose Zone Soil | MATAEQIVHVSEFTNEPFIDFTKAENRGRMEEALKKVKAEF |
| Ga0209118_12066871 | 3300027674 | Forest Soil | MATAEAKLGLKEFTNEPFVDFSTAENRKKMEEALKQVAS |
| Ga0209772_101609091 | 3300027768 | Bog Forest Soil | MATAETTLHVSEFINEPFVDFSKHENKKSMEEALKK |
| Ga0209139_102406021 | 3300027795 | Bog Forest Soil | MATAETTVRVGDFANEPFVDFSRPENQAAMAAALG |
| Ga0209580_102084952 | 3300027842 | Surface Soil | MATAETKPQASEFVNEPFLDFSRPETRKRMEDALAKL |
| Ga0209180_104604692 | 3300027846 | Vadose Zone Soil | MVTAEVKIQRGEFTNEPFVDFSKPENRKAMEDALKKV |
| Ga0209180_107797962 | 3300027846 | Vadose Zone Soil | MATAEQIVHVSEFTNEPFIDFTKAENRGRMEEALKKVRG |
| Ga0209166_103407982 | 3300027857 | Surface Soil | MATAEAKLHKAEFTNEPFVDFSKPENRAAMEAALKKVA |
| Ga0308309_114592841 | 3300028906 | Soil | MATAEKTVHVSEFTNETFIDFSKPENRKRMEDALKKVKSE |
| Ga0222749_104436571 | 3300029636 | Soil | MATAEQIVQVSEFTNEPFIDFTKGENRSRMEEALKKVKAE |
| Ga0265753_11271112 | 3300030862 | Soil | MATAEAKIQMSEFTNEPFVDFSKLENRKAMEYALKKFAS |
| Ga0170834_1053376501 | 3300031057 | Forest Soil | MATAEAKIHVSEFSNEPFIDFSKSENRKAMEDALKKVA |
| Ga0170834_1056369221 | 3300031057 | Forest Soil | MATAESKIHVSEFTNEPFVDFSKLDNKQAMRAALKKVEAEFG |
| Ga0170824_1176470541 | 3300031231 | Forest Soil | MATAETSLQKSEFVNEPFVDFAKAENRDAMLAALKKV |
| Ga0318528_108094732 | 3300031561 | Soil | MATAEAKITVPEFTNEPFIDFSNAENRKKMEEALKKV |
| Ga0318573_102792563 | 3300031564 | Soil | MATAEVKLPVKEFTNEPFIDFSNAENRKKMEEALKK |
| Ga0318560_103631021 | 3300031682 | Soil | VATAEQTLPISEFTNEPFIDFSKPENRKRMEDALKKV |
| Ga0307476_100768841 | 3300031715 | Hardwood Forest Soil | MATAEAKIQVSEFTNEPFVDFSKPENRKAMEDALKKV |
| Ga0306918_110786051 | 3300031744 | Soil | MATAEAKITVPEFTNEPFIDFSNAENRKKMEEALKK |
| Ga0307477_102060451 | 3300031753 | Hardwood Forest Soil | VATAEQKLHLTEFTNEPFIDFSKPENRKRMEEALKKA |
| Ga0307475_114938552 | 3300031754 | Hardwood Forest Soil | MATAEAKIQVSEFTNEPFVDFSKSENRKATEDALKKVASEF |
| Ga0318521_104689131 | 3300031770 | Soil | MATAEVKLPVKEFTNEPFIDFSNAENRKKMEEALKQV |
| Ga0306925_112322891 | 3300031890 | Soil | MATAEVKLPVKEFTNEPFIDFSNAENRKKMEEALKKV |
| Ga0306922_100487284 | 3300032001 | Soil | MATAEVKLPVKEFTNEPFIDFSNAENRKKMEEALKQ |
| Ga0306924_101682513 | 3300032076 | Soil | VATAEQKPLISEFANEPFIDFSKPENRKRMEDALK |
| Ga0318577_101601403 | 3300032091 | Soil | MATAEAKITVPEFSNEPFIDFSNADNRKKMEEALKKVASE |
| Ga0307472_1027576181 | 3300032205 | Hardwood Forest Soil | MATAETKPQVSEFVNEPFIDFSRPENKARMEEALKKVA |
| Ga0335082_111356202 | 3300032782 | Soil | MATADAKVHVTEFTNEPFIDFSNPDNRKKMEEALRK |
| Ga0335079_106633441 | 3300032783 | Soil | MATAEAKIQMTEFVNEPFVDFSKPENRQAMQAALKKVA |
| Ga0318519_101883393 | 3300033290 | Soil | MATAEVKLPVKEFTNEPFIDFSNAENRKKMEEALKKVSLEFGHE |
| ⦗Top⦘ |