


| Basic Information | |
|---|---|
| Family ID | F054121 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MDEPGEDPREARFLPILLYVLGFMAALALLALAAGWLLRHL |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 62.32 % |
| % of genes near scaffold ends (potentially truncated) | 23.57 % |
| % of genes from short scaffolds (< 2000 bps) | 82.86 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.286 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (7.143 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF07690 | MFS_1 | 42.86 |
| PF07992 | Pyr_redox_2 | 38.57 |
| PF00070 | Pyr_redox | 3.57 |
| PF00155 | Aminotran_1_2 | 2.86 |
| PF00795 | CN_hydrolase | 1.43 |
| PF13432 | TPR_16 | 0.71 |
| PF00158 | Sigma54_activat | 0.71 |
| PF00171 | Aldedh | 0.71 |
| PF01329 | Pterin_4a | 0.71 |
| PF14559 | TPR_19 | 0.71 |
| PF04952 | AstE_AspA | 0.71 |
| PF13738 | Pyr_redox_3 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.71 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.71 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.71 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.43 % |
| Unclassified | root | N/A | 18.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|FZY7DQ102IE4MM | Not Available | 510 | Open in IMG/M |
| 3300000886|AL3A1W_1004307 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300001145|JGI12682J13319_1000241 | All Organisms → cellular organisms → Bacteria | 6038 | Open in IMG/M |
| 3300003995|Ga0055438_10011377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1830 | Open in IMG/M |
| 3300004480|Ga0062592_100127440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1650 | Open in IMG/M |
| 3300004480|Ga0062592_101283301 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300005328|Ga0070676_10072782 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
| 3300005330|Ga0070690_100204760 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300005338|Ga0068868_102009747 | Not Available | 549 | Open in IMG/M |
| 3300005339|Ga0070660_100824411 | Not Available | 781 | Open in IMG/M |
| 3300005347|Ga0070668_101535585 | Not Available | 609 | Open in IMG/M |
| 3300005355|Ga0070671_100569418 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300005356|Ga0070674_101675035 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005365|Ga0070688_100060869 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
| 3300005367|Ga0070667_101980684 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005437|Ga0070710_10742426 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300005440|Ga0070705_100212588 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300005456|Ga0070678_100294326 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Cannabaceae | 1377 | Open in IMG/M |
| 3300005459|Ga0068867_100021195 | All Organisms → cellular organisms → Bacteria | 4635 | Open in IMG/M |
| 3300005467|Ga0070706_100487385 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300005468|Ga0070707_101923941 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005543|Ga0070672_100052751 | All Organisms → cellular organisms → Bacteria | 3176 | Open in IMG/M |
| 3300005546|Ga0070696_102000512 | Not Available | 503 | Open in IMG/M |
| 3300005617|Ga0068859_100130520 | All Organisms → cellular organisms → Bacteria | 2584 | Open in IMG/M |
| 3300005618|Ga0068864_100722016 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300005764|Ga0066903_101933626 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300005764|Ga0066903_103560683 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300005764|Ga0066903_104992657 | Not Available | 704 | Open in IMG/M |
| 3300005841|Ga0068863_100417303 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300005841|Ga0068863_100485511 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 1215 | Open in IMG/M |
| 3300005937|Ga0081455_10007281 | All Organisms → cellular organisms → Bacteria | 11675 | Open in IMG/M |
| 3300005938|Ga0066795_10038288 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300006047|Ga0075024_100102729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium animalis → Bifidobacterium animalis subsp. lactis → Bifidobacterium animalis subsp. lactis CNCM I-2494 | 1255 | Open in IMG/M |
| 3300006237|Ga0097621_100578541 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300006358|Ga0068871_101411188 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300006579|Ga0074054_11472536 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300006844|Ga0075428_100859644 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300006854|Ga0075425_100398145 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300006904|Ga0075424_102461694 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006931|Ga0097620_101210586 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300009053|Ga0105095_10033004 | All Organisms → cellular organisms → Bacteria | 2786 | Open in IMG/M |
| 3300009081|Ga0105098_10365525 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300009814|Ga0105082_1074422 | Not Available | 607 | Open in IMG/M |
| 3300009815|Ga0105070_1049352 | Not Available | 778 | Open in IMG/M |
| 3300009837|Ga0105058_1177740 | Not Available | 525 | Open in IMG/M |
| 3300010373|Ga0134128_10166552 | All Organisms → cellular organisms → Bacteria | 2489 | Open in IMG/M |
| 3300010375|Ga0105239_13306508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces | 525 | Open in IMG/M |
| 3300010397|Ga0134124_11849707 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300010399|Ga0134127_11086486 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 863 | Open in IMG/M |
| 3300010400|Ga0134122_13241396 | Not Available | 510 | Open in IMG/M |
| 3300010401|Ga0134121_10218832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1654 | Open in IMG/M |
| 3300010867|Ga0126347_1302594 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012204|Ga0137374_11264345 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes | 512 | Open in IMG/M |
| 3300012212|Ga0150985_110141534 | Not Available | 631 | Open in IMG/M |
| 3300012358|Ga0137368_10752074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 608 | Open in IMG/M |
| 3300012899|Ga0157299_10071112 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300012957|Ga0164303_10515762 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300012971|Ga0126369_12495169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 602 | Open in IMG/M |
| 3300012984|Ga0164309_10388339 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300012989|Ga0164305_10207799 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300013100|Ga0157373_10687422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 749 | Open in IMG/M |
| 3300013102|Ga0157371_11646283 | Not Available | 503 | Open in IMG/M |
| 3300013306|Ga0163162_11422033 | Not Available | 789 | Open in IMG/M |
| 3300014324|Ga0075352_1025274 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300014829|Ga0120104_1004865 | Not Available | 2383 | Open in IMG/M |
| 3300015168|Ga0167631_1013693 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300015168|Ga0167631_1036333 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300015371|Ga0132258_10374292 | All Organisms → cellular organisms → Bacteria | 3530 | Open in IMG/M |
| 3300015371|Ga0132258_10625542 | All Organisms → cellular organisms → Bacteria | 2705 | Open in IMG/M |
| 3300015372|Ga0132256_101771114 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300015373|Ga0132257_100061296 | All Organisms → cellular organisms → Bacteria | 4224 | Open in IMG/M |
| 3300015373|Ga0132257_104112460 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300015374|Ga0132255_105240380 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300017792|Ga0163161_10656449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 869 | Open in IMG/M |
| 3300017974|Ga0187777_11222398 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Labyrinthulomycetes | 550 | Open in IMG/M |
| 3300018056|Ga0184623_10440699 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300018058|Ga0187766_10245862 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300018084|Ga0184629_10003153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 6160 | Open in IMG/M |
| 3300018422|Ga0190265_11115833 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 909 | Open in IMG/M |
| 3300018482|Ga0066669_10637950 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300021081|Ga0210379_10053465 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300021432|Ga0210384_10064191 | All Organisms → cellular organisms → Bacteria | 3314 | Open in IMG/M |
| 3300021445|Ga0182009_10079163 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300021445|Ga0182009_10802203 | Not Available | 515 | Open in IMG/M |
| 3300021478|Ga0210402_10002907 | All Organisms → cellular organisms → Bacteria | 16357 | Open in IMG/M |
| 3300021559|Ga0210409_10353848 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300025315|Ga0207697_10528703 | Not Available | 520 | Open in IMG/M |
| 3300025324|Ga0209640_10809392 | Not Available | 737 | Open in IMG/M |
| 3300025899|Ga0207642_10566367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 703 | Open in IMG/M |
| 3300025899|Ga0207642_10858885 | Not Available | 580 | Open in IMG/M |
| 3300025903|Ga0207680_10066514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 2217 | Open in IMG/M |
| 3300025905|Ga0207685_10271175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
| 3300025910|Ga0207684_11374393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 579 | Open in IMG/M |
| 3300025920|Ga0207649_10529848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 899 | Open in IMG/M |
| 3300025925|Ga0207650_10041601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 3368 | Open in IMG/M |
| 3300025931|Ga0207644_10166419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1718 | Open in IMG/M |
| 3300025931|Ga0207644_10575277 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300025934|Ga0207686_11169792 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300025938|Ga0207704_10101956 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300025941|Ga0207711_11214738 | Not Available | 695 | Open in IMG/M |
| 3300025942|Ga0207689_10294891 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300025981|Ga0207640_10305972 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300025981|Ga0207640_12138085 | Not Available | 508 | Open in IMG/M |
| 3300026088|Ga0207641_10088999 | All Organisms → cellular organisms → Bacteria | 2697 | Open in IMG/M |
| 3300026088|Ga0207641_10296171 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300026088|Ga0207641_10464520 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300026095|Ga0207676_10716762 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300026095|Ga0207676_12031628 | Not Available | 573 | Open in IMG/M |
| 3300026271|Ga0209880_1107058 | Not Available | 562 | Open in IMG/M |
| 3300027667|Ga0209009_1000216 | All Organisms → cellular organisms → Bacteria | 23297 | Open in IMG/M |
| 3300027722|Ga0209819_10011407 | All Organisms → cellular organisms → Bacteria | 2876 | Open in IMG/M |
| 3300027731|Ga0209592_1107948 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300027909|Ga0209382_10453553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1420 | Open in IMG/M |
| 3300027915|Ga0209069_10115105 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300028592|Ga0247822_10589107 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300028596|Ga0247821_11209783 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300028792|Ga0307504_10064106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1086 | Open in IMG/M |
| 3300030336|Ga0247826_11583184 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031366|Ga0307506_10054972 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300031682|Ga0318560_10319929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300031720|Ga0307469_10178409 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300031720|Ga0307469_10262547 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300031720|Ga0307469_10613506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 974 | Open in IMG/M |
| 3300031779|Ga0318566_10388941 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300031834|Ga0315290_10377895 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300032092|Ga0315905_11106753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 656 | Open in IMG/M |
| 3300032180|Ga0307471_100403655 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300032180|Ga0307471_100894595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1055 | Open in IMG/M |
| 3300032180|Ga0307471_101771630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
| 3300032205|Ga0307472_100438682 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300032205|Ga0307472_102028355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300032397|Ga0315287_12654804 | Not Available | 534 | Open in IMG/M |
| 3300032516|Ga0315273_10028489 | All Organisms → cellular organisms → Bacteria | 7419 | Open in IMG/M |
| 3300032782|Ga0335082_10272162 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300033408|Ga0316605_11449150 | Not Available | 666 | Open in IMG/M |
| 3300033807|Ga0314866_089432 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300034123|Ga0370479_0108196 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300034178|Ga0364934_0139852 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 916 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.14% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.29% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.57% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.86% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.14% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.14% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.43% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.43% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.43% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.43% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.43% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.43% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.71% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.71% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.71% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.71% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.71% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.71% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.71% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.71% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001145 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300034123 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_02034080 | 2170459002 | Grass Soil | VRREPDPTKTPFVSILLYVMGFMGGLALLAYAAACFLRH |
| AL3A1W_10043072 | 3300000886 | Permafrost | MDESEEGPRGTRFLPILLYVLGFMGALALLAVAAAWLLRRL* |
| JGI12682J13319_10002415 | 3300001145 | Forest Soil | LGGQAEDPQKTRFLSILLYVMGFVGGLALLAWAVAWLLRHG* |
| Ga0055438_100113773 | 3300003995 | Natural And Restored Wetlands | MDEPGGDPRRTPFLALLLYVLGFMGALALLALLAAWALRRL* |
| Ga0062592_1001274403 | 3300004480 | Soil | GASMDEPPDDDPRSTPFLAILLYVLGFMLALAVLALAAGWLLKRLA* |
| Ga0062592_1012833012 | 3300004480 | Soil | MGEEPEDDPRRTPFLAILIYVLGFMLALAVLALAAGWLLKRLA* |
| Ga0070676_100727822 | 3300005328 | Miscanthus Rhizosphere | MDEDPGDPDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA* |
| Ga0070690_1002047602 | 3300005330 | Switchgrass Rhizosphere | MSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA* |
| Ga0068868_1020097472 | 3300005338 | Miscanthus Rhizosphere | MGEEPEDDPRRTPFLAILLYVLGFMLALAVLALAAGWLLKRLA* |
| Ga0070660_1008244112 | 3300005339 | Corn Rhizosphere | MDEDPGDPDEQDSARFLPILLYVLGFMLALALLAAAAAWLLKRFA* |
| Ga0070668_1015355852 | 3300005347 | Switchgrass Rhizosphere | MSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWVLKHLA* |
| Ga0070671_1005694182 | 3300005355 | Switchgrass Rhizosphere | MDDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWVLKHLA* |
| Ga0070674_1016750352 | 3300005356 | Miscanthus Rhizosphere | HPWMSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHIA* |
| Ga0070688_1000608693 | 3300005365 | Switchgrass Rhizosphere | MSNEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA* |
| Ga0070667_1019806842 | 3300005367 | Switchgrass Rhizosphere | MDDEPDGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA* |
| Ga0070710_107424262 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEPPDEDPSRTPFLAILLYVLGFMLALAVLAYAAAWILRHLA* |
| Ga0070705_1002125882 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDPENDPNANRFLPILLYVLGFMFALALAALVAGWLLRHL* |
| Ga0070678_1002943262 | 3300005456 | Miscanthus Rhizosphere | MSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHIA* |
| Ga0068867_1000211952 | 3300005459 | Miscanthus Rhizosphere | MDEDSGDRDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA* |
| Ga0070706_1004873852 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGEPGDDPDKTPFLPILLYVLGFMGALALAALAVGWLLRHL* |
| Ga0070707_1019239411 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDEPEEDSEKTRFLPILAYVLGFMAALALLALAAGWLLRHL* |
| Ga0070672_1000527513 | 3300005543 | Miscanthus Rhizosphere | MDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA* |
| Ga0070696_1020005122 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGTDPPEDNPRNTPFLSILLYVMGFMGGLALLAYAVAWLLRHR* |
| Ga0068859_1001305202 | 3300005617 | Switchgrass Rhizosphere | MGEEPEDDLRRTPFLAILLYVLGFMLALAVLALAAGWLLKRLA* |
| Ga0068864_1007220162 | 3300005618 | Switchgrass Rhizosphere | MDDRGDDPRNTPFLAILAYVLGFMGALALLAWVLARLMRH* |
| Ga0066903_1019336262 | 3300005764 | Tropical Forest Soil | MTEPGDDPRRTPFLAILLYVLGFMLALAVLALAAGWLLKHLA* |
| Ga0066903_1035606832 | 3300005764 | Tropical Forest Soil | MPDDPRQTPFLSILLYVLGFMGALALLALAGAWLLRHL* |
| Ga0066903_1049926572 | 3300005764 | Tropical Forest Soil | MSDDPRQTPFLSILLYVLGFMGALALLALAGAWVLHHLR* |
| Ga0068863_1004173032 | 3300005841 | Switchgrass Rhizosphere | MDDRGNDPRNTPFLAILAYVLGFMGALGLLAWLLARLMRH* |
| Ga0068863_1004855111 | 3300005841 | Switchgrass Rhizosphere | MDDRGDDPRNTPFLAILAYVLGFMGALALLAWVLARLMRP* |
| Ga0081455_100072814 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDEDRKKPGGPDEESPPRFLPILLYVLGFMLALALLAAAAAWLLRRLG* |
| Ga0066795_100382882 | 3300005938 | Soil | LGGQAEDPQKTPFLSILLYVMGFMGGLALLAWAVAWLLR* |
| Ga0075024_1001027293 | 3300006047 | Watersheds | MSADPEDDPRNTPFLAILAYVLGFMGALALAAWIIARLLRRG* |
| Ga0097621_1005785411 | 3300006237 | Miscanthus Rhizosphere | RGSMDDPGQDPNANRFLPILLYVLGFMFALALAALVAGWLMRHL* |
| Ga0068871_1014111882 | 3300006358 | Miscanthus Rhizosphere | MSNEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHIA* |
| Ga0074054_114725361 | 3300006579 | Soil | MGEPGEDPRESRFVPILLYVLGFMAALALAALAAGWLLRHR* |
| Ga0075428_1008596442 | 3300006844 | Populus Rhizosphere | MDEDPGDRDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA* |
| Ga0075425_1003981452 | 3300006854 | Populus Rhizosphere | MDDPRQTRFLSILVYVLGFMGALALLALAGAWLLRHLS* |
| Ga0075424_1024616941 | 3300006904 | Populus Rhizosphere | GEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA* |
| Ga0097620_1012105862 | 3300006931 | Switchgrass Rhizosphere | HPWMSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA* |
| Ga0105095_100330044 | 3300009053 | Freshwater Sediment | MDDGEGGDPRYARFLPILLYVLGFMAALALLALAAGWLLKRFG* |
| Ga0105098_103655252 | 3300009081 | Freshwater Sediment | MDEDPDDPRSARFLPILLYVLGFMLALALLAAAAAWLLKRLG* |
| Ga0105082_10744221 | 3300009814 | Groundwater Sand | MDEPEDDPRRARFLPILLYVLGFMLALALAALAAGWL |
| Ga0105070_10493521 | 3300009815 | Groundwater Sand | MDEPEDDPRRARFLPILLYVLGFMLALALAALAAGWLLRRLA* |
| Ga0105058_11777402 | 3300009837 | Groundwater Sand | MDEPEDDSRRTRFLPILLYVLGFMLALALAALAAGWLLRRLA* |
| Ga0134128_101665523 | 3300010373 | Terrestrial Soil | MDDPEDDPNANRFLPILLYVLGFMFALALAALVAGWLLRHL* |
| Ga0105239_133065081 | 3300010375 | Corn Rhizosphere | MDEPPDDDPRSTPFLAILLYVLGFMLALAVLALAAGWLLKRLA* |
| Ga0134124_118497073 | 3300010397 | Terrestrial Soil | GASMDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA* |
| Ga0134127_110864862 | 3300010399 | Terrestrial Soil | MDEDPGDPDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRF |
| Ga0134122_132413962 | 3300010400 | Terrestrial Soil | MDDPQEDPNANRFLPILLYVLGFMLALALAALVAGWLLRHL* |
| Ga0134121_102188322 | 3300010401 | Terrestrial Soil | MDDPQEDPNANRFLPILLYVLGFMLALALAALVAGWLMRHL* |
| Ga0126347_13025942 | 3300010867 | Boreal Forest Soil | EDPRNTPFLAILLYVLGFMGALALLAWALARLLRHG* |
| Ga0137374_112643452 | 3300012204 | Vadose Zone Soil | MRTPKEDPRQTPFLSIVLYIFGFMVALALLAWAGAWLMHHI* |
| Ga0150985_1101415342 | 3300012212 | Avena Fatua Rhizosphere | MTDEPPGDDPGRTPFIAILLYVLGFMFALALLALAAGWVLK |
| Ga0137368_107520742 | 3300012358 | Vadose Zone Soil | MDEPGEDPRDTPFLAILLYVLGFMGVLALAALLAAWLLRRL* |
| Ga0157299_100711122 | 3300012899 | Soil | PGASMDEPPDDDPRSTPFLAILLYVLGFMLALAVLALAAGWLLKRLA* |
| Ga0164303_105157622 | 3300012957 | Soil | EDPRRTSFLSLLLYVLGFMGGLALLAYGAAWLLRHH* |
| Ga0126369_124951692 | 3300012971 | Tropical Forest Soil | MDERGEDPNENRFLPILLYVLGFMGALALAALLVGWLLRHL* |
| Ga0164309_103883392 | 3300012984 | Soil | VSAPEEDPRNTPFLSILLYVIGFMVALGALAFVTAWLLRR* |
| Ga0164305_102077992 | 3300012989 | Soil | VSAPEDDPRNTPFLSILLYVIGFMVALGALAFVTAWLLRR* |
| Ga0157373_106874222 | 3300013100 | Corn Rhizosphere | MDDPENDPNTSRFLPILLYVLGFMFALALAALVAGWLLRHL* |
| Ga0157371_116462832 | 3300013102 | Corn Rhizosphere | MSNEPPGDDPGRAPFLAILLYVLGFMFALALLALAAGWILKHLA* |
| Ga0163162_114220332 | 3300013306 | Switchgrass Rhizosphere | MGEEPEDDPRRTPFLSILLYVLGFMLALAVLALAAGWLLK |
| Ga0075352_10252741 | 3300014324 | Natural And Restored Wetlands | MSDKEGGDPRNTPFLSILLYVLGFMGAVALLAFAAAWLLKRF* |
| Ga0120104_10048651 | 3300014829 | Permafrost | MDESEEGPRGTRFLPILLYVLGFMGALALLAVAAAWLLR |
| Ga0167631_10136932 | 3300015168 | Glacier Forefield Soil | MGERGEKPRDARFLPLLLYVLGFMLALAVLALLAAWLLRRL* |
| Ga0167631_10363332 | 3300015168 | Glacier Forefield Soil | MSAEPEEDPRNTPFLAILFYVLGFMGALALLAWALARLLRHG* |
| Ga0132258_103742922 | 3300015371 | Arabidopsis Rhizosphere | MDDPGQDPNANRFLPILLYVLGFMFALALAALVAGWLMRHL* |
| Ga0132258_106255422 | 3300015371 | Arabidopsis Rhizosphere | MDDPEDDDPRNARFLPILLYVLGFMGALALLALAAAWLLRRFG* |
| Ga0132256_1017711142 | 3300015372 | Arabidopsis Rhizosphere | MNDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHIA* |
| Ga0132257_1000612962 | 3300015373 | Arabidopsis Rhizosphere | VSAPEEDPRNTPFLSILLYVIGFMVALGVLAFVTAWLLRK* |
| Ga0132257_1041124602 | 3300015373 | Arabidopsis Rhizosphere | GRTPFLAILLYVLGFMFALALLALAAGWILKHLA* |
| Ga0132255_1052403802 | 3300015374 | Arabidopsis Rhizosphere | MNDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA* |
| Ga0163161_106564492 | 3300017792 | Switchgrass Rhizosphere | MDEDPGDPDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA |
| Ga0187777_112223982 | 3300017974 | Tropical Peatland | VADESDREPRDARFLPILLYVLGFMGGLALLALAAAWLLRRL |
| Ga0184623_104406992 | 3300018056 | Groundwater Sediment | MDEPGEDPREARFLPILLYVLGFMAALALLALAAGWLLRHL |
| Ga0187766_102458622 | 3300018058 | Tropical Peatland | MSSDPRQTPFLSILLYVLGFMGALALLAFIGAWLLRHLG |
| Ga0184629_100031533 | 3300018084 | Groundwater Sediment | MSDEPGDDDPRNTPFLAILLYVLGFMGALALAAWILARLLRRL |
| Ga0190265_111158332 | 3300018422 | Soil | MIVHMPDEDPSKPPFLPILGYVLGFMLLLALLAFATAALLHLD |
| Ga0066669_106379501 | 3300018482 | Grasslands Soil | DGRRKTVDDDPRKTSFLSILLYVLGFMGGLALLAWAAAWLIRQH |
| Ga0210379_100534652 | 3300021081 | Groundwater Sediment | MSDEPGDDDPRNTPFLAILLYVLRFMGALALAAWILARLLRRL |
| Ga0210384_100641913 | 3300021432 | Soil | MGDDPRQTPFLSILLYVLGFMGALGLLALLGAWLLRRL |
| Ga0182009_100791632 | 3300021445 | Soil | MDERPDDDDPTRTPFLAILLYVLGFMLALALLALAAGWLLKRLA |
| Ga0182009_108022031 | 3300021445 | Soil | LTNEEEDPRNTRFASILFYVLGIMLALGALAFAAVRLLRR |
| Ga0210402_100029077 | 3300021478 | Soil | MSADPEEDPRNTPFLAILLYVLGFMGALALLAWVLARLLRHA |
| Ga0210409_103538482 | 3300021559 | Soil | MGEPGDDPRETRFLSTLLYVLGFMGALALAALAAAWLLRHF |
| Ga0207697_105287032 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGW |
| Ga0209640_108093921 | 3300025324 | Soil | MDEPEDDSRRTRFLPILLYVLGFMLALALLALAAGWLLRRLA |
| Ga0207642_105663672 | 3300025899 | Miscanthus Rhizosphere | MDDPENDPNANRFLPILLYVLGFMFALALAALVAGWLLRHL |
| Ga0207642_108588851 | 3300025899 | Miscanthus Rhizosphere | MDEDSGDRDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA |
| Ga0207680_100665142 | 3300025903 | Switchgrass Rhizosphere | MSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA |
| Ga0207685_102711752 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDRGDDPRNTPFLAILAYVLGFMGALALLAWVLARLMRH |
| Ga0207684_113743932 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGEPGDDPDKTPFLPILLYVLGFMGALALAALAVGWLLRHL |
| Ga0207649_105298482 | 3300025920 | Corn Rhizosphere | MSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHIA |
| Ga0207650_100416013 | 3300025925 | Switchgrass Rhizosphere | MSNEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA |
| Ga0207644_101664193 | 3300025931 | Switchgrass Rhizosphere | MDDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWVLKH |
| Ga0207644_105752771 | 3300025931 | Switchgrass Rhizosphere | MDDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA |
| Ga0207686_111697922 | 3300025934 | Miscanthus Rhizosphere | DEDPGDPDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA |
| Ga0207704_101019563 | 3300025938 | Miscanthus Rhizosphere | MDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA |
| Ga0207711_112147381 | 3300025941 | Switchgrass Rhizosphere | MDEDPGDPDEQDSARFLPILLYVLGFMVALALLAAAAAWLLK |
| Ga0207689_102948913 | 3300025942 | Miscanthus Rhizosphere | MDEPPDDDPRSTPFLAILLYVLGFMLALAVLALAAGWLLKRLA |
| Ga0207640_103059722 | 3300025981 | Corn Rhizosphere | MDEDPGDRDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA |
| Ga0207640_121380852 | 3300025981 | Corn Rhizosphere | DDPRSTPFLAILLYVLGFMLALAVLALAAGWLLKRLA |
| Ga0207641_100889993 | 3300026088 | Switchgrass Rhizosphere | MDDRGDDPRNTPFLAILAYVLGFMGALALLAWVLARLMRP |
| Ga0207641_102961713 | 3300026088 | Switchgrass Rhizosphere | MDDRGNDPRNTPFLAILAYVLGFMGALGLLAWLLARLMRH |
| Ga0207641_104645202 | 3300026088 | Switchgrass Rhizosphere | MDDPDDDPRQARFLPILLYVLGFMGALALLAFAAAWLLRRFG |
| Ga0207676_107167621 | 3300026095 | Switchgrass Rhizosphere | ARHPWMSDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA |
| Ga0207676_120316281 | 3300026095 | Switchgrass Rhizosphere | MRDEPPGDDPGRTPFLAILLYVLGFMFALALLALAAGWILKHLA |
| Ga0209880_11070582 | 3300026271 | Soil | LGGQAEDPQKTPFLSILLYVMGFMGGLALLAWAVAWLLR |
| Ga0209217_11027452 | 3300027651 | Forest Soil | LTPPEEDPRRTSLASLLLYVLGFMGILAVLAFLAVWLLRR |
| Ga0209009_100021625 | 3300027667 | Forest Soil | LGGQAEDPQKTRFLSILLYVMGFVGGLALLAWAVAWLLRHG |
| Ga0209011_10126432 | 3300027678 | Forest Soil | LTPPEEDPRRTSLASLLLYVLGFMGILAVLAFLAVWWLRR |
| Ga0209819_100114073 | 3300027722 | Freshwater Sediment | MDEDPDDPRSARFLPILLYVLGFMLALALLAAAAAWLLKRLG |
| Ga0209592_11079482 | 3300027731 | Freshwater Sediment | MDDGEGGDPRYARFLPILLYVLGFMAALALLALAAGWLLKRFG |
| Ga0209382_104535532 | 3300027909 | Populus Rhizosphere | MDEDPGDPDAQDSARFLPILLYVLGFMLALALLAAAAAWLLKRFA |
| Ga0209069_101151052 | 3300027915 | Watersheds | MSADPEDDPRNTPFLAILAYVLGFMGALALAAWIIARLLRRG |
| Ga0247822_105891072 | 3300028592 | Soil | MDDPGRAPGKTPFFPILLYVLGFMAILALAALAAAWLLRHL |
| Ga0247821_112097832 | 3300028596 | Soil | SMDEDPGDPDEQDSARFLPILLYVLGFMVALALLAAAAAWLLKRFA |
| Ga0307504_100641062 | 3300028792 | Soil | MDDPGEDPGENRFLPILFYVLGFMGALALLALAAAWLLRRL |
| Ga0247826_115831842 | 3300030336 | Soil | MDDPGRAPGKTPFLPILLYVLGFMAILALAALAAAWLLRHL |
| Ga0307506_100549722 | 3300031366 | Soil | MDDPGDDPRNTPFLAILAYVLGFMGALALLAWVLARLMRH |
| Ga0318560_103199292 | 3300031682 | Soil | MDDPEDDPNATRFLPILLYVLGFMFALALAALAAGWVLKHL |
| Ga0307469_101784092 | 3300031720 | Hardwood Forest Soil | MAETEPPEDNPRNTRFLSILLYVMGFMGGLALLAYAVAWLLRHR |
| Ga0307469_102625471 | 3300031720 | Hardwood Forest Soil | MPDDPRQTRFLSILIYVLGFMGALALLALAGAWLLRHLS |
| Ga0307469_106135062 | 3300031720 | Hardwood Forest Soil | MPDDPRQTPFLSMLLYVLGFMGALGLLALLGAWLLRRL |
| Ga0318566_103889412 | 3300031779 | Soil | SMDDPEDDPNATRFLPILLYVLGFMFALALAALAAGWVLKHL |
| Ga0315290_103778952 | 3300031834 | Sediment | MDDPGDDPRNTPFVAILAYVLGFMGALALLAWVLARLMRH |
| Ga0315905_111067532 | 3300032092 | Freshwater | MGDPGEEPGSPRFLPILLYVLGFMGAVALLALAVAWLLRRFG |
| Ga0307471_1004036552 | 3300032180 | Hardwood Forest Soil | MVETEPPEENPRNTPFLSILLYVMGFMGGLALLAYAVAWLLRHR |
| Ga0307471_1008945952 | 3300032180 | Hardwood Forest Soil | MSDDPRQTRFLSILIYVLGFMGALALLALAAAWLLRHLS |
| Ga0307471_1017716301 | 3300032180 | Hardwood Forest Soil | MGEPGDDPRETRFLSILLYVLGFMGALALAALAAAWLLRHF |
| Ga0307472_1004386822 | 3300032205 | Hardwood Forest Soil | MAETEPPGDNPRNTPFLSILLYVMGFMGGLALLAYAVAWLLRHR |
| Ga0307472_1020283552 | 3300032205 | Hardwood Forest Soil | LSDAPGGDPRNTPFLAILVYVLGFMLALALLAWLLARLLR |
| Ga0315287_126548041 | 3300032397 | Sediment | MSVDPEDDPRNTPFLALLAYVLGFMGALALAAWIIARLLRRA |
| Ga0315273_100284895 | 3300032516 | Sediment | VNDAPGDDDPRNTPFLSILLYVLGFMGALALLAWVLARLMRS |
| Ga0335082_102721622 | 3300032782 | Soil | VRRETDPTRTRFVSALLYVLGFMTALALLAYAAAWLLHRH |
| Ga0316605_114491502 | 3300033408 | Soil | MDDPEDDDPRYARFLPILLYVLGFMGALALLALAAGWLLRRFG |
| Ga0314866_089432_437_544 | 3300033807 | Peatland | DPRRTSFLAILLYVLGFMGALALAAWILAALLRRG |
| Ga0370479_0108196_443_574 | 3300034123 | Untreated Peat Soil | MDDPEDDDPRNARFLPILLYVLGFMAALALLALAAGWLLKRFA |
| Ga0364934_0139852_799_915 | 3300034178 | Sediment | MSDEPGDDDPRNTPFLAILLYVLGFMGALALAAWILARL |
| ⦗Top⦘ |