


| Basic Information | |
|---|---|
| Family ID | F054236 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MGHEERFPPTRLSAGCGFRKETIAGMRRNGRDAPI |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 40.94 % |
| % of genes near scaffold ends (potentially truncated) | 82.86 % |
| % of genes from short scaffolds (< 2000 bps) | 83.57 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.714 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (47.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.286 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF08546 | ApbA_C | 4.29 |
| PF04392 | ABC_sub_bind | 2.86 |
| PF00903 | Glyoxalase | 2.86 |
| PF00211 | Guanylate_cyc | 2.86 |
| PF07969 | Amidohydro_3 | 2.14 |
| PF04828 | GFA | 2.14 |
| PF13751 | DDE_Tnp_1_6 | 2.14 |
| PF00536 | SAM_1 | 2.14 |
| PF14234 | DUF4336 | 1.43 |
| PF04632 | FUSC | 1.43 |
| PF07647 | SAM_2 | 1.43 |
| PF08388 | GIIM | 1.43 |
| PF00589 | Phage_integrase | 1.43 |
| PF08241 | Methyltransf_11 | 1.43 |
| PF10518 | TAT_signal | 1.43 |
| PF03466 | LysR_substrate | 1.43 |
| PF13495 | Phage_int_SAM_4 | 1.43 |
| PF00072 | Response_reg | 0.71 |
| PF03976 | PPK2 | 0.71 |
| PF08028 | Acyl-CoA_dh_2 | 0.71 |
| PF13432 | TPR_16 | 0.71 |
| PF06411 | HdeA | 0.71 |
| PF12680 | SnoaL_2 | 0.71 |
| PF01738 | DLH | 0.71 |
| PF03060 | NMO | 0.71 |
| PF13586 | DDE_Tnp_1_2 | 0.71 |
| PF02771 | Acyl-CoA_dh_N | 0.71 |
| PF00486 | Trans_reg_C | 0.71 |
| PF01117 | Aerolysin | 0.71 |
| PF08818 | DUF1801 | 0.71 |
| PF11149 | DUF2924 | 0.71 |
| PF14559 | TPR_19 | 0.71 |
| PF00924 | MS_channel | 0.71 |
| PF13714 | PEP_mutase | 0.71 |
| PF02630 | SCO1-SenC | 0.71 |
| PF00355 | Rieske | 0.71 |
| PF08031 | BBE | 0.71 |
| PF00248 | Aldo_ket_red | 0.71 |
| PF13185 | GAF_2 | 0.71 |
| PF01638 | HxlR | 0.71 |
| PF03092 | BT1 | 0.71 |
| PF01027 | Bax1-I | 0.71 |
| PF13416 | SBP_bac_8 | 0.71 |
| PF06468 | Spond_N | 0.71 |
| PF16655 | PhoD_N | 0.71 |
| PF00797 | Acetyltransf_2 | 0.71 |
| PF07719 | TPR_2 | 0.71 |
| PF13424 | TPR_12 | 0.71 |
| PF13599 | Pentapeptide_4 | 0.71 |
| PF12840 | HTH_20 | 0.71 |
| PF02518 | HATPase_c | 0.71 |
| PF07690 | MFS_1 | 0.71 |
| PF10009 | DUF2252 | 0.71 |
| PF02558 | ApbA | 0.71 |
| PF12833 | HTH_18 | 0.71 |
| PF07885 | Ion_trans_2 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 4.29 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 2.86 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.86 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 2.14 |
| COG1289 | Uncharacterized membrane protein YccC | Function unknown [S] | 1.43 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.43 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.71 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.71 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.71 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.71 |
| COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.71 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.71 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.71 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.71 % |
| Unclassified | root | N/A | 39.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS401DIO56 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300005436|Ga0070713_100188194 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300005560|Ga0066670_10926674 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005610|Ga0070763_10098908 | Not Available | 1468 | Open in IMG/M |
| 3300006057|Ga0075026_100447577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 735 | Open in IMG/M |
| 3300006162|Ga0075030_101165405 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006175|Ga0070712_100093217 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
| 3300006175|Ga0070712_101933904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300006176|Ga0070765_100405233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1273 | Open in IMG/M |
| 3300006176|Ga0070765_101020460 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300006914|Ga0075436_101076590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300009792|Ga0126374_11841493 | Not Available | 507 | Open in IMG/M |
| 3300010046|Ga0126384_11004295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. | 760 | Open in IMG/M |
| 3300010047|Ga0126382_10061030 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
| 3300010162|Ga0131853_10438404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1225 | Open in IMG/M |
| 3300010361|Ga0126378_11722517 | Not Available | 712 | Open in IMG/M |
| 3300010376|Ga0126381_104961266 | Not Available | 511 | Open in IMG/M |
| 3300010398|Ga0126383_10172477 | Not Available | 2045 | Open in IMG/M |
| 3300011120|Ga0150983_14153650 | Not Available | 653 | Open in IMG/M |
| 3300012362|Ga0137361_10204464 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300012971|Ga0126369_10462215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1320 | Open in IMG/M |
| 3300016294|Ga0182041_10170569 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300016294|Ga0182041_11123655 | Not Available | 714 | Open in IMG/M |
| 3300016341|Ga0182035_11556663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
| 3300016371|Ga0182034_10186072 | Not Available | 1594 | Open in IMG/M |
| 3300016371|Ga0182034_11516347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 587 | Open in IMG/M |
| 3300016387|Ga0182040_11689283 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300016404|Ga0182037_10601847 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300016422|Ga0182039_11476840 | Not Available | 619 | Open in IMG/M |
| 3300016445|Ga0182038_10172490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1675 | Open in IMG/M |
| 3300016445|Ga0182038_12030329 | Not Available | 521 | Open in IMG/M |
| 3300020579|Ga0210407_10073458 | Not Available | 2570 | Open in IMG/M |
| 3300020579|Ga0210407_11099527 | Not Available | 602 | Open in IMG/M |
| 3300020580|Ga0210403_11278546 | Not Available | 561 | Open in IMG/M |
| 3300020580|Ga0210403_11283135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300020581|Ga0210399_10204335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1643 | Open in IMG/M |
| 3300020581|Ga0210399_10433752 | Not Available | 1095 | Open in IMG/M |
| 3300020583|Ga0210401_10401393 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300021088|Ga0210404_10395154 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300021168|Ga0210406_10279529 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300021170|Ga0210400_10467775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1040 | Open in IMG/M |
| 3300021170|Ga0210400_10819302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300021170|Ga0210400_11588985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300021178|Ga0210408_10417146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1069 | Open in IMG/M |
| 3300021178|Ga0210408_10697815 | Not Available | 799 | Open in IMG/M |
| 3300021180|Ga0210396_10256160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1555 | Open in IMG/M |
| 3300021180|Ga0210396_10416127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1181 | Open in IMG/M |
| 3300021405|Ga0210387_10640421 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300021406|Ga0210386_10602234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 949 | Open in IMG/M |
| 3300021406|Ga0210386_11668958 | Not Available | 527 | Open in IMG/M |
| 3300021407|Ga0210383_10766272 | Not Available | 827 | Open in IMG/M |
| 3300021475|Ga0210392_10957438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300021475|Ga0210392_11126313 | Not Available | 588 | Open in IMG/M |
| 3300021478|Ga0210402_10766458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 889 | Open in IMG/M |
| 3300021478|Ga0210402_11001414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 762 | Open in IMG/M |
| 3300021478|Ga0210402_11432425 | Not Available | 618 | Open in IMG/M |
| 3300022724|Ga0242665_10307259 | Not Available | 557 | Open in IMG/M |
| 3300025915|Ga0207693_10112864 | All Organisms → cellular organisms → Bacteria | 2132 | Open in IMG/M |
| 3300025915|Ga0207693_11295411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300025916|Ga0207663_10404774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1044 | Open in IMG/M |
| 3300025929|Ga0207664_10799004 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300026330|Ga0209473_1288772 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300026508|Ga0257161_1120917 | Not Available | 549 | Open in IMG/M |
| 3300026550|Ga0209474_10093401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2039 | Open in IMG/M |
| 3300026998|Ga0208369_1001454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1785 | Open in IMG/M |
| 3300026998|Ga0208369_1001523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ai1a-2 | 1754 | Open in IMG/M |
| 3300026999|Ga0207949_1003304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1422 | Open in IMG/M |
| 3300027069|Ga0208859_1003983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1549 | Open in IMG/M |
| 3300027104|Ga0208095_1005267 | Not Available | 878 | Open in IMG/M |
| 3300027874|Ga0209465_10188903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1027 | Open in IMG/M |
| 3300028047|Ga0209526_10013834 | All Organisms → cellular organisms → Bacteria | 5584 | Open in IMG/M |
| 3300028047|Ga0209526_10352499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 985 | Open in IMG/M |
| 3300028047|Ga0209526_10590783 | Not Available | 712 | Open in IMG/M |
| 3300028381|Ga0268264_11576726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300030967|Ga0075399_10025406 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300031231|Ga0170824_102522888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300031231|Ga0170824_111698188 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 945 | Open in IMG/M |
| 3300031231|Ga0170824_116108600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 731 | Open in IMG/M |
| 3300031231|Ga0170824_120420816 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 977 | Open in IMG/M |
| 3300031231|Ga0170824_126041679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1092 | Open in IMG/M |
| 3300031446|Ga0170820_12705989 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 984 | Open in IMG/M |
| 3300031474|Ga0170818_106203921 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300031474|Ga0170818_108115380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300031543|Ga0318516_10259756 | Not Available | 1004 | Open in IMG/M |
| 3300031543|Ga0318516_10500151 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300031549|Ga0318571_10363097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 558 | Open in IMG/M |
| 3300031573|Ga0310915_10659847 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 739 | Open in IMG/M |
| 3300031573|Ga0310915_10694883 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300031680|Ga0318574_10279506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 968 | Open in IMG/M |
| 3300031681|Ga0318572_10514089 | Not Available | 714 | Open in IMG/M |
| 3300031708|Ga0310686_117118819 | Not Available | 1042 | Open in IMG/M |
| 3300031724|Ga0318500_10081163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1444 | Open in IMG/M |
| 3300031724|Ga0318500_10303661 | Not Available | 782 | Open in IMG/M |
| 3300031724|Ga0318500_10345166 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300031736|Ga0318501_10362428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300031751|Ga0318494_10652608 | Not Available | 615 | Open in IMG/M |
| 3300031753|Ga0307477_10089525 | All Organisms → cellular organisms → Bacteria | 2136 | Open in IMG/M |
| 3300031753|Ga0307477_10451963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
| 3300031763|Ga0318537_10247696 | Not Available | 661 | Open in IMG/M |
| 3300031771|Ga0318546_10325613 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300031771|Ga0318546_10647585 | Not Available | 743 | Open in IMG/M |
| 3300031782|Ga0318552_10331767 | Not Available | 774 | Open in IMG/M |
| 3300031819|Ga0318568_10600815 | Not Available | 685 | Open in IMG/M |
| 3300031821|Ga0318567_10374301 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300031832|Ga0318499_10037548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1773 | Open in IMG/M |
| 3300031893|Ga0318536_10497755 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300031910|Ga0306923_10056782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4337 | Open in IMG/M |
| 3300031910|Ga0306923_10138351 | Not Available | 2774 | Open in IMG/M |
| 3300031910|Ga0306923_10775216 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300031912|Ga0306921_10849585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1039 | Open in IMG/M |
| 3300031947|Ga0310909_10747511 | Not Available | 810 | Open in IMG/M |
| 3300031947|Ga0310909_11015023 | Not Available | 677 | Open in IMG/M |
| 3300032010|Ga0318569_10164009 | Not Available | 1025 | Open in IMG/M |
| 3300032052|Ga0318506_10082133 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300032055|Ga0318575_10163691 | Not Available | 1110 | Open in IMG/M |
| 3300032059|Ga0318533_11163122 | Not Available | 565 | Open in IMG/M |
| 3300032076|Ga0306924_10399130 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300032076|Ga0306924_10555052 | Not Available | 1303 | Open in IMG/M |
| 3300032076|Ga0306924_10769369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatitalea → unclassified Desulfatitalea → Desulfatitalea sp. M08but | 1076 | Open in IMG/M |
| 3300032089|Ga0318525_10315782 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 802 | Open in IMG/M |
| 3300032094|Ga0318540_10316508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Sediminicoccus → Sediminicoccus rosea | 753 | Open in IMG/M |
| 3300032180|Ga0307471_100308488 | Not Available | 1673 | Open in IMG/M |
| 3300032180|Ga0307471_101139275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangdongense | 945 | Open in IMG/M |
| 3300032261|Ga0306920_100780633 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300032261|Ga0306920_101368536 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300032261|Ga0306920_102648041 | Not Available | 686 | Open in IMG/M |
| 3300032261|Ga0306920_104281039 | Not Available | 513 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 47.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.14% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.71% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.71% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
| 3300027104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_08298880 | 2189573004 | Grass Soil | MSVFGHEERFPPTRLSAGCGFTKETIAGMRRNGRDAPTP |
| Ga0070713_1001881941 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQKGHEERFPPTRLSAGCGFRKETLAGMRRNGRDAPKAVT |
| Ga0066670_109266741 | 3300005560 | Soil | MTAMGHEERFPPTRLSAGCGFRKETIAGMRRNGRDAPI |
| Ga0070763_100989082 | 3300005610 | Soil | MSQKGHEERFPPTRLSAGCGFSQGTFAGTRGNGRDAPKA |
| Ga0075026_1004475771 | 3300006057 | Watersheds | MTKKGHEERFPPTRLSVGCGFRKETIAGMRRNGRDAP |
| Ga0075030_1011654051 | 3300006162 | Watersheds | MRRSAKGHEERFAPTRLSAGCGFRKETIAGMRRNG |
| Ga0070712_1000932171 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTASGHEERFPPTRLNAGCGFRKETIAGMRRNGRDAP |
| Ga0070712_1019339041 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGMGHEERFPPTRLSAGCGFRKETIAGMRRNGRDA |
| Ga0070765_1004052331 | 3300006176 | Soil | MGHEERFPPTRLSAGCGFRKETIAGMRRNGRDAPI |
| Ga0070765_1010204601 | 3300006176 | Soil | MAAMGHNERFPPTRLSAGYGFRKETIAGMRRNGRDAP |
| Ga0075436_1010765901 | 3300006914 | Populus Rhizosphere | MAASGHEEQFPPTRLSAGCGFRKETIAGMRRNGRDAP |
| Ga0126374_118414931 | 3300009792 | Tropical Forest Soil | VGHDERFLLTRLSAGCSFRKETIAGVRRNGRDAPIADLPAL |
| Ga0126384_110042951 | 3300010046 | Tropical Forest Soil | MAEVGREARFPPARLSGGCGFRKETIAGIRRNGRDAPK |
| Ga0126382_100610304 | 3300010047 | Tropical Forest Soil | MTDVGHEDQFPPPRLSAGCGFRKETFAGAHGNGRAAPK |
| Ga0131853_104384042 | 3300010162 | Termite Gut | MSQTGHEERFPLIRLSVGCGFRKETIAGKRGNDKVAP* |
| Ga0126378_117225172 | 3300010361 | Tropical Forest Soil | MGHEERLPPIRLSAGYGFRKETIAGVRHNERDRTLP |
| Ga0126381_1049612661 | 3300010376 | Tropical Forest Soil | MAGLGHEEWFLPPRLSGGCGFRKGMIAGMCRKGRDAPI |
| Ga0126383_101724771 | 3300010398 | Tropical Forest Soil | IRRSGMGHENSFPPPRLSARYGFKKETIAGVRHNGRNAPKADSP* |
| Ga0150983_141536502 | 3300011120 | Forest Soil | MGHEERFPPTRLSAGCGFRKGTIAGMRRNGRDAPIAATHFLACA |
| Ga0137361_102044642 | 3300012362 | Vadose Zone Soil | MGHEERFPPTKLSDGYGKETIAGMRCNGRDAPIPAV |
| Ga0126369_104622151 | 3300012971 | Tropical Forest Soil | MSFFNKIGHEERFSPPRLSAGCGFRKETIPGTRRNGRVAP* |
| Ga0182041_101705691 | 3300016294 | Soil | HAFFHSLGHEERFPPQRLSAGCGFRKETIAGTRRNERDA |
| Ga0182041_111236552 | 3300016294 | Soil | MTGMAHEERFPLTRLSAGYGFRKETIAGMRRNGRDA |
| Ga0182033_111137631 | 3300016319 | Soil | MAGKGQEERFPPTRLSAGYEFRKETIAEVHHDGRDAPIPGVRRQEGNLSG |
| Ga0182035_115566631 | 3300016341 | Soil | MGHEERFPPIKLSAGCGFRKATIAGMKRCAETGPP |
| Ga0182034_101860721 | 3300016371 | Soil | MTEAGHEEFPPTRLSAGCGFRKETIAGVHRNGRDAPI |
| Ga0182034_105221033 | 3300016371 | Soil | VGQEERFPPTRLSGGYEFRKETIAEVHHDGRDAPIPGVRRQEGNLSG |
| Ga0182034_115163471 | 3300016371 | Soil | AGMGHEERFPPTRLSASCGFRKETIAGARGNNHDASKSSLS |
| Ga0182040_116892832 | 3300016387 | Soil | MPVAELGHEEWFPLTRLSAYCGFRKETIAGTQSNERDA |
| Ga0182037_106018472 | 3300016404 | Soil | LTAALGHKERFPPTRLSAGYGVRKETIVGVRHNGRDAP |
| Ga0182039_114768401 | 3300016422 | Soil | MRHEERFPPTKLSVGCGFRKETIAGMRRNGRDAPILAVRGT |
| Ga0182038_101724903 | 3300016445 | Soil | PHLVIARFARARSGQGYEERFPPTGLSAGYGFRKETIAGTRRYG |
| Ga0182038_120303291 | 3300016445 | Soil | VLRTAGVGHEERFLPSRLSAGFLLRKETIAGRRRNGRDAP |
| Ga0210407_100734585 | 3300020579 | Soil | VTGTGHEERFPATRLSARCGFRKETIAETRCNGRDAPTAVVR |
| Ga0210407_110995271 | 3300020579 | Soil | MVWSRMTQKGHEERFPPTRLSAGCGFRKETLAGMRRNGRDAPIPDLLSL |
| Ga0210403_112785461 | 3300020580 | Soil | RSLKGHEERFPPTRLNAGCGFRKETIAGMRRNGRDAP |
| Ga0210403_112831351 | 3300020580 | Soil | MAGKGHEERFPPTRLSAGCGFRKETIAGMRRNGRDA |
| Ga0210399_102043351 | 3300020581 | Soil | MFTGARSGKGHEERFPPTRLSAGCGFRKETIAGMRRNGRDA |
| Ga0210399_104337522 | 3300020581 | Soil | MGQEERFPPTRLSAGCGFRKETIAGMRRNERDAPMIGLGG |
| Ga0210399_106169892 | 3300020581 | Soil | MAGVGQEERFPPTRLSAGYEFRKETIAEVHHDGRDAPIPGVRRQ |
| Ga0210401_104013932 | 3300020583 | Soil | MGHNERFPPTRLSAGYGFRKETIAGMRRNGRDAPKAAIPSEPTN |
| Ga0210404_103951541 | 3300021088 | Soil | MAGMGHEERFPPTRLSAGCGFRKETIAGMRHNGRD |
| Ga0210406_102795291 | 3300021168 | Soil | MGHEERFPPTRLSAGCGFRKETIAGMRHNGRDAPN |
| Ga0210400_104677752 | 3300021170 | Soil | MAGVGHEEQFRPTRLSAGCGFRKETIAGMGRNARDAPTADIRSARFH |
| Ga0210400_108193021 | 3300021170 | Soil | VGHEERFPPTRLSAGCGFRKETIAGMRRNERAAPIPALRA |
| Ga0210400_115889851 | 3300021170 | Soil | RDGNSTGHEERFPPTRLSAGCGFRKETIAGMRRNGRDAP |
| Ga0210408_104171463 | 3300021178 | Soil | MGHQERFAPPRLSAGCGFRKETIAGLRRNRREAPVADTCQVTT |
| Ga0210408_106978151 | 3300021178 | Soil | MTAVGHEERFPPTRLSAGCGFRKVTIAGMRRNGRDAPI |
| Ga0210396_102561602 | 3300021180 | Soil | MGHEERFPPTRLSAGCGFRKETIAGMRRNGRDAPRAVVQ |
| Ga0210396_104161272 | 3300021180 | Soil | MGHEERFPPTRLSAGCGFRKETIAGMRGNGRDAPIPAVRG |
| Ga0210387_106404214 | 3300021405 | Soil | GARVGIGDEERFPPPQLNIGCRFRKEMIAGMRRNGRDVQ |
| Ga0210386_106022343 | 3300021406 | Soil | MAGVGHEERFPPTRLSAGCGFRKETIAGIRRNGRDAPIPAVRST |
| Ga0210386_116689582 | 3300021406 | Soil | MAEMGHEEQFPPTRLSAGCGFRKETIAGMRRNERDAPIPDLPGLAP |
| Ga0210383_107662723 | 3300021407 | Soil | MSQMGHEERFPPTRLSAGCGFRKETIAGIRRTGRDAP |
| Ga0210392_109574382 | 3300021475 | Soil | MGHEERFPPTRLSAGCGFRKETIAGMRRNGRDAPRAVVQTL |
| Ga0210392_111263132 | 3300021475 | Soil | MGHEERFPPTRLSAGCGFRKETIAGIRRNGRDAPIPAVRSTTM |
| Ga0210402_107664581 | 3300021478 | Soil | MGHEERFPPTRLSAGCGFRKGTIAGMRRNGRDAPIAATHFLA |
| Ga0210402_110014142 | 3300021478 | Soil | MSVFAHEERFPPTRLTAGCGVRKGMIAGMRRNGRDAPMN |
| Ga0210402_114324251 | 3300021478 | Soil | MGHEERFPPTRLSARCGFRKETIAETRCNGRDAPKA |
| Ga0242665_103072592 | 3300022724 | Soil | MFTRARSGKGHEERFPPTRLSAGCGFRKETIAGMRRNGRDAP |
| Ga0207693_101128643 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MGHEERFPPTRPSAGYRFRKETIGGMRRNGRDASIAVIGPPQM |
| Ga0207693_112954111 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGMGHEERFPPTRLSAGCGFRKETIAGMRRNGRDAP |
| Ga0207663_104047742 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | FEATAAMGHEERFPRPKLSAGCGFGKETIAGMRRNGRDAP |
| Ga0207664_107990041 | 3300025929 | Agricultural Soil | MGHEERFPPTRPSAGYRFRKETIGGMRRNGRDAPIAVIGPPQMSA |
| Ga0209473_12887721 | 3300026330 | Soil | PCSFRMFVFGREERFPPTGLSAGYGLRKETIAGMRRNGRDAPMD |
| Ga0257161_11209172 | 3300026508 | Soil | CATLRLYHEEQFPSTRLSAGCGFKKETIAEMRCNGRDAP |
| Ga0209474_100934013 | 3300026550 | Soil | TPCSFRMFVFGREERFPPTGLSAGYGLRKETIAGMRRNGRDAPMD |
| Ga0208369_10014541 | 3300026998 | Forest Soil | HEERFPPTRLSAGCGFRKETIAGMRRNGRDAPTAAIL |
| Ga0208369_10015231 | 3300026998 | Forest Soil | MTGLGHEERFPPTRLSAGCGFRKETIAGMRRNGRDA |
| Ga0207949_10033042 | 3300026999 | Forest Soil | MSAVGHEERFPPTRLSAGCGFRKETIAGIRRNGRDAPEAGVH |
| Ga0208859_10039831 | 3300027069 | Forest Soil | HEERFPPTRLSAGCGFRKETIAGMRRNGRDAPIPAVR |
| Ga0208095_10052671 | 3300027104 | Forest Soil | VTGTGHEERFPATRLSARCGFRKETIAETRCNGRDAPIAVIRAYRP |
| Ga0209465_101889033 | 3300027874 | Tropical Forest Soil | MTEEGHEERFPQTRMSARCGFRKATIAGIRRNGQDAPILDARR |
| Ga0209526_100138341 | 3300028047 | Forest Soil | MTGKRQEERFPPTRLSAGYGFRKETLAGMRRNGRDA |
| Ga0209526_103524992 | 3300028047 | Forest Soil | LGHEERFPPPRLSAGYAFRKETIAGMRRNGRDAPTADISRAS |
| Ga0209526_105907831 | 3300028047 | Forest Soil | VGQEERFPPTRLSVGCGFRKETIAGMRRNGRDAPKAA |
| Ga0268264_115767262 | 3300028381 | Switchgrass Rhizosphere | MTGKRQEERFPPTRLSAGYGFRKETIAGVRHNERDA |
| Ga0075399_100254061 | 3300030967 | Soil | EERFPPTRLSAGCGFRKETIAGMRRNGRDAPIPAARLGGGEVR |
| Ga0170824_1025228881 | 3300031231 | Forest Soil | LGHEERFPQTRMSAGCGFRNETIVGMRRNGRDAPIP |
| Ga0170824_1116981881 | 3300031231 | Forest Soil | MGHKDAFPPTRLSAGCGFRKETIAGRNGRDESIPALS |
| Ga0170824_1161086001 | 3300031231 | Forest Soil | VGHEERFPPTRLNAGCGFRKETIAGMRRNGRDAPKA |
| Ga0170824_1204208161 | 3300031231 | Forest Soil | MGHEEPFPPTRLNAGCGFIKETIAGVRCNGRDAPRAVIPVNAV |
| Ga0170824_1260416791 | 3300031231 | Forest Soil | MAAPGHEERFPPTRLSAGCGFRKETIAGMRRNGRDAPIAAVP |
| Ga0170820_127059891 | 3300031446 | Forest Soil | MSGLGHEERFPPTRLTAACGFRKETIAGMRRNGRDAPIPAVR |
| Ga0170818_1062039213 | 3300031474 | Forest Soil | MTGLGHEERFPPPRLRVGCGFRKETIAGMRRNGRDAPIPDLPG |
| Ga0170818_1081153801 | 3300031474 | Forest Soil | MGHEERFPPTRLSARYGFRKETIAGMRRNGRDGPIPAVRQLTP |
| Ga0318516_102597562 | 3300031543 | Soil | MTEVGHEEFPPTRLSAGCGFRKETIAGVHRNGRDAPISA |
| Ga0318516_105001512 | 3300031543 | Soil | MTGLGHEERFPPTRLSAGCGFRKETIAGTRRNGRDA |
| Ga0318571_103630971 | 3300031549 | Soil | MIEWFRPPRLGVGCEFRKETIAGRRRNGRGAPKAE |
| Ga0318528_101385961 | 3300031561 | Soil | MAVSGHEERFPPTRLNAGYVLRKETIAGVRLDGRDAPIPGVRGV |
| Ga0310915_106598471 | 3300031573 | Soil | MRHEERFPPTKLSVGCGVRKETIAGMRRNGRDAPKA |
| Ga0310915_106948832 | 3300031573 | Soil | MAGVGHEERLPLTGLDAGCGFRKETIAGMRRNWRDGPIADL |
| Ga0318574_102795063 | 3300031680 | Soil | MTAKGHQKRFPLTRLSAGCGFRKETIAGMRRNGRDAP |
| Ga0318572_105140892 | 3300031681 | Soil | MTAKGHQKRFPLTRLSAGCGFRKETIAGMRRNGRD |
| Ga0310686_1171188192 | 3300031708 | Soil | MGHEERFRPTRLSVGCGFRKETIAGMRRNGRDAPIPVIQRSKP |
| Ga0318500_100811633 | 3300031724 | Soil | MTHSGHEERYPPTKLSVGCGFRKETIAGMSRKGRDAPYADLS |
| Ga0318500_103036612 | 3300031724 | Soil | VMAGQGHEERFPPTRLSAGCGFRKETIAGMRRNGRDAPKAAVLTA |
| Ga0318500_103451662 | 3300031724 | Soil | RESASGHQGSFLRQRLSAGCGFGKETIAEMRRDGRDAP |
| Ga0318501_103624282 | 3300031736 | Soil | MAVSGHEERFPPTRLNAGYVLRKETIAGVRLDGRDAPKD |
| Ga0318502_107041492 | 3300031747 | Soil | MAGKGQEERFPPTRLSAGYEFRKETIAEVHHDGRDAPIPGVRRQEGNLS |
| Ga0318492_103317951 | 3300031748 | Soil | VGQEERFPPTRLSGGYEFRKETIAEVHHDGRDAPIPGVR |
| Ga0318494_106526081 | 3300031751 | Soil | MRHEERFPPTKLSVGCGFRKETIAGMRRNGRDAPISDLP |
| Ga0307477_100895253 | 3300031753 | Hardwood Forest Soil | MSAMGHEERFPPTRLSAGYGFRKETIGGMRRTGEMRRVEM |
| Ga0307477_104519631 | 3300031753 | Hardwood Forest Soil | MTGMGQEERFPPTRLSAGCGFRKETIAGMRRNGRDAPFPDARRGE |
| Ga0318537_102476961 | 3300031763 | Soil | MTEVGHEEFPPTRLSAGCGFRKETIAGVHRNGRDAPISAVR |
| Ga0318546_103256131 | 3300031771 | Soil | MAVSGHEERFPPTRLNAGYVLRKETIAGVRLDGRDAPIP |
| Ga0318546_106475852 | 3300031771 | Soil | EWGHKDQFPPHRLSAGFGFRKATIAGTRRNGRDAP |
| Ga0318547_107453221 | 3300031781 | Soil | MAGKGQEERFPPTRLSAGYEFRKETIAEVHHDGRDAPIPGVRRQEGNLSGSG |
| Ga0318552_103317672 | 3300031782 | Soil | MTAKGHQKRFPLTRLSAGCGFRKETIAGMRRNGRDAPKAAICIG |
| Ga0318557_100463563 | 3300031795 | Soil | VGQEERFPPTRLSGGYEFRKETIAEVHHDGRDAPIPGVRRQEGNLS |
| Ga0318523_100847052 | 3300031798 | Soil | VGQEERFPPTRLSGGYEFRKETIAEVHHDGRDAPIPGVRRQEG |
| Ga0318568_106008151 | 3300031819 | Soil | MTEVGHEEFPPTRLSAGCGFRKETIAGVHRNGRDAPISAVRLTTTS |
| Ga0318567_103743011 | 3300031821 | Soil | VSAKGHEERFPPTRLSAGYGFRKETIAGTRRNGRDAP |
| Ga0318499_100375482 | 3300031832 | Soil | MRHEERFPPTKLSVGRGFRKETIAGMRRNGRDAPMSLKK |
| Ga0318536_104977551 | 3300031893 | Soil | MTAVGHEERFPPPGLSAGCGFRKETIAGMRRNGRVAPTAAVR |
| Ga0306923_100567821 | 3300031910 | Soil | MTGMAHEERFPLTRLSAGYGFRKETIAGMRRNGRDAPKTV |
| Ga0306923_101383511 | 3300031910 | Soil | MGHEERFPPTRLNAGYVLRKETIAGVRLDGRDAPIPN |
| Ga0306923_107752161 | 3300031910 | Soil | MGHEERFPQTRVSAGYGFRKETIIGMCRNERDAPLAAVCRDAMMLRDSTR |
| Ga0306921_108495851 | 3300031912 | Soil | VGHEERFPPTRLNAGYVLRKETIAGVRLDGRDAPIP |
| Ga0310910_108043541 | 3300031946 | Soil | MTAQGHEEWFPPSNLSDGFGLRKETVAGRRRNGRDAPKAVVALFRYKL |
| Ga0310909_107475112 | 3300031947 | Soil | MTAKGHQKRFPLTRLSAGCGFRKETIAGMRRNGRDAPKAAICI |
| Ga0310909_110150231 | 3300031947 | Soil | MTGMAHEERFPLTRLSAGYGFRKETIAGMRRNGRDAPKTVA |
| Ga0318569_101640091 | 3300032010 | Soil | QKGHEDPFPPTRLSAGCGFRKETIAGTRRNGRDAP |
| Ga0318506_100821331 | 3300032052 | Soil | MTAKGHQKRFPLTRLSAGCGFRKETIAGMRRNGRDAPKGDIC |
| Ga0318575_101636912 | 3300032055 | Soil | MIGSGHEERFAPSRLSAGFGLRKETIAGRRRNGRDAPIPA |
| Ga0318533_111631221 | 3300032059 | Soil | LEAMTAMGHEERFPPTILGAGYGFRKETIAGMHPNGRDAPIAAVR |
| Ga0318510_103663802 | 3300032064 | Soil | VEREERFPPTRLNAGYVLRKETIAGVRLDGRDAPIPGVRGV |
| Ga0318513_100636881 | 3300032065 | Soil | HGRAGMTDQGHEERFPPPRLNAGCRFRKETIAEIRRNGRDAPKPVIAD |
| Ga0318514_102388732 | 3300032066 | Soil | MRHEERYPPTKLSVGRGFRKETIAGMRRNGRDAPGAAIRPS |
| Ga0306924_103991301 | 3300032076 | Soil | MAGAGHEERFPLIRLSAGYGFGKETIARVRHNGRDAPIP |
| Ga0306924_105550521 | 3300032076 | Soil | MTAKGHQKRFPLTRLSAGCGFRKETIAGMRRNGRDAPKAAICIGIVE |
| Ga0306924_107693693 | 3300032076 | Soil | MGHEERFPPTRLNAGYVLRKETIAGVRLVGRDAPIPNLPP |
| Ga0318525_103157821 | 3300032089 | Soil | MRHEERFPPTKLSVGRGFRKETIAGMRRNGRDAPMS |
| Ga0318540_103165081 | 3300032094 | Soil | REERFPPTGLSAGYGFRKETIAGMRRNGRDAPIPAIRRLI |
| Ga0307471_1003084881 | 3300032180 | Hardwood Forest Soil | LFNGIGHEDPFLQATLSARYGFRKETITGTRRNGRDAPLPA |
| Ga0307471_1011392751 | 3300032180 | Hardwood Forest Soil | MAGMGHEERLPPPRLSARCGFRKETITGMRAATGDGPKAFLPGT |
| Ga0306920_1007806332 | 3300032261 | Soil | LTAALGHKERFPPTRLSAGYGVRKETIVGVRHNGRDAPI |
| Ga0306920_1013685361 | 3300032261 | Soil | LQRGHEERFPPTKLSAGCGFRKETIAGICRNGRDAP |
| Ga0306920_1026480412 | 3300032261 | Soil | MTAKGHQKRFPLTRLSAGCGFRKETIAGMRRNGRDAPTAAIRR |
| Ga0306920_1042810392 | 3300032261 | Soil | EERFPSPRLSAAYGFRKETIAGMPCNGRDAPIAAIPIELT |
| ⦗Top⦘ |