


| Basic Information | |
|---|---|
| Family ID | F054116 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 47 residues |
| Representative Sequence | CLVLDELLRELGVVFNPQTLHNPNATPSGTKEFDLSARWTWGHDRVM |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.29 % |
| % of genes from short scaffolds (< 2000 bps) | 96.43 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.143 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.143 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.286 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.67% β-sheet: 0.00% Coil/Unstructured: 81.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF00571 | CBS | 10.71 |
| PF01268 | FTHFS | 4.29 |
| PF13400 | Tad | 3.57 |
| PF03328 | HpcH_HpaI | 2.86 |
| PF01261 | AP_endonuc_2 | 2.86 |
| PF09861 | Lar_N | 2.14 |
| PF00753 | Lactamase_B | 2.14 |
| PF01855 | POR_N | 2.14 |
| PF13620 | CarboxypepD_reg | 1.43 |
| PF07638 | Sigma70_ECF | 1.43 |
| PF14690 | zf-ISL3 | 0.71 |
| PF01384 | PHO4 | 0.71 |
| PF01734 | Patatin | 0.71 |
| PF08532 | Glyco_hydro_42M | 0.71 |
| PF01837 | HcyBio | 0.71 |
| PF13360 | PQQ_2 | 0.71 |
| PF08388 | GIIM | 0.71 |
| PF02954 | HTH_8 | 0.71 |
| PF07969 | Amidohydro_3 | 0.71 |
| PF04989 | CmcI | 0.71 |
| PF13414 | TPR_11 | 0.71 |
| PF12543 | DUF3738 | 0.71 |
| PF00285 | Citrate_synt | 0.71 |
| PF13520 | AA_permease_2 | 0.71 |
| PF06723 | MreB_Mbl | 0.71 |
| PF02518 | HATPase_c | 0.71 |
| PF00069 | Pkinase | 0.71 |
| PF01545 | Cation_efflux | 0.71 |
| PF01527 | HTH_Tnp_1 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG2759 | Formyltetrahydrofolate synthetase | Nucleotide transport and metabolism [F] | 4.29 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 2.86 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.86 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 2.86 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 2.86 |
| COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 2.14 |
| COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 2.14 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.43 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.71 |
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.71 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.71 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.71 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.71 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.71 |
| COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.71 |
| COG1900 | Sulfur incorporation enzyme MA1821 (anaerobic homocysteine biosynthesis), HcyBio/DUF39 family | Amino acid transport and metabolism [E] | 0.71 |
| COG3510 | Cephalosporin hydroxylase | Defense mechanisms [V] | 0.71 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.71 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.71 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.14 % |
| Unclassified | root | N/A | 7.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459014|G1P06HT02FHKSG | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300000567|JGI12270J11330_10289796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300000789|JGI1027J11758_10887601 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300000891|JGI10214J12806_12256917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300000955|JGI1027J12803_103253491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300000956|JGI10216J12902_106143097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300002561|JGI25384J37096_10169743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300004013|Ga0055465_10328248 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005177|Ga0066690_10994796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300005332|Ga0066388_102567359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300005353|Ga0070669_100654773 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300005450|Ga0066682_10135863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1560 | Open in IMG/M |
| 3300005450|Ga0066682_10221357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1215 | Open in IMG/M |
| 3300005457|Ga0070662_101800923 | Not Available | 529 | Open in IMG/M |
| 3300005466|Ga0070685_10226914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1226 | Open in IMG/M |
| 3300005526|Ga0073909_10700438 | Not Available | 508 | Open in IMG/M |
| 3300005532|Ga0070739_10175219 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300005534|Ga0070735_10549882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300005540|Ga0066697_10100941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1681 | Open in IMG/M |
| 3300005558|Ga0066698_10138993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1633 | Open in IMG/M |
| 3300005558|Ga0066698_10391610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300005598|Ga0066706_10669485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300005713|Ga0066905_100875631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300005718|Ga0068866_11441861 | Not Available | 504 | Open in IMG/M |
| 3300005764|Ga0066903_101806293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1168 | Open in IMG/M |
| 3300005764|Ga0066903_108591133 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 520 | Open in IMG/M |
| 3300006162|Ga0075030_100123480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2104 | Open in IMG/M |
| 3300006162|Ga0075030_100637428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300006237|Ga0097621_101158105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300006794|Ga0066658_10755941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300006796|Ga0066665_10551032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
| 3300006796|Ga0066665_11587299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300006844|Ga0075428_100472947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1341 | Open in IMG/M |
| 3300006852|Ga0075433_10406947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
| 3300006903|Ga0075426_10453906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300007004|Ga0079218_10500740 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300007004|Ga0079218_11964269 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300007265|Ga0099794_10392859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300009012|Ga0066710_102021799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300009012|Ga0066710_102861346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300009012|Ga0066710_104760264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300009098|Ga0105245_11877953 | Not Available | 652 | Open in IMG/M |
| 3300009137|Ga0066709_100034036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5470 | Open in IMG/M |
| 3300009147|Ga0114129_11788214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300009147|Ga0114129_11982113 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300009162|Ga0075423_11739831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300009162|Ga0075423_11983775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300009553|Ga0105249_11507180 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300009609|Ga0105347_1212698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300009662|Ga0105856_1078273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300010043|Ga0126380_12191322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300010119|Ga0127452_1106608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300010141|Ga0127499_1187403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300010304|Ga0134088_10034865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2280 | Open in IMG/M |
| 3300010304|Ga0134088_10338228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300010358|Ga0126370_11101268 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300010358|Ga0126370_11769035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300010358|Ga0126370_12601363 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 506 | Open in IMG/M |
| 3300010362|Ga0126377_11506728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300010362|Ga0126377_13266182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300010398|Ga0126383_12830318 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 567 | Open in IMG/M |
| 3300010399|Ga0134127_12178542 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300010401|Ga0134121_12107016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 599 | Open in IMG/M |
| 3300010401|Ga0134121_12520952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300010905|Ga0138112_1058446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
| 3300011120|Ga0150983_12983299 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300011120|Ga0150983_14390917 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| 3300011120|Ga0150983_14817991 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300011120|Ga0150983_15035623 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300012172|Ga0137320_1126127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 544 | Open in IMG/M |
| 3300012211|Ga0137377_10317800 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300012211|Ga0137377_10911521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300012401|Ga0134055_1154427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1319 | Open in IMG/M |
| 3300012403|Ga0134049_1087545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300012403|Ga0134049_1254073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300012509|Ga0157334_1074819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300012899|Ga0157299_10099057 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300012906|Ga0157295_10008378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1757 | Open in IMG/M |
| 3300012914|Ga0157297_10310909 | Not Available | 597 | Open in IMG/M |
| 3300012923|Ga0137359_11100803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300012929|Ga0137404_12188901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300012930|Ga0137407_12109576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300012972|Ga0134077_10336596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300012989|Ga0164305_11571915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300013296|Ga0157374_10979094 | Not Available | 865 | Open in IMG/M |
| 3300014154|Ga0134075_10171112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 931 | Open in IMG/M |
| 3300014200|Ga0181526_10292725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1037 | Open in IMG/M |
| 3300014325|Ga0163163_10960824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300014325|Ga0163163_11056905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300014326|Ga0157380_12786054 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300014745|Ga0157377_10517488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300015358|Ga0134089_10008302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3274 | Open in IMG/M |
| 3300015371|Ga0132258_13859005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300015372|Ga0132256_101641833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300015374|Ga0132255_104660711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300015374|Ga0132255_104847483 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300016270|Ga0182036_10876298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300016294|Ga0182041_12005160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300016357|Ga0182032_10645247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300017656|Ga0134112_10069231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1299 | Open in IMG/M |
| 3300017656|Ga0134112_10457925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300017966|Ga0187776_11387294 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 535 | Open in IMG/M |
| 3300018468|Ga0066662_12329718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300018482|Ga0066669_10965346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300019458|Ga0187892_10149487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1310 | Open in IMG/M |
| 3300019487|Ga0187893_10609080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 691 | Open in IMG/M |
| 3300019487|Ga0187893_10820304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300019789|Ga0137408_1069423 | Not Available | 955 | Open in IMG/M |
| 3300020004|Ga0193755_1170240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300021171|Ga0210405_10321022 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300021178|Ga0210408_10261768 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300021178|Ga0210408_11075408 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 620 | Open in IMG/M |
| 3300021432|Ga0210384_11767578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 524 | Open in IMG/M |
| 3300021478|Ga0210402_11517235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300021479|Ga0210410_11364454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300021861|Ga0213853_10658258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300022504|Ga0242642_1010062 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300022531|Ga0242660_1006228 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300022533|Ga0242662_10242995 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 582 | Open in IMG/M |
| 3300022724|Ga0242665_10327697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300022726|Ga0242654_10098634 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300025934|Ga0207686_11470191 | Not Available | 561 | Open in IMG/M |
| 3300025936|Ga0207670_10321421 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300025961|Ga0207712_10773038 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300025986|Ga0207658_11160215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300026307|Ga0209469_1100199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300026313|Ga0209761_1231401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300026327|Ga0209266_1053157 | Not Available | 1980 | Open in IMG/M |
| 3300026524|Ga0209690_1172360 | Not Available | 737 | Open in IMG/M |
| 3300027910|Ga0209583_10553291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300028379|Ga0268266_12277553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300028536|Ga0137415_11345536 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300030706|Ga0310039_10330004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300031231|Ga0170824_110359850 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 533 | Open in IMG/M |
| 3300031231|Ga0170824_128369091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300031236|Ga0302324_102518325 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300031236|Ga0302324_102976998 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300031474|Ga0170818_101395324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300031573|Ga0310915_10595085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4 | 784 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.14% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.14% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.14% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.14% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.43% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.43% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.43% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.43% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.71% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.71% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.71% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010119 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010905 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2PV_00036920 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | RELGVIFTPARLHDPKATASGIKEFLITAKWTWGHDRVL |
| JGI12270J11330_102897961 | 3300000567 | Peatlands Soil | GVIFTPQTLHNPDAVPGGVKEFRLSARHPWGEDRVM* |
| JGI1027J11758_108876011 | 3300000789 | Soil | NGDGIEFPGLTYGNNVLDELLRELGVIFTPXKLHNPNATPSGKKEFDLSGRWTWGHDRVM |
| JGI10214J12806_122569172 | 3300000891 | Soil | NNVLDELLRELGVIFNPANLHNPNATPSGKKEYDLSGRWTWGHDRVM* |
| JGI1027J12803_1032534912 | 3300000955 | Soil | LGIVFNKQTLHNPKATPSGIKEFDISAKWTWGHDRVL* |
| JGI10216J12902_1061430971 | 3300000956 | Soil | LRELGIVFNPKTLHNPQATPTGVKEFDISAKWTWGHDRVL* |
| JGI25384J37096_101697432 | 3300002561 | Grasslands Soil | GCSVLDELLRELGVVFNPQTLHKPNSTTSGTKEFDLTARWTWGHDRVM* |
| Ga0055465_103282482 | 3300004013 | Natural And Restored Wetlands | GNTVLEDLLRELGVIFTPASLHNPNATPSGTKEFDLSGRWTWGHDRVM* |
| Ga0066690_109947961 | 3300005177 | Soil | GCAALEELLHELGVIFTPKTLHDPTATPGGVKEFALSARWTWGHDRVM* |
| Ga0066388_1025673591 | 3300005332 | Tropical Forest Soil | TYGCQSLEELLRELGIVFNAQTLHNPKATPSGIKEFDISAKWTWGHDRVM* |
| Ga0070669_1006547731 | 3300005353 | Switchgrass Rhizosphere | PGLTYGNAVLDELLRELGVIFTPAQLHNPNATPSGKKEFDLSGRWTWGHDRVM* |
| Ga0066682_101358633 | 3300005450 | Soil | RELGVVFNPQTLHKPNSTASGTKEFDLTARWTWGHDRVM* |
| Ga0066682_102213572 | 3300005450 | Soil | PGLSYGCSVLDELLRELGVVFNPQTLHNPDSTPSGTKEFDLTARWTWGHDRVM* |
| Ga0070662_1018009231 | 3300005457 | Corn Rhizosphere | SLDELLHELGVIYTPQTLHNPRATPSGKKEFTLSGRWTWGHDRIL* |
| Ga0070685_102269142 | 3300005466 | Switchgrass Rhizosphere | YGNAVLDELLRELGVIFTPAQLHNPNATPSGKKEFDLSGRWTWGHDRVM* |
| Ga0073909_107004381 | 3300005526 | Surface Soil | YGNPSLDELLHELGVIYTPKTLHNPKATPSGKKEFTLSGRWTWGHDRIL* |
| Ga0070739_101752191 | 3300005532 | Surface Soil | LGVIFNPQILHNPKATPNGIKEFVLSARWTWGHDRVM* |
| Ga0070735_105498822 | 3300005534 | Surface Soil | GLTYGCASLDELLRELGVVFSAAKLHDPNATPTGVKEFRLSARFPWGHERVM* |
| Ga0066697_101009414 | 3300005540 | Soil | IEFPGLSYGCSVLDELLRELGVVFNPQTLHKPNSTASGTKEFDLTARWTWGHDRVM* |
| Ga0066698_101389931 | 3300005558 | Soil | DELLRELGVVFNPQTLHNPNSTPSGTKEFDLTARWTWGHERVM* |
| Ga0066698_103916103 | 3300005558 | Soil | DELLRELGVVFNPQTLHNPNSTPSGTKEFDLTARWTWGHDRVM* |
| Ga0066706_106694851 | 3300005598 | Soil | IEFPGLTYGCPSLDELLRELGIVFNAQTLHNPNATPGGVKEFDISARWTWGHDRVM* |
| Ga0066905_1008756312 | 3300005713 | Tropical Forest Soil | DGIEFPGLTYGNNVLDELLRELGVIFTPANLHNPNATPSGKKEFDLSGRWTWGHDRVM* |
| Ga0068866_114418612 | 3300005718 | Miscanthus Rhizosphere | GNPSLDELLHELGVIYTPQTLHNPRATPSGKKEFTLSGRWTWGHDRIL* |
| Ga0066903_1018062931 | 3300005764 | Tropical Forest Soil | KDGMEFPGLTYGCASLEELLRELGIVFNKQTLHNPKATPSGIKEFDISAKWTWGHDRVM* |
| Ga0066903_1085911332 | 3300005764 | Tropical Forest Soil | DAIEFPALTYGSPVLEELLRELGVVFSPQILHNPKATVSGIKEFVLSARWTWGHDRIL* |
| Ga0075030_1001234803 | 3300006162 | Watersheds | LEALLREVGVVFTPAILHNPNATADGVKEFTLSAVNPWGHERVM* |
| Ga0075030_1006374281 | 3300006162 | Watersheds | YGSAPLEALLREVGVVFTPAVLHNPNATADGVKEFSLSAVDPWGHERVM* |
| Ga0097621_1011581052 | 3300006237 | Miscanthus Rhizosphere | LSYGNPMLEELLRELEVVFTPKTLHDPAATPDGVKEFRLSARWTWGHERVM* |
| Ga0066658_107559412 | 3300006794 | Soil | LTYGCPSLDELLRELGIVFNAQTLHNPNATPGGVKEFDISARWTWGHDRVM* |
| Ga0066665_105510321 | 3300006796 | Soil | IEFPGLSYGCSVLDELLRELGVVFNPQTLHKPNSTASGTKEIDLTARWTWGHDRVM* |
| Ga0066665_115872991 | 3300006796 | Soil | GLEFPQLTYGCPALEGLLHELGVIFTPKTLHDPTATPGGVKEFALSARWTWGHDRVM* |
| Ga0075428_1004729471 | 3300006844 | Populus Rhizosphere | TYGSASLEELLRELGIVFNKSTLHNPKATPSGTKEFDISAKWTWGHDRVM* |
| Ga0075433_104069472 | 3300006852 | Populus Rhizosphere | RELGIVFNKQTLHNPKATPSGTKEFDISAKWTWGHDRVM* |
| Ga0075426_104539061 | 3300006903 | Populus Rhizosphere | MEFPGLTYGSATLDVLMQELGVIYTPQTLHTPPATPGGMKEFRLSLRHPWGHERVM* |
| Ga0079218_105007403 | 3300007004 | Agricultural Soil | ELGVIFTPEKLHNANATANGVKEFDLSGRWTWGHDRIL* |
| Ga0079218_119642692 | 3300007004 | Agricultural Soil | LLRELGVIFTPAHLHNPNATPTGKKEFDLSGRWTWGHDRIL* |
| Ga0099794_103928592 | 3300007265 | Vadose Zone Soil | LLQEVGVIFNPQTLHDPDATPGGVKEFRLSARWPWAHERVM* |
| Ga0066710_1020217992 | 3300009012 | Grasslands Soil | DELMRELGIVFNPKTLHNPNATPSGVKEFDISAKWTWGHDRVM |
| Ga0066710_1028613461 | 3300009012 | Grasslands Soil | RESIEFPGLTYGSAALEELLRELGVVFTPATLHIPNTANGVKEFDLSSRWTWGHDRVM |
| Ga0066710_1047602641 | 3300009012 | Grasslands Soil | ELLRDLGVVFSPQVLHNPNATASGVKEFVLSAKWTWGHDRVM |
| Ga0105245_118779531 | 3300009098 | Miscanthus Rhizosphere | KIEFPGLSYGNPSLDELLHELGVIYTPQTLHNPRATPSGKKEFTLSGRWTWGHDRIL* |
| Ga0066709_1000340361 | 3300009137 | Grasslands Soil | GVVFNPQTLHNPDSTPSGTKEFDLTARWTWGHDRVM* |
| Ga0114129_117882142 | 3300009147 | Populus Rhizosphere | SLEELLRELGIVFNKSTLHNPKATPSGTKEFDISAKWTWGHDRVM* |
| Ga0114129_119821131 | 3300009147 | Populus Rhizosphere | LGVVFSPKTLHDPNATPSGVKEFVLSARWTWGHDRVM* |
| Ga0075423_117398311 | 3300009162 | Populus Rhizosphere | EELLRELGVIFTPKTLHDPNSTPGGVKEFALSARWTWGHDRVM* |
| Ga0075423_119837752 | 3300009162 | Populus Rhizosphere | SASLEELLRELGIVFNKSTLHNPKATPSGTKEFDISAKWTWGHDRVM* |
| Ga0116222_12076122 | 3300009521 | Peatlands Soil | LDVNGDGIEFPGLTYGCAALEELLRELGVIFTPLTLHNPDATPGGVKEFRLSARHPWGEDRVM* |
| Ga0105249_115071802 | 3300009553 | Switchgrass Rhizosphere | ELGVIFNPQSLHDPNSTPGGVKEFRLSARWTWGHDRVM* |
| Ga0105347_12126982 | 3300009609 | Soil | DELLRELGVIFTPTHLHNPNATPSRKKEFDLSGRWTWGHDRIL* |
| Ga0105856_10782731 | 3300009662 | Permafrost Soil | LREVGVVFTSATLHNPNATADGVKEFILSARDPWGHERVL* |
| Ga0126380_121913222 | 3300010043 | Tropical Forest Soil | EFPGLSYGCSVLDELLRELGVVFNPQTLHNPNSTPSGTKEFDLTARWTWGHDRVM* |
| Ga0127452_11066082 | 3300010119 | Grasslands Soil | PGLSYGCSVLDELLRELGVVFNPQTLHNPNSTPSGTKEFDLTARWTWGHDRVM* |
| Ga0127499_11874033 | 3300010141 | Grasslands Soil | GLSYGCSVLDELLRELGVVFNPQTLHNPNSTPSGTKEFDLTARWTWGHDRVM* |
| Ga0134088_100348652 | 3300010304 | Grasslands Soil | LRELGVVFNPQTLHNPNSTPSGTKEFDLTARWTWGHDRVM* |
| Ga0134088_103382282 | 3300010304 | Grasslands Soil | GCSVLDELLRELGVVFNPQTLHNPNSTPSGTKEFDLTARWTWGHERVM* |
| Ga0126370_111012681 | 3300010358 | Tropical Forest Soil | LGVVFSPQVLHNPKATPSGIKEFILSAKWTWGHDRVM* |
| Ga0126370_117690351 | 3300010358 | Tropical Forest Soil | LGVVFNAQTLHNPNATPTGVKEFELTARWTWGHDRVM* |
| Ga0126370_126013631 | 3300010358 | Tropical Forest Soil | SYGCSSLDELLRELGVVFSPQVLHNPKATPSGIKEFVLSAKWTWGHDRVM* |
| Ga0126377_115067282 | 3300010362 | Tropical Forest Soil | SYGCSVLDELLRELGVVFNPRTLHNPNATPSGTKEFDLTARWTWGHDRVM* |
| Ga0126377_132661821 | 3300010362 | Tropical Forest Soil | ELLRGLGVIFTPGSLHNLIGTASGSKEFDLSGRWSWGHDRVV* |
| Ga0126383_128303182 | 3300010398 | Tropical Forest Soil | SPVLEELLRELGVVFSPQILHNPKATVSGIKEFVLSARWTWGHDRIL* |
| Ga0134127_121785422 | 3300010399 | Terrestrial Soil | GVIFTPQNLHNPNATASGIKEFEVSARWTWGHDRVM* |
| Ga0134121_121070162 | 3300010401 | Terrestrial Soil | LREVGVIFSPQTLHNPNATASGVKEFLLSARWPWGEDRIL* |
| Ga0134121_125209522 | 3300010401 | Terrestrial Soil | LTYGNATLDELLRELGVVFNPQALHNPNATPSGVKEFELTARWTWGHDRVM* |
| Ga0138112_10584463 | 3300010905 | Grasslands Soil | RDGIEFPGLSYGCSVLDELLRELGVVFNPQTLHNPNSTPSGTKEFDLTARWTWGHDRVM* |
| Ga0150983_129832993 | 3300011120 | Forest Soil | GLTYGSPTLEDLLRELEVIFTPKTLHDPDATPNGVKEFRLSARWTWGHERVM* |
| Ga0150983_143909172 | 3300011120 | Forest Soil | RELGVIFTAKTLHDPNATPDGVKEFRLSARWTWAHERVM* |
| Ga0150983_148179912 | 3300011120 | Forest Soil | GNATLDELLRELGVVFNSQTLHNPNATPSGIKEFELTARWTWGHDRVL* |
| Ga0150983_150356231 | 3300011120 | Forest Soil | PGLTYGSATLEDLLRELEVIFSPQTLHNPNTTPNGVKEYRLSARWTWGHERVM* |
| Ga0137320_11261271 | 3300012172 | Soil | GIEFPGLTYGSTTLEELLRELGVVFSREVLHNPNATPSGTKEFLLSARWTWGHDRVL* |
| Ga0137377_103178001 | 3300012211 | Vadose Zone Soil | IFTPENLHNPNATPGGVKEFRLSARHPWGHDRVM* |
| Ga0137377_109115212 | 3300012211 | Vadose Zone Soil | HELGVIFTPKTLHDPTATPGGVKEFALSARWTWGHDRVM* |
| Ga0134055_11544273 | 3300012401 | Grasslands Soil | VVFNPQTLHNPNSTPSGTKDFDLSARWTWGHDRVM* |
| Ga0134049_10875451 | 3300012403 | Grasslands Soil | VVFNPQTLHNPDSTPSGTKEFDLTARWTWGHDRVM* |
| Ga0134049_12540732 | 3300012403 | Grasslands Soil | VFNPQTLHNPNSTPSGTKEFDLTARWTWGHDRVM* |
| Ga0157334_10748191 | 3300012509 | Soil | VIFTPQNLHNPKATASGIKEFEISARWTWGHDRVM* |
| Ga0157299_100990572 | 3300012899 | Soil | IEFPGLTYGNSVLDELLRELGVIFTPAQLHNPNATPSGKKEFDLSGRWTWGHDRVM* |
| Ga0157295_100083784 | 3300012906 | Soil | IYSPQTLHNPKATAGGKKEFTLSGRWTWGHDRIL* |
| Ga0157297_103109092 | 3300012914 | Soil | GNPSLDELLRELGVIYTPKTLHNPSATPSGKKEFTLSGRWTWGHDRIL* |
| Ga0137359_111008031 | 3300012923 | Vadose Zone Soil | EPLLHEVGVVFVAQTLHDPNTTPSGVKEFDLSARFPWGHERVM* |
| Ga0137404_121889012 | 3300012929 | Vadose Zone Soil | EFPGLTYGCAALEELLRELGVIFTPKTLHDPNATPGGVKEFALSARWTWGHERVM* |
| Ga0137407_121095762 | 3300012930 | Vadose Zone Soil | EFPGLTYGCAALEELLRELGVIFTPQNLHDPNSTPGGIKEFRLSARWTWGHDRVM* |
| Ga0134077_103365961 | 3300012972 | Grasslands Soil | GCAALDELLHELGVVFNPQTLHNPKATPSGIKEFDLSARWTWGHDRVM* |
| Ga0164305_115719152 | 3300012989 | Soil | LDVLMQELGVVYSPQSLHQPPQTPSGIKEFRLSARHPWGHDRVM* |
| Ga0157374_109790941 | 3300013296 | Miscanthus Rhizosphere | LDELLHELGVIYTPQTLHNPRATPSGKKEFTLSGRWTWGHDRIL* |
| Ga0134075_101711121 | 3300014154 | Grasslands Soil | ELGVVFNPQTLHNPNSTPSGTKEFDLTARWTWGHDRVM* |
| Ga0181526_102927251 | 3300014200 | Bog | CGSATLEVLLEELGVVFSPQTLHNPNATPSGVKEFDLSARYTWGNDRVM* |
| Ga0163163_109608241 | 3300014325 | Switchgrass Rhizosphere | EFPGLTYGCGSLDEILRELGVIFTPSVLHNANATPDGVKEFRLSARHPWGEDRVM* |
| Ga0163163_110569053 | 3300014325 | Switchgrass Rhizosphere | PSLTYGCTALEELLRELGVIFTPQNLHNPNATASGIKEFEVSARWTWGHDRVM* |
| Ga0157380_127860542 | 3300014326 | Switchgrass Rhizosphere | DGIEFPGLTYGNSVLDELLRELGVIFTPAQLHNPNATPSGKKEFDLSGRWTWGHDRVM* |
| Ga0157377_105174881 | 3300014745 | Miscanthus Rhizosphere | LLRELGIVFNKQTLHNPKATPSGVKEFDISAKWTWGHDRVM* |
| Ga0134089_100083021 | 3300015358 | Grasslands Soil | ELLRELGVVFNPQTLHKPNSTTSGTKEFDLTARWTWGHDRVM* |
| Ga0132258_138590052 | 3300015371 | Arabidopsis Rhizosphere | GSQILEDLLRELGVVFNAQTLHNPNATPSGVKEFRLSARWTWGHDRVM* |
| Ga0132256_1016418332 | 3300015372 | Arabidopsis Rhizosphere | IFTPAQLHNPNATPSGKKEFDLSGRWTWGHDRVM* |
| Ga0132255_1046607112 | 3300015374 | Arabidopsis Rhizosphere | VVFNPQILHNPKATPSGVKEFDISAKWTWGHDRVM* |
| Ga0132255_1048474832 | 3300015374 | Arabidopsis Rhizosphere | TVLDELLRELGVIFTPAQLHNPNATPSGKKEFDLSGRWTWGHDRVM* |
| Ga0182036_108762981 | 3300016270 | Soil | LRELGVVFNPQTLHNPKATATGVKEFDISAKWTWGHDRVM |
| Ga0182041_120051602 | 3300016294 | Soil | CLVLDELLRELGVVFNPQTLHNPNATPSGTKEFDLSARWTWGHDRVM |
| Ga0182032_106452472 | 3300016357 | Soil | YGNKTLDELLRELGVVFNTQTLHNPKATATGVKEFDISAKWTWGHHRVM |
| Ga0134112_100692312 | 3300017656 | Grasslands Soil | SVLDELLRELGVVFNPQTLHNPNSTPSGTKEFDLTARWTWGHDRVM |
| Ga0134112_104579252 | 3300017656 | Grasslands Soil | GVVFNPQSLHNPNATASGIKEFDLSSRWTWGHDRIL |
| Ga0187776_113872942 | 3300017966 | Tropical Peatland | EFPSLSYGCSSLDELLRELGVVFSPQVLHNPKATPSGIKEFVLSAKWTWGHDRAM |
| Ga0066662_123297181 | 3300018468 | Grasslands Soil | LTYGSTTLEMLLEELGVIFTPQTLHNPNATPDGVKEFRLSVRWPWGNERVM |
| Ga0066669_109653462 | 3300018482 | Grasslands Soil | ELLHELAVIFTPKTLHDPTATPGGVKEFALSARWTWGHDRVM |
| Ga0187892_101494873 | 3300019458 | Bio-Ooze | VNHDAIEFPGLTYGSATLEELLRELGAIFTPQILHNPNATPSGNKEFVLSAKWTWGHDRV |
| Ga0187893_106090802 | 3300019487 | Microbial Mat On Rocks | ERLLRELGVVFTAQTLHNPDATPSGVKEFRLSARWTWAHDRVM |
| Ga0187893_108203041 | 3300019487 | Microbial Mat On Rocks | ELGVIFTPQILHNPNATPSGNKEFVLSAKWTWGHDRVL |
| Ga0137408_10694231 | 3300019789 | Vadose Zone Soil | LRELGVVFNPQSLHNPNATASGIKEFDLSSRWTWGHDRIL |
| Ga0193755_11702401 | 3300020004 | Soil | LTYGNPTLERLLVELGVVFTPQNLHNPNATPSGRKEYILSARWTWGHDRVM |
| Ga0210405_103210221 | 3300021171 | Soil | LRELGVIFSSQALHNPNATADGVKEFRLSARWTWGHERVM |
| Ga0210408_102617681 | 3300021178 | Soil | LRELGVIFSPQALHNPNATPDGVKEFRLSARWTWGHERVM |
| Ga0210408_110754082 | 3300021178 | Soil | LEFPGLTYGSATLEELLRELGVIFTPKTLHNPNATPDGVKEFRLSARWTWGHERVM |
| Ga0210384_117675781 | 3300021432 | Soil | ALRDVNGDGIEFPGLTYGSAALEALLREVGVMFTPATLHNPNATATGVKEFSLSAVNPWGHERVL |
| Ga0210402_115172351 | 3300021478 | Soil | LEFPGLTYGSANLEELLRELGVIFNPQSLHNPNATPDGVKEFRLSARWTWGHERVM |
| Ga0210410_113644542 | 3300021479 | Soil | LLRELGVIFTPQTLHNPDATPDGVKEFRLSARWTWGHERVM |
| Ga0213853_106582581 | 3300021861 | Watersheds | SATLETLLRELGVIFTPQTLHNPNATPDGVKEFRLSARWTWAHERVM |
| Ga0242642_10100623 | 3300022504 | Soil | LEFPGLTYGSATLEELLRELGVIFTPKTLHDPNATPDGVKEFRLSARWTWAHERVM |
| Ga0242660_10062281 | 3300022531 | Soil | VIFTPKTLHNPNATPDGVKEFRLSARWTWGHERVM |
| Ga0242662_102429951 | 3300022533 | Soil | KTVVRDVNGDGLEFPGLTYGSATLETLLRELGVIFTPQTLHNPDATPDGVKEFRLSARWTWGHERVM |
| Ga0242665_103276972 | 3300022724 | Soil | CATLEMVLREVGVVFTPATLHNPNATADGVKEFILSARDPWGHERVL |
| Ga0242654_100986341 | 3300022726 | Soil | EKTVVRDVNGDGLEFPGLTYGSATLEELLRELGVIFTPKTLHDPNVTPDGVKEFRLSARWTWGHERVM |
| Ga0207686_114701912 | 3300025934 | Miscanthus Rhizosphere | LTYGNNVLDELLRELGVIFTPANLHNPHSTPSGKKEFDLSGRWTWGHDRVM |
| Ga0207670_103214212 | 3300025936 | Switchgrass Rhizosphere | ELLRELGVIFTPSQLHNPNATPSGKKEFDLSGRWTWGHDRVM |
| Ga0207712_107730381 | 3300025961 | Switchgrass Rhizosphere | AALEELMRELGIVFNKQTLHNPKATPSGTKEFDISAKWTWGHDRVM |
| Ga0207658_111602151 | 3300025986 | Switchgrass Rhizosphere | KVEVIFTPQTLHDPGATPNGVKEFRLSARWTWGHERVM |
| Ga0209469_11001993 | 3300026307 | Soil | LLRELGVVFNPQTLHNPNSTPSGTKEFDLTARWTWGHDRVM |
| Ga0209761_12314011 | 3300026313 | Grasslands Soil | DGIEFPGLSYGCSVLDELLRELGVVFNPQTLHNPNSTPSGTKEFDLTARWTWGHDRVM |
| Ga0209266_10531571 | 3300026327 | Soil | VLDELLRELGVVFNPQTLHNPNSTPSGTKEFDLTARWTWGHDRVM |
| Ga0209690_11723602 | 3300026524 | Soil | SYGCSVLDELLRELGVVFNPQTLHKPNSTASGTKEFDLTARWTWGHDRVM |
| Ga0209583_105532911 | 3300027910 | Watersheds | SYGNSLLDELLRELGVIFTPSRLHDPKATPSGKKEFDLSGRWTWGHDRVL |
| Ga0268266_122775532 | 3300028379 | Switchgrass Rhizosphere | EFLGLTYGNAVLDELLRELGVIFTPAQLHNPNATPSGKKEFDLSGRWTWGHDRVM |
| Ga0137415_113455361 | 3300028536 | Vadose Zone Soil | TDATEELLRELGVIFTPKTLHDPNVTPDGVKEFRLSARWTWGHERVM |
| Ga0310039_103300041 | 3300030706 | Peatlands Soil | ELGVIFTPQTLHNPDAVPGGVKEFRLSARHPWGEDRVM |
| Ga0170824_1103598502 | 3300031231 | Forest Soil | EELLRELGVIFTPKTLHDPNATPDGVKEFRLSARWTWGHERVM |
| Ga0170824_1283690912 | 3300031231 | Forest Soil | GNATLDELLRELGVVFNPQTLHNPKATPSGVKEFDISAKWTWGHDRVM |
| Ga0302324_1025183251 | 3300031236 | Palsa | LTYGSAVLEELLRELEVVFTPQVLHNPDATPGGIKEFSLSARWTWGHERVM |
| Ga0302324_1029769983 | 3300031236 | Palsa | PGLTYGCPAVDELLRELGVVFSPAVLHNPNATPSGVKEFILSARWTWGHDRVL |
| Ga0170818_1013953241 | 3300031474 | Forest Soil | TLLRELGVIFTPQTLHNPDATPDGVKEFRLSARWTWGHERVM |
| Ga0310915_105950851 | 3300031573 | Soil | DSIEFPGLTYGNPALEALLHEVGVVFKPATLHDPNATPDGVKEFSLSARHPWGHERVM |
| ⦗Top⦘ |