


| Basic Information | |
|---|---|
| Family ID | F054177 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 39 residues |
| Representative Sequence | FGKPTGEFGTVEQANEDDAVVKWDDDGRVRVHQPWLKKV |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 13.57 % |
| % of genes near scaffold ends (potentially truncated) | 85.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.57 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.571 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (10.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF13545 | HTH_Crp_2 | 2.86 |
| PF11737 | DUF3300 | 2.86 |
| PF00210 | Ferritin | 2.86 |
| PF00072 | Response_reg | 2.14 |
| PF07238 | PilZ | 2.14 |
| PF01988 | VIT1 | 2.14 |
| PF05532 | CsbD | 1.43 |
| PF00873 | ACR_tran | 1.43 |
| PF01872 | RibD_C | 1.43 |
| PF00056 | Ldh_1_N | 1.43 |
| PF03401 | TctC | 0.71 |
| PF00106 | adh_short | 0.71 |
| PF00196 | GerE | 0.71 |
| PF02852 | Pyr_redox_dim | 0.71 |
| PF04338 | DUF481 | 0.71 |
| PF08281 | Sigma70_r4_2 | 0.71 |
| PF01569 | PAP2 | 0.71 |
| PF12680 | SnoaL_2 | 0.71 |
| PF07228 | SpoIIE | 0.71 |
| PF01138 | RNase_PH | 0.71 |
| PF04226 | Transgly_assoc | 0.71 |
| PF00665 | rve | 0.71 |
| PF04972 | BON | 0.71 |
| PF16872 | putAbiC | 0.71 |
| PF00589 | Phage_integrase | 0.71 |
| PF13517 | FG-GAP_3 | 0.71 |
| PF01590 | GAF | 0.71 |
| PF09699 | Paired_CXXCH_1 | 0.71 |
| PF01594 | AI-2E_transport | 0.71 |
| PF00076 | RRM_1 | 0.71 |
| PF07676 | PD40 | 0.71 |
| PF00691 | OmpA | 0.71 |
| PF00166 | Cpn10 | 0.71 |
| PF12836 | HHH_3 | 0.71 |
| PF02518 | HATPase_c | 0.71 |
| PF00069 | Pkinase | 0.71 |
| PF08240 | ADH_N | 0.71 |
| PF09537 | DUF2383 | 0.71 |
| PF07690 | MFS_1 | 0.71 |
| PF07519 | Tannase | 0.71 |
| PF00717 | Peptidase_S24 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.86 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 2.14 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 2.14 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.43 |
| COG1486 | Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase | Carbohydrate transport and metabolism [G] | 1.43 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.43 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 1.43 |
| COG0039 | Malate/lactate dehydrogenase | Energy production and conversion [C] | 1.43 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.71 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.71 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.71 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.71 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.71 |
| COG3137 | Putative salt-induced outer membrane protein YdiY | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.71 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.71 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.57 % |
| Unclassified | root | N/A | 6.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_13075289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300001137|JGI12637J13337_1019712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300001471|JGI12712J15308_10026261 | Not Available | 1511 | Open in IMG/M |
| 3300001593|JGI12635J15846_10002813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15187 | Open in IMG/M |
| 3300001593|JGI12635J15846_10561439 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100289672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1522 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100512830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300004631|Ga0058899_12212411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300005439|Ga0070711_101512272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300005536|Ga0070697_100001821 | All Organisms → cellular organisms → Bacteria | 16288 | Open in IMG/M |
| 3300005598|Ga0066706_10815707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300005602|Ga0070762_10038914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2580 | Open in IMG/M |
| 3300005602|Ga0070762_10998397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300005843|Ga0068860_101524230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300005921|Ga0070766_11012424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300005944|Ga0066788_10055372 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300005995|Ga0066790_10213933 | Not Available | 823 | Open in IMG/M |
| 3300005995|Ga0066790_10498365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300006028|Ga0070717_10749364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300006041|Ga0075023_100181368 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300006052|Ga0075029_100315193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300006059|Ga0075017_101264431 | Not Available | 579 | Open in IMG/M |
| 3300006086|Ga0075019_10181918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1239 | Open in IMG/M |
| 3300006102|Ga0075015_100051510 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
| 3300006176|Ga0070765_101924405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300006893|Ga0073928_10002675 | All Organisms → cellular organisms → Bacteria | 29963 | Open in IMG/M |
| 3300006893|Ga0073928_10008361 | All Organisms → cellular organisms → Bacteria | 13039 | Open in IMG/M |
| 3300006893|Ga0073928_11082340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300006903|Ga0075426_11295135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 553 | Open in IMG/M |
| 3300007255|Ga0099791_10403222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300009176|Ga0105242_11831513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300009519|Ga0116108_1012130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3175 | Open in IMG/M |
| 3300009519|Ga0116108_1137050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300009524|Ga0116225_1398707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300009547|Ga0116136_1111413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300009629|Ga0116119_1018066 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300009700|Ga0116217_10588175 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300009762|Ga0116130_1089940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 963 | Open in IMG/M |
| 3300009764|Ga0116134_1297654 | Not Available | 555 | Open in IMG/M |
| 3300009824|Ga0116219_10813119 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009839|Ga0116223_10741119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300010341|Ga0074045_10480318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300010876|Ga0126361_10433197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300011120|Ga0150983_12086546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300011120|Ga0150983_16610361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300012917|Ga0137395_10751865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300012924|Ga0137413_11761691 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012961|Ga0164302_11577723 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012986|Ga0164304_11340859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300012989|Ga0164305_10609920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300013100|Ga0157373_10448037 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300013296|Ga0157374_10606769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300014162|Ga0181538_10088161 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
| 3300014164|Ga0181532_10363488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 809 | Open in IMG/M |
| 3300014493|Ga0182016_10854483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300014498|Ga0182019_10150185 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300014501|Ga0182024_10230782 | All Organisms → cellular organisms → Bacteria | 2499 | Open in IMG/M |
| 3300014501|Ga0182024_11316433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 837 | Open in IMG/M |
| 3300015078|Ga0167660_1012112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300015193|Ga0167668_1084779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300016750|Ga0181505_11140829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 589 | Open in IMG/M |
| 3300018005|Ga0187878_1154806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300018012|Ga0187810_10123698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300018013|Ga0187873_1206069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300018015|Ga0187866_1159135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 870 | Open in IMG/M |
| 3300018017|Ga0187872_10487207 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300018021|Ga0187882_1225610 | Not Available | 731 | Open in IMG/M |
| 3300018030|Ga0187869_10222606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 919 | Open in IMG/M |
| 3300018037|Ga0187883_10124827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1330 | Open in IMG/M |
| 3300018043|Ga0187887_10384356 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300018047|Ga0187859_10214659 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300018476|Ga0190274_13484089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300019082|Ga0187852_1445728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300019189|Ga0184585_113385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1398 | Open in IMG/M |
| 3300019888|Ga0193751_1126662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
| 3300019890|Ga0193728_1062583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1785 | Open in IMG/M |
| 3300020579|Ga0210407_10945422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300020583|Ga0210401_10421591 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300021088|Ga0210404_10206716 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300021168|Ga0210406_10670428 | Not Available | 802 | Open in IMG/M |
| 3300021181|Ga0210388_10076430 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
| 3300021420|Ga0210394_10509884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
| 3300021475|Ga0210392_10000468 | All Organisms → cellular organisms → Bacteria | 24851 | Open in IMG/M |
| 3300021477|Ga0210398_10832183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300021478|Ga0210402_10909816 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300021478|Ga0210402_11960343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300021559|Ga0210409_10710879 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300022873|Ga0224550_1006875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1595 | Open in IMG/M |
| 3300025419|Ga0208036_1012465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1930 | Open in IMG/M |
| 3300025453|Ga0208455_1060236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300025929|Ga0207664_10382594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1249 | Open in IMG/M |
| 3300025929|Ga0207664_11326895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300025944|Ga0207661_10159222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1958 | Open in IMG/M |
| 3300026078|Ga0207702_11469232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300026223|Ga0209840_1117736 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300026294|Ga0209839_10163913 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300027567|Ga0209115_1000023 | All Organisms → cellular organisms → Bacteria | 13119 | Open in IMG/M |
| 3300027884|Ga0209275_10033526 | All Organisms → cellular organisms → Bacteria | 2383 | Open in IMG/M |
| 3300027889|Ga0209380_10423620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 780 | Open in IMG/M |
| 3300027895|Ga0209624_10027579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3608 | Open in IMG/M |
| 3300027905|Ga0209415_10320361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1318 | Open in IMG/M |
| 3300027908|Ga0209006_10001976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 18633 | Open in IMG/M |
| 3300027908|Ga0209006_10012334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7739 | Open in IMG/M |
| 3300027911|Ga0209698_10059344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3311 | Open in IMG/M |
| 3300028047|Ga0209526_10173358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1504 | Open in IMG/M |
| 3300028047|Ga0209526_10260438 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300028740|Ga0302294_10082462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300028748|Ga0302156_10198844 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300028759|Ga0302224_10129023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300029922|Ga0311363_11374991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300029943|Ga0311340_10510270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
| 3300029944|Ga0311352_11336595 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300029955|Ga0311342_10343586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1328 | Open in IMG/M |
| 3300029999|Ga0311339_10266017 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
| 3300029999|Ga0311339_10607956 | Not Available | 1087 | Open in IMG/M |
| 3300030007|Ga0311338_10285727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1831 | Open in IMG/M |
| 3300030007|Ga0311338_12076495 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300030047|Ga0302286_10436006 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300030114|Ga0311333_11754752 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300030520|Ga0311372_11693736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 763 | Open in IMG/M |
| 3300030991|Ga0073994_12018902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 636 | Open in IMG/M |
| 3300030991|Ga0073994_12024224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300031090|Ga0265760_10245923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300031090|Ga0265760_10335819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300031239|Ga0265328_10458266 | Not Available | 505 | Open in IMG/M |
| 3300031241|Ga0265325_10278106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300031241|Ga0265325_10524517 | Not Available | 513 | Open in IMG/M |
| 3300031344|Ga0265316_10950021 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031708|Ga0310686_116323603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300031715|Ga0307476_11216746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300031938|Ga0308175_102928174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300031962|Ga0307479_10322932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1526 | Open in IMG/M |
| 3300031962|Ga0307479_10676821 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300032515|Ga0348332_10472034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1326 | Open in IMG/M |
| 3300032515|Ga0348332_14594036 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300032756|Ga0315742_12590521 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300033888|Ga0334792_051738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1273 | Open in IMG/M |
| 3300034065|Ga0334827_003048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8268 | Open in IMG/M |
| 3300034124|Ga0370483_0056061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1249 | Open in IMG/M |
| 3300034125|Ga0370484_0149081 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.29% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.14% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.71% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.71% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.29% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 3.57% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.86% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.14% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.14% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.14% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.43% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.43% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.43% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.43% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.43% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.71% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.71% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.71% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.71% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015078 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019189 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028740 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_130752893 | 3300000891 | Soil | TGEFGTVERANEDDAVVKWDDDGRVRLHQPWLKKV* |
| JGI12637J13337_10197122 | 3300001137 | Forest Soil | LGTFGIPTGELGTVEQTNEEDAVVKWDDDGRKRLHQPSLKKI* |
| JGI12712J15308_100262612 | 3300001471 | Forest Soil | MGLADFGKPTGEFGTIEKTNEDDALVKWDDDDRTRQDQSSLRKV* |
| JGI12635J15846_1000281315 | 3300001593 | Forest Soil | NFGKPTGEFGTVERANEEDAIVKWDDDGRMRLHQPSLKKV* |
| JGI12635J15846_105614391 | 3300001593 | Forest Soil | EGLGNFGKPTGEFGTIKQANEDDAVVKWDDDGRVRVHQPSLKKV* |
| JGIcombinedJ26739_1002896721 | 3300002245 | Forest Soil | LGDFGIPTGELGTVEQTNEEDAIVKWDDDGRKRLHQLWLKKV* |
| JGIcombinedJ26739_1005128302 | 3300002245 | Forest Soil | GLGDFGKPTGEFGTVEQANEDDAVVKWDDDGRMRLHQPSLKKV* |
| Ga0058899_122124112 | 3300004631 | Forest Soil | LGNFGKPTGEFGTVEQANEEDAIVKWDDDGRMRLHQPWLKKV* |
| Ga0070711_1015122722 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LGNFGKPTGEFGTVEQANDDDAVVKWDDDGRMRLHQPWLKKV* |
| Ga0070697_10000182118 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | FGKPLGQFGTVEQANEDDAVVKWDDDGRMRLRQPWLKKI* |
| Ga0066706_108157072 | 3300005598 | Soil | GKPLGQFGTVEQANEDDAVVKWDDDGRMRLRQPWLKKV* |
| Ga0070762_100389142 | 3300005602 | Soil | LGNFGKPTGELGTVEQANEDDAVVKWDDDRRQRVHRPSLKKV* |
| Ga0070762_109983972 | 3300005602 | Soil | MGLADFGKPTGEFGTIEKTNEDDALVKREGDGRTRPHQPSLTKV* |
| Ga0068860_1015242301 | 3300005843 | Switchgrass Rhizosphere | NPTGELGTVEQSNEDDAVVKWDDDGRMRLRQPWLKKL** |
| Ga0070766_110124241 | 3300005921 | Soil | EGLGNLGRPTGEIGTVERTNEDDAVVKWDDDGRVRVGQPWLKKV* |
| Ga0066788_100553723 | 3300005944 | Soil | FGKPTGELGTVEQTNEDDAVVKWDDDGRMRLPQPSLRKT* |
| Ga0066790_102139332 | 3300005995 | Soil | LGNFGKPTDEFGTVERANEDDAIVKWDDDGRTRVHQPWLKKV* |
| Ga0066790_104983651 | 3300005995 | Soil | GEFGTVEKTNEDDALVKWDDDGRTRQHQPSLKKV* |
| Ga0070717_107493642 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PTGEFGTVEQANEDDAVVKWDDDGRMRLHQPSLKKI* |
| Ga0075023_1001813681 | 3300006041 | Watersheds | PTGEFGTVEQTNEDDAVVKWDDDGRMRLHQPWLKKV* |
| Ga0075029_1003151932 | 3300006052 | Watersheds | VEGLGDFGKPTGKFGTVWQTNEDDALVKWDGAGRMRSQQTWLKKV* |
| Ga0075017_1012644311 | 3300006059 | Watersheds | NFGNPTGEIGTVERTNENEPVVKWDDDGRVRVGQTWLKKV* |
| Ga0075019_101819181 | 3300006086 | Watersheds | TGEFGTVEQANEDDAVVKWDDDGRMRLYQPSLRKV* |
| Ga0075015_1000515103 | 3300006102 | Watersheds | VEGLGDFGKPTGKFGTVWQTNEDDALVKWDGAGCMRSQQTWLKKV* |
| Ga0070765_1019244052 | 3300006176 | Soil | TGEFGTVERTNEDDAEVKWDDDGRVRVHQPSLKKI* |
| Ga0073928_100026753 | 3300006893 | Iron-Sulfur Acid Spring | LGDFGIPTGDLGTVEQTNEEDAIVKWDDDGRKRLHQPWLKKV* |
| Ga0073928_100083618 | 3300006893 | Iron-Sulfur Acid Spring | MGLGNFGKPTGEFGTVEQTNEDDALVKWDDDGRVRLHQPSLRKV* |
| Ga0073928_110823402 | 3300006893 | Iron-Sulfur Acid Spring | GELGTVEQANEDDAVVKWDNDGRMRLHQPSLKKI* |
| Ga0075426_112951352 | 3300006903 | Populus Rhizosphere | NFGKPTGELGTVERANEDDAVVKWDDDGRMRLHQVSLKKI* |
| Ga0099791_104032222 | 3300007255 | Vadose Zone Soil | GKPTGEFGTVEQANEDDAVVKWDDDGRMRVHQPWLKKI* |
| Ga0105242_118315131 | 3300009176 | Miscanthus Rhizosphere | TGAFGTVEQANEDDAVVKWDDDGRVRLHQPSVKKL* |
| Ga0116108_10121301 | 3300009519 | Peatland | PTGEFGTVEQANEDDAVVKWDDDGRMRLHQPSLKKV* |
| Ga0116108_11370501 | 3300009519 | Peatland | GEFGTVQRTNEDDAEVKWDDDRRVRVHQPSLKKV* |
| Ga0116225_13987073 | 3300009524 | Peatlands Soil | GEFGTVKQANEDDAVVKWDDDGRMRLHQPWLKKV* |
| Ga0116136_11114131 | 3300009547 | Peatland | TGEFGTVQRTNEDDAEVKWDDDRRVRVHQPSLKKV* |
| Ga0116119_10180664 | 3300009629 | Peatland | GKPTGEFGTVEQANEDDAVVKWDDDGRVRVHQPWLKKV* |
| Ga0116217_105881751 | 3300009700 | Peatlands Soil | KPTGEFGTVQQTNEDDAVVKWDDDGRMRVHQPSLKKV* |
| Ga0116130_10899402 | 3300009762 | Peatland | GDFGKPTGVFGTVEQANEDDAVVKWDDYGRARLHQPWLKKV* |
| Ga0116134_12976542 | 3300009764 | Peatland | GKPNGEFGTVERANDEDAVVKWDDDGRVRLHQPSLKKV* |
| Ga0116219_108131192 | 3300009824 | Peatlands Soil | FGTVQQANEDDAVVKWDDDGRMRVHQPSLKKVWPA* |
| Ga0116223_107411193 | 3300009839 | Peatlands Soil | PTGEFGTVERTNDDDALVKWDGDGRMRMHQPWLKKV* |
| Ga0074045_104803181 | 3300010341 | Bog Forest Soil | PTGEFGTVERTNEDDAVVKWDKDGRIRLHQPQLKRV* |
| Ga0126361_104331971 | 3300010876 | Boreal Forest Soil | LADFGKPTGEFGTVEKTNEDDALVKWDDDGRTRQHQPSLKKV* |
| Ga0150983_120865461 | 3300011120 | Forest Soil | TGEFGTVEQANEDDAVVKWDDDGRIRLHQPSLKKV* |
| Ga0150983_166103611 | 3300011120 | Forest Soil | KPTGELGTVEQTNEDDAVVKWDDDGRTRLRIPLVKKV* |
| Ga0137395_107518653 | 3300012917 | Vadose Zone Soil | NGEFGTVERTNEQDAVVKWDDDGRMRIHQPSLKKV* |
| Ga0137413_117616912 | 3300012924 | Vadose Zone Soil | EGLGDFGKPKGEFGTVEQANEDDAVVKWDNDGRRRLHQPWLKKL* |
| Ga0164302_115777232 | 3300012961 | Soil | TGELGTVQQANEDDAVVKWDNDGRMRVHQPSLKKV* |
| Ga0164304_113408592 | 3300012986 | Soil | GEFGTVEQANEDDAVVKWDDDGRMRLHQPSLKKV* |
| Ga0164305_106099203 | 3300012989 | Soil | NFGKPSGEFGTVEQANEDDAVVKWDDAGRMRLHHPWLKKV* |
| Ga0157373_104480372 | 3300013100 | Corn Rhizosphere | LGDFGKPTGEFGTVKQANEDDAVVKWDDDGRVRVHQPSLKKA* |
| Ga0157374_106067693 | 3300013296 | Miscanthus Rhizosphere | GKPTGEIGTVEQTNEDDAVVKWDDDGRTRLRQLSLKNVPAS* |
| Ga0181538_100881615 | 3300014162 | Bog | TGEFGTVKQANEDDAVVKWDDDGRVRVHQPSLKKV* |
| Ga0181532_103634881 | 3300014164 | Bog | TGVFGTVEQANEDDAVVKWDDYGRARLHQPWLKKV* |
| Ga0182016_108544831 | 3300014493 | Bog | EGLGNFGKPTGEFGTVKRVNEDDAVVKWDDDGRVRVHQPSLKKV* |
| Ga0182019_101501854 | 3300014498 | Fen | GEFGTVKQANEDDAVVKWDDDGRVRVHQPSLKKI* |
| Ga0182024_102307823 | 3300014501 | Permafrost | GTFGKPTGELGTVEQANEDDAIVKWDDDGRMRLHQQSLKKV* |
| Ga0182024_113164331 | 3300014501 | Permafrost | GEFGTVRQVNDDDAVVKWDDAGRIRVHQPSLKKV* |
| Ga0167660_10121123 | 3300015078 | Glacier Forefield Soil | MGLADFGKPTGEFGTVEKTNEDDALVKWDDDGRTRQHQPSLKKV* |
| Ga0167668_10847792 | 3300015193 | Glacier Forefield Soil | GEFGTVEQANEDDAVVKWDGDGRMRLAQPWLKKV* |
| Ga0181505_111408291 | 3300016750 | Peatland | VEGLGDFGKPTGEFGTVQQTNEDDAVVKWDDDGRMRVHQPSLKKV |
| Ga0187878_11548062 | 3300018005 | Peatland | FGKPTGEFGTVEQANEDDAVVKWDDDGRVRVHQPWLKKV |
| Ga0187810_101236982 | 3300018012 | Freshwater Sediment | GLGDFGMPTGEFGTVRQVNEDDALVKWDDDGRVRLHQPSLKKL |
| Ga0187873_12060691 | 3300018013 | Peatland | PTGEFGTVQRTNEDDAEVKWDDDRRVRVHQPSLKKV |
| Ga0187866_11591351 | 3300018015 | Peatland | KPSGEFGTVEQANEDDALVKWDDDGRMRLGQPWLKKV |
| Ga0187872_104872071 | 3300018017 | Peatland | NFGKPTGEFGTVKQANEDDAVVKWDDDGRVTVHQPSLKKV |
| Ga0187882_12256101 | 3300018021 | Peatland | NFGKPTGEFGTVERANEEDAVVKWDDDGRMRLHQPSLKKI |
| Ga0187869_102226062 | 3300018030 | Peatland | LGNFGKPSGEFGTVEQANEDDAVVKWDDDGRMRLGQPWLKKV |
| Ga0187883_101248271 | 3300018037 | Peatland | GLGDFGMPTGEFGTVRQVNEDDALVKWDDDGRMRVHKPSLKNV |
| Ga0187887_103843563 | 3300018043 | Peatland | NFGKPNGEFGTVKQSNADDAVVKWDDDGRVRVHQPSLKKI |
| Ga0187859_102146592 | 3300018047 | Peatland | TGVFGTVEQANEDDAVVKWDGDGRVRLHQPWLKKV |
| Ga0190274_134840891 | 3300018476 | Soil | PTGEFGTVKQANDEDAVVKWDDDGRVRLHQPSLKKL |
| Ga0187852_14457282 | 3300019082 | Peatland | DFGKPTGVFGTVEQANEDDAVVKWDDYGRARLHQPWLKKV |
| Ga0184585_1133851 | 3300019189 | Soil | GDRVEGLANFGKPTGEFGTVEKTNEDDALVKWDDDGRMRLQQPWLKKVSN |
| Ga0193751_11266621 | 3300019888 | Soil | DFGKPTGESGIVEQANEDDAVVKWDDDGRVRLHQPWLKKL |
| Ga0193728_10625834 | 3300019890 | Soil | TGDLGTVERSNEEDAVVKWDDDGRMRLRQGSLKKI |
| Ga0210407_109454221 | 3300020579 | Soil | EIASRVWADFGKPTGEFGTVEQTNEDDALVKWDDDGRMRLHQPWLKKV |
| Ga0210401_104215911 | 3300020583 | Soil | TGEFGTVEQSNEDDAVVKWDDDGRMRLHQPSLRKV |
| Ga0210404_102067161 | 3300021088 | Soil | NFGKPTGGLGTVEQANEDDAIVKWDDDGRTRLPQPSLKKI |
| Ga0210406_106704281 | 3300021168 | Soil | LGSFGKTTGEFGTVKQANEEDAIVKWDDDSRTWLQQPRPAASQVTL |
| Ga0210388_100764301 | 3300021181 | Soil | LRRWRVMGLADFGKPTGEFGTIEKTNEDDALVKWDDDDRTRQHQSSLRKV |
| Ga0210394_105098841 | 3300021420 | Soil | TGEFGTVEQTNEDDAVVKWDDDGRSRQHQPWLKKV |
| Ga0210392_1000046817 | 3300021475 | Soil | MGLADFGKPTGEFGTVEKTNEDDALVKWDDDGRTRQHQPSLKKV |
| Ga0210398_108321831 | 3300021477 | Soil | PTGEFGTVQQANDDDAVVKWDDDGRVRVHQPSLKKI |
| Ga0210402_109098161 | 3300021478 | Soil | NLGKPTGELGTVEQTNEDDALVKWDDDGRVRLHQPSLKKV |
| Ga0210402_119603431 | 3300021478 | Soil | GKPTGEFGTVERANEEDAVVKWDHDGRVRLHQPSLKKV |
| Ga0210409_107108792 | 3300021559 | Soil | FGKPTGELGTVEQANEDDAVVKWDDDGRKRLPQPWLKKV |
| Ga0224550_10068752 | 3300022873 | Soil | GKPTGEFGTVERANEDDAEVKWDDDGRVRVHQPSLRRV |
| Ga0208036_10124651 | 3300025419 | Peatland | GKPTGEFGTVEQANEDDAVVKWDDDGRVRVHQPWLKKV |
| Ga0208455_10602361 | 3300025453 | Peatland | KPTGEFGTVQRTNEDDAEVKWDDDRRVRVHQPSLKKV |
| Ga0207664_103825941 | 3300025929 | Agricultural Soil | FGTPTGQLGTVERTNEEDAVVKWDSDGRTRLHQPWLKRV |
| Ga0207664_113268952 | 3300025929 | Agricultural Soil | TGEFGTVEQTNEEDAVVKWDDDGRMILHQPWLKKV |
| Ga0207661_101592225 | 3300025944 | Corn Rhizosphere | DFGKPTGEFGTVEQTNEDDALVKWDHDGRMRLHQPWLKKISNKSKG |
| Ga0207702_114692322 | 3300026078 | Corn Rhizosphere | GNFGKPTGEFGTVEQANEDDALVKWDDDGRMRLHQPSLKKV |
| Ga0209840_11177362 | 3300026223 | Soil | GNFGKPTGEFGTVEQTNEDDAVVKWDDDGRMRLHQPWLKKV |
| Ga0209839_101639131 | 3300026294 | Soil | NFGKPTGEFGTVEQANEDDALVKWDDDGRMRLHQPSLKKI |
| Ga0209115_100002316 | 3300027567 | Forest Soil | MGLADFGKPTGEFGTIEKTNEDDALVKREDDGRTRQHQPSLTKV |
| Ga0209275_100335266 | 3300027884 | Soil | KPTGEFGTVQQANDDDAVVKWDHDGRVRVHQPSLKKI |
| Ga0209380_104236202 | 3300027889 | Soil | LGNFGKPTGELGTVEQANEDDAVVKWDDDRRQRVHRPSLKKV |
| Ga0209624_100275794 | 3300027895 | Forest Soil | MGLADFGKPTGEFGTIEKTNEDDALVKREGDGRTRPHQPSLTKV |
| Ga0209415_103203612 | 3300027905 | Peatlands Soil | VEGLGDFGKPTGVFGTVEQANEDDAVVKWDDDGRVRLHQPWLKKV |
| Ga0209006_100019762 | 3300027908 | Forest Soil | MGLADFGKPTGEFGTIEKTNEDDALVKWDDDDRTRQDQSSLRKV |
| Ga0209006_100123348 | 3300027908 | Forest Soil | TGEIGTVERTNEDDAVVKWDDDGRVRVGQPWLKKI |
| Ga0209698_100593445 | 3300027911 | Watersheds | VEGLGDFGKPTGKFGTVWQTNEDDALVKWDGAGCMRSQQTWLKKV |
| Ga0209526_101733583 | 3300028047 | Forest Soil | TGEFGTVEQANEDDAVVKWDDDSRMRLHQPWLKRA |
| Ga0209526_102604381 | 3300028047 | Forest Soil | GLGNFGKPTGEFGTIERSNEEDAIVKWDDDGRKRLHQPSLKKV |
| Ga0302294_100824623 | 3300028740 | Fen | GLGYFGVPTGQLGTVERTNEVDAVVKWDDDGRMRLRQPWLKKV |
| Ga0302156_101988441 | 3300028748 | Bog | YFGKPTGDFGTVEKSNEYDALVKWDDDGRVRLQQPWLRKVVTEPPLS |
| Ga0302224_101290231 | 3300028759 | Palsa | GKPTGEFGTVQRTSEDDVDVKWDNDGRVRVSQPSLRKV |
| Ga0311363_113749911 | 3300029922 | Fen | MPTGEFGTVRQVNEDDALVKWDDDSRIRVHQPSLKKV |
| Ga0311340_105102701 | 3300029943 | Palsa | GKPTGEIGTVERTNEDDALVKWDDDGRVRVGQPWLKRV |
| Ga0311352_113365951 | 3300029944 | Palsa | GLGNFGKPTSEFGTVQQTNDDDAVVKWDDDGRVRVRQPSLKKV |
| Ga0311342_103435862 | 3300029955 | Bog | GDFGMPTGEFGTVRQVNEDDALVKWDDDSRIRVHQPSLKKV |
| Ga0311339_102660171 | 3300029999 | Palsa | VEGLSKFGTPTGEFGTVQQANHEDAVVKWDDDGRVRVHQPSLKNV |
| Ga0311339_106079562 | 3300029999 | Palsa | PTSEFGTVQQTNDDDAVVKWDDDGRVRVRQPSLKKV |
| Ga0311338_102857271 | 3300030007 | Palsa | TGEFGTVERANEDDAEVKWDDDGRVRVHQPSLRRV |
| Ga0311338_120764951 | 3300030007 | Palsa | TGEFGTVEQANEDDAVVKWDDDGRMRLHQPSLKKV |
| Ga0302286_104360061 | 3300030047 | Fen | SNFGKPNGEFGTVKLANEEDAVVKWDNDGRVRVHQPSLRKI |
| Ga0311333_117547521 | 3300030114 | Fen | KPNGEFGTVKLANEEDAVVKWDDDGRVRVHQPSLKKI |
| Ga0311372_116937362 | 3300030520 | Palsa | ADGRIGTVRQVNDDDPVVKWDDDGRIRVHQPSLKTV |
| Ga0073994_120189021 | 3300030991 | Soil | GNFGKPTGEFGTVEQSNDEDAIVKWDDDGRKRLHQPSLKKV |
| Ga0073994_120242241 | 3300030991 | Soil | GSFGTPTGESGIVERTNEDDAVIKWDGAGRRRVRQTWLKKI |
| Ga0265760_102459231 | 3300031090 | Soil | GNFGKPTGAIGTVERANEDDAVVKWDDDGRVRLHQPWLKKI |
| Ga0265760_103358191 | 3300031090 | Soil | GKPTSEFGTVQQTNDDDAVVKWDDDGRVRVRQPSLKKV |
| Ga0265328_104582662 | 3300031239 | Rhizosphere | MPTGEFGTVRQVNEEDAVVKWDDDGRVRVHQPWLKKV |
| Ga0265325_102781061 | 3300031241 | Rhizosphere | LGRPTGEIGTVERTNEDDAVVKWDDDGRVRVGQPWLKKI |
| Ga0265325_105245171 | 3300031241 | Rhizosphere | DFGMLTGEFGTVRQVNEEDAVVKWDDDGRVRVHQPWLKKV |
| Ga0265316_109500212 | 3300031344 | Rhizosphere | EGLGNFGKPTGEFGTVKQANEDDAVVKWDDDGRVRVHQPSLKKA |
| Ga0310686_1163236031 | 3300031708 | Soil | KPTGEFGTVEQANEDDAVVKWDGDGRMRLHQPSLKKV |
| Ga0307476_112167462 | 3300031715 | Hardwood Forest Soil | FGVPTGELGTVEQANEDDALVKWDDDGRKRIPRLWLKKV |
| Ga0308175_1029281741 | 3300031938 | Soil | ADFGKPTGEFGTVEQTNEDDALVKWDHDGRMRLHQPWLKKISNKSKG |
| Ga0307479_103229321 | 3300031962 | Hardwood Forest Soil | GDFGKPTGEFGTVEQANEDDAVVKWDDDGRKRLPQPRLKKV |
| Ga0307479_106768211 | 3300031962 | Hardwood Forest Soil | NFGKPTGAFGTVEQANEDDAIVKWDDDGRVRLHRPSLKKV |
| Ga0348332_104720342 | 3300032515 | Plant Litter | PTGQLGTVERANEDDAVVKWDDDGRVRLHQPSLQKI |
| Ga0348332_145940364 | 3300032515 | Plant Litter | GKPTDEFGTVERANEDDAIVKWDKDGRTRVHQPWLKKVDRG |
| Ga0315742_125905211 | 3300032756 | Forest Soil | PTGEFGTVERANEDDAVVKWDDDGRMRLHQPSLKKI |
| Ga0334792_051738_841_969 | 3300033888 | Soil | MGDFGKPTGVFGTVEQANEDDAVVKWDHDVRARLHQPWLKKV |
| Ga0334827_003048_1449_1562 | 3300034065 | Soil | MPTGEFGTVRQVNEDDALVKWDDDNRIRVHQPSLKKV |
| Ga0370483_0056061_1126_1239 | 3300034124 | Untreated Peat Soil | VPTGELGTVEKATEDDAIVKWDDDGRMKIRQPWLKKI |
| Ga0370484_0149081_503_625 | 3300034125 | Untreated Peat Soil | NFGRPTGAFGTVEQTNEDDAVVKWDDDGRMRLHQPSLKKV |
| ⦗Top⦘ |