


| Basic Information | |
|---|---|
| Family ID | F053924 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MNERKLDHGSRINTADEGTLERSVGPSIFESLDDGLVSKPVTPSAAA |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 57.86 % |
| % of genes near scaffold ends (potentially truncated) | 46.43 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.286 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (35.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF06147 | DUF968 | 14.29 |
| PF04404 | ERF | 2.14 |
| PF13489 | Methyltransf_23 | 1.43 |
| PF09588 | YqaJ | 1.43 |
| PF08241 | Methyltransf_11 | 0.71 |
| PF01381 | HTH_3 | 0.71 |
| PF02321 | OEP | 0.71 |
| PF01370 | Epimerase | 0.71 |
| PF00872 | Transposase_mut | 0.71 |
| PF13358 | DDE_3 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.43 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.29 % |
| Unclassified | root | N/A | 0.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004629|Ga0008092_11315960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300005179|Ga0066684_10594538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
| 3300005332|Ga0066388_101219148 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300005435|Ga0070714_101997311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300005467|Ga0070706_100951651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 793 | Open in IMG/M |
| 3300005574|Ga0066694_10307180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 755 | Open in IMG/M |
| 3300005713|Ga0066905_100137415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1737 | Open in IMG/M |
| 3300005764|Ga0066903_100068938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4504 | Open in IMG/M |
| 3300005764|Ga0066903_100232727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2813 | Open in IMG/M |
| 3300005764|Ga0066903_100818557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1669 | Open in IMG/M |
| 3300005764|Ga0066903_103200911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
| 3300005764|Ga0066903_103442420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 853 | Open in IMG/M |
| 3300005764|Ga0066903_104332430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300005764|Ga0066903_105052433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 699 | Open in IMG/M |
| 3300005764|Ga0066903_105065813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300005764|Ga0066903_105612613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300005764|Ga0066903_105626938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 659 | Open in IMG/M |
| 3300005764|Ga0066903_106614862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 603 | Open in IMG/M |
| 3300005764|Ga0066903_108257797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300006796|Ga0066665_11167375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 587 | Open in IMG/M |
| 3300006852|Ga0075433_11341788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 619 | Open in IMG/M |
| 3300006854|Ga0075425_100821012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1065 | Open in IMG/M |
| 3300007258|Ga0099793_10459024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 630 | Open in IMG/M |
| 3300007788|Ga0099795_10201971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
| 3300009137|Ga0066709_103205411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300009147|Ga0114129_10442777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1705 | Open in IMG/M |
| 3300009147|Ga0114129_12696639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 592 | Open in IMG/M |
| 3300009792|Ga0126374_10212800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1233 | Open in IMG/M |
| 3300009792|Ga0126374_10717535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 754 | Open in IMG/M |
| 3300009792|Ga0126374_11059620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300009792|Ga0126374_11157214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300010043|Ga0126380_11322105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300010046|Ga0126384_10105346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2090 | Open in IMG/M |
| 3300010047|Ga0126382_10404728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1066 | Open in IMG/M |
| 3300010047|Ga0126382_11065093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 714 | Open in IMG/M |
| 3300010047|Ga0126382_11577185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300010047|Ga0126382_12117426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300010047|Ga0126382_12435611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 509 | Open in IMG/M |
| 3300010048|Ga0126373_10239936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1778 | Open in IMG/M |
| 3300010048|Ga0126373_11837200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 669 | Open in IMG/M |
| 3300010048|Ga0126373_11844148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 668 | Open in IMG/M |
| 3300010048|Ga0126373_12564957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
| 3300010048|Ga0126373_13253830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300010321|Ga0134067_10447715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300010358|Ga0126370_10357470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1183 | Open in IMG/M |
| 3300010358|Ga0126370_11361045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300010359|Ga0126376_10107382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2144 | Open in IMG/M |
| 3300010359|Ga0126376_11859476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300010359|Ga0126376_12446790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 569 | Open in IMG/M |
| 3300010359|Ga0126376_13151925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 510 | Open in IMG/M |
| 3300010360|Ga0126372_10281596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1448 | Open in IMG/M |
| 3300010360|Ga0126372_10387972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1269 | Open in IMG/M |
| 3300010361|Ga0126378_10518500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1307 | Open in IMG/M |
| 3300010361|Ga0126378_10561762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1256 | Open in IMG/M |
| 3300010361|Ga0126378_12298507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 615 | Open in IMG/M |
| 3300010361|Ga0126378_13089460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300010361|Ga0126378_13202686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 521 | Open in IMG/M |
| 3300010362|Ga0126377_10476717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1275 | Open in IMG/M |
| 3300010366|Ga0126379_11981548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300010366|Ga0126379_12290810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300010366|Ga0126379_13188521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300010366|Ga0126379_13656091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300010376|Ga0126381_103543496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 613 | Open in IMG/M |
| 3300010376|Ga0126381_103605261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
| 3300010376|Ga0126381_104325104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 550 | Open in IMG/M |
| 3300010376|Ga0126381_105089152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300010398|Ga0126383_10231255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1799 | Open in IMG/M |
| 3300010398|Ga0126383_10793195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
| 3300010398|Ga0126383_11059675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
| 3300010398|Ga0126383_11859980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
| 3300010398|Ga0126383_12544859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 596 | Open in IMG/M |
| 3300011270|Ga0137391_10581327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 941 | Open in IMG/M |
| 3300012199|Ga0137383_10167143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1612 | Open in IMG/M |
| 3300012202|Ga0137363_10052652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2925 | Open in IMG/M |
| 3300012206|Ga0137380_10624499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
| 3300012208|Ga0137376_11684747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 525 | Open in IMG/M |
| 3300012210|Ga0137378_11115321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300012211|Ga0137377_10296723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1551 | Open in IMG/M |
| 3300012351|Ga0137386_11306903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 502 | Open in IMG/M |
| 3300012355|Ga0137369_11065552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 531 | Open in IMG/M |
| 3300012356|Ga0137371_11299017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 538 | Open in IMG/M |
| 3300012358|Ga0137368_10694614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300012359|Ga0137385_10485385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1046 | Open in IMG/M |
| 3300012360|Ga0137375_10716044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 815 | Open in IMG/M |
| 3300012361|Ga0137360_10543078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 992 | Open in IMG/M |
| 3300012361|Ga0137360_10933137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
| 3300012923|Ga0137359_10095736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2619 | Open in IMG/M |
| 3300012929|Ga0137404_11487793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 626 | Open in IMG/M |
| 3300012930|Ga0137407_11977215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300012948|Ga0126375_10321650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1084 | Open in IMG/M |
| 3300012948|Ga0126375_11033923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 671 | Open in IMG/M |
| 3300012948|Ga0126375_11782032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 537 | Open in IMG/M |
| 3300012971|Ga0126369_10710265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1083 | Open in IMG/M |
| 3300012971|Ga0126369_12441349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300012984|Ga0164309_11168616 | Not Available | 644 | Open in IMG/M |
| 3300015371|Ga0132258_12159865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1398 | Open in IMG/M |
| 3300015372|Ga0132256_102523961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300016294|Ga0182041_12070114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 531 | Open in IMG/M |
| 3300016387|Ga0182040_11843860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 518 | Open in IMG/M |
| 3300016404|Ga0182037_11024356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 720 | Open in IMG/M |
| 3300016404|Ga0182037_11855996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300018468|Ga0066662_12705739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 525 | Open in IMG/M |
| 3300018482|Ga0066669_11373729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 640 | Open in IMG/M |
| 3300021560|Ga0126371_11840882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
| 3300021560|Ga0126371_13679668 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300031572|Ga0318515_10455287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 684 | Open in IMG/M |
| 3300031573|Ga0310915_10035150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3156 | Open in IMG/M |
| 3300031744|Ga0306918_10001046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 13495 | Open in IMG/M |
| 3300031744|Ga0306918_10291992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1254 | Open in IMG/M |
| 3300031747|Ga0318502_10738004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300031770|Ga0318521_10653807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 637 | Open in IMG/M |
| 3300031793|Ga0318548_10426825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300031795|Ga0318557_10065162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1563 | Open in IMG/M |
| 3300031819|Ga0318568_10795728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300031821|Ga0318567_10209023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1091 | Open in IMG/M |
| 3300031833|Ga0310917_10540458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 792 | Open in IMG/M |
| 3300031833|Ga0310917_11036873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300031845|Ga0318511_10179262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 936 | Open in IMG/M |
| 3300031846|Ga0318512_10317716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 776 | Open in IMG/M |
| 3300031860|Ga0318495_10413081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 594 | Open in IMG/M |
| 3300031860|Ga0318495_10461258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300031879|Ga0306919_10026330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3603 | Open in IMG/M |
| 3300031890|Ga0306925_10062595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3903 | Open in IMG/M |
| 3300031897|Ga0318520_10047988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → unclassified Candidatus Melainabacteria → Candidatus Melainabacteria bacterium GWA2_34_9 | 2231 | Open in IMG/M |
| 3300031912|Ga0306921_11363848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 781 | Open in IMG/M |
| 3300031912|Ga0306921_11680592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300031912|Ga0306921_11849002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 648 | Open in IMG/M |
| 3300031942|Ga0310916_11282450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300031942|Ga0310916_11553867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 538 | Open in IMG/M |
| 3300031945|Ga0310913_10274178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1187 | Open in IMG/M |
| 3300031946|Ga0310910_10140549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1838 | Open in IMG/M |
| 3300031946|Ga0310910_10993430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300031947|Ga0310909_11424216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300031954|Ga0306926_10157710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2812 | Open in IMG/M |
| 3300031954|Ga0306926_12266253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300032035|Ga0310911_10002086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 8069 | Open in IMG/M |
| 3300032035|Ga0310911_10845913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300032063|Ga0318504_10413549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 643 | Open in IMG/M |
| 3300032076|Ga0306924_12232052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300032261|Ga0306920_100138395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3625 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 35.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0008092_113159601 | 3300004629 | Tropical Rainforest Soil | NERKLQHGSRIDAAYEGTLECSLGPNFFNVPNNGLVGEPVTPSAAA* |
| Ga0066684_105945382 | 3300005179 | Soil | SMNERKLEHGSGIDAADESTLKRSVGSNIFAVVNDGLVSKAVAPGAPA* |
| Ga0066388_1012191481 | 3300005332 | Tropical Forest Soil | MNERKLDHGSRIHAADEDTLERSVASNMFESRNDGLVSKPITPSAAA* |
| Ga0070714_1019973113 | 3300005435 | Agricultural Soil | ERKLDHGSRINTADEGTLERSVGANIFESLNDGLVSKAVTPCAAA* |
| Ga0070706_1009516512 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNERKFEQGSRINTADEGTLERSVGANIFESLNDGLVSKAVTPCAAA* |
| Ga0066694_103071803 | 3300005574 | Soil | MNERKLEHGSRINTADEGTLEPSVGSNIFKSLNDGL |
| Ga0066905_1001374153 | 3300005713 | Tropical Forest Soil | MNERKFDHGSRIDTSDEGTLERSIGPNIFEIINDGLVS |
| Ga0066903_1000689384 | 3300005764 | Tropical Forest Soil | MNELEPDHGSRINTADEGTLKRSVGPHIFKSLDDGLVSKAAAPSAAV* |
| Ga0066903_1002327276 | 3300005764 | Tropical Forest Soil | MNELKLEHGSRVNTADEGALECSVGADIFTSLNDGLVSKPV |
| Ga0066903_1008185572 | 3300005764 | Tropical Forest Soil | MNERKFDYGPRIDTADERTLERTVGSSIFESLNDGLVSKPVTPSAA* |
| Ga0066903_1032009112 | 3300005764 | Tropical Forest Soil | MNERTFEQGSRINTADEGTLERSVGAGIFKILNDGLVSKPVTPGSAASVLQINTGKV* |
| Ga0066903_1034424202 | 3300005764 | Tropical Forest Soil | MKELKFYHRPRIADEGTFERSVGPNMFEILNDGLVSKPVAPNAAA* |
| Ga0066903_1043324302 | 3300005764 | Tropical Forest Soil | MNERKLERGSRINTADEGTLERPIASNIFESLNDGLVSKPIAQSASARSAAFALGIDTGKV* |
| Ga0066903_1050524331 | 3300005764 | Tropical Forest Soil | MNERKLERASRINTADEGTLERPIASNIFESLNDGLVSKPIAPSAAARSAAF |
| Ga0066903_1050658131 | 3300005764 | Tropical Forest Soil | KLDHLIEVNTGDDGTLERSVGPDIFENLNDGLVSKPVTPNAAA* |
| Ga0066903_1056126132 | 3300005764 | Tropical Forest Soil | MNERKLERRSRISTADEGTLERPIASNIFESFSDGLVSKSIAPSAAARSAAFALGIDTGKV* |
| Ga0066903_1056269381 | 3300005764 | Tropical Forest Soil | MNERKFEQGSRINAADEGTLERSVGAGIFKILNDGLVSKPVTPSATA* |
| Ga0066903_1066148621 | 3300005764 | Tropical Forest Soil | MNERKFDYGSRIDAADEGTLERSVGSGIFEIPNDGLISEPVPPSAAT* |
| Ga0066903_1082577972 | 3300005764 | Tropical Forest Soil | MNERKLERGSRINTADEGTLERPIASNIFESLNGGLVSKPIAPSAAARSAAFARGIDTGKV* |
| Ga0066665_111673751 | 3300006796 | Soil | MNERKFEQGSRINTADEGTLERSVGANIFESLNDGLVSKAVTPCAAAWSAACAPGM |
| Ga0075433_113417881 | 3300006852 | Populus Rhizosphere | MNERKFEQGSRINTADEGTLERSVGANIFESLNDGLVSKPVTP |
| Ga0075425_1008210121 | 3300006854 | Populus Rhizosphere | RIDAADEGTLERSVGANIFESLNDGLVSKAVTPCAAA* |
| Ga0099793_104590242 | 3300007258 | Vadose Zone Soil | MNERKLERGSRINTADEGTLERPIASNIFESFNDGLVSKPIAPSAAARSAAFALGIDTGKV* |
| Ga0099795_102019711 | 3300007788 | Vadose Zone Soil | MTERKLNHRSRINTADESPFERSVGANIYEILNDGLISETGTPSAAA* |
| Ga0066709_1032054111 | 3300009137 | Grasslands Soil | QLDHGSGINTADEGALERSIGSNMFESRNDGLVGKPVTPGATA* |
| Ga0114129_104427771 | 3300009147 | Populus Rhizosphere | MSERKLEHGSGINTADEGALERSVGAGIFKSRNDELVSKPVTPSAAA* |
| Ga0114129_126966391 | 3300009147 | Populus Rhizosphere | MNERKLDHGSRINTADEGTLERSVGPSIFESLDDGLVSKPVTPSAAA* |
| Ga0126374_102128002 | 3300009792 | Tropical Forest Soil | MNECKLDHRSRIDTAGEGTLECSVGPNIFDNLNDGLVSKPIAPSAAA* |
| Ga0126374_107175351 | 3300009792 | Tropical Forest Soil | MNERKLQHGSRINTADEGTLECSVGADIFERLNDRLVSKPVAPSAAA |
| Ga0126374_110596202 | 3300009792 | Tropical Forest Soil | LDRGARINTADEDTLERSVGWNVLETANDGLVSKPITPSAAA* |
| Ga0126374_111572142 | 3300009792 | Tropical Forest Soil | MNKLKLDHGSRINTSDEGTLERSVRPNIFESLNDRLVGKSVTPSATAWSAASVLQINTGKV* |
| Ga0126380_113221051 | 3300010043 | Tropical Forest Soil | MNERKLDHGSRIHTADEDTLECSVGSNMFESRNDGLVSKPITPSAAA* |
| Ga0126384_101053462 | 3300010046 | Tropical Forest Soil | MNERKLDHGSRINTADEGTLKRSVGPNMFETRNDGLVSKPITPSAAA* |
| Ga0126382_104047281 | 3300010047 | Tropical Forest Soil | MNERKFDYGSRIDTADEGTLERSVGSGIFEIPNDGLISEPVPPSAAT* |
| Ga0126382_110650931 | 3300010047 | Tropical Forest Soil | MNERKLDHGSRINTADEGTLEPSVRADIFESLNDGLVSKPITPTAAA* |
| Ga0126382_115771851 | 3300010047 | Tropical Forest Soil | MSERKLEHGSGINTADEGALERSVGPGIFKSRNDGLVSKPVTPSAA |
| Ga0126382_121174261 | 3300010047 | Tropical Forest Soil | MNERKFDHGSRIDTSDEGTLERSIGPNIFEIINDGLVSNALMPCAAT* |
| Ga0126382_124356111 | 3300010047 | Tropical Forest Soil | MNERKLEHGSRLDTADKGALERSVGSNIFVSLDDGLVGEPITPCAAA* |
| Ga0126373_102399363 | 3300010048 | Tropical Forest Soil | MNKLKLDHGSRINTSDEGTLERSVGPNTFESLDDGLVSKPVTPSVAA* |
| Ga0126373_118372002 | 3300010048 | Tropical Forest Soil | MNERKLERASRINTADEGTLERPIASNIFESLNDGLVSKPVTPGATA* |
| Ga0126373_118441481 | 3300010048 | Tropical Forest Soil | MDERKLDHGSRIHTADEDTLERSVGPNIFKSLNHRLISKPVTPGAAA* |
| Ga0126373_125649572 | 3300010048 | Tropical Forest Soil | SYSMNDRKLQHGSRINTGDEGALKSSVGSGIFEIPNDNLISEPVTPSAAA* |
| Ga0126373_132538301 | 3300010048 | Tropical Forest Soil | QQACQPMNECKLDHGSRINTADEDTLERSVGSNVFEIGNDGLVSKPITPSAAA* |
| Ga0134067_104477151 | 3300010321 | Grasslands Soil | QLDHGSGINTADEGALERSIGSNMFESRNDGLVCKPVTPGATA* |
| Ga0126370_103574701 | 3300010358 | Tropical Forest Soil | SPQQACQPMNERKLDHGSRINTADEDTLERSVGSNVFETANDGLVSKPITPSAAA* |
| Ga0126370_113610452 | 3300010358 | Tropical Forest Soil | MHERKLDRCSRINAADEGTLERSVGPDIFKVPNDSLISEPVTPSAVT* |
| Ga0126376_101073822 | 3300010359 | Tropical Forest Soil | MNERKLERGSSINTADEGTLERPIASNIFESLNDGLVSKPIAPSAAARSAAFALGIDTGKV* |
| Ga0126376_118594761 | 3300010359 | Tropical Forest Soil | MSECKLEYGSRINTADEGALERSVGSSIFEMPDDSLISKPVTPSATA* |
| Ga0126376_124467901 | 3300010359 | Tropical Forest Soil | MNERKLQHGSRINTADEGTLECSVGADIFERLNDRLVSKPVAPSAAARSAAFALRIDTGKVRDILLGRFGGSPH |
| Ga0126376_131519251 | 3300010359 | Tropical Forest Soil | MNERKLDHGSRINTGDEGALECPVGSNMFEILNDGLVGKPVTPSAAA* |
| Ga0126372_102815962 | 3300010360 | Tropical Forest Soil | EHGSGINTADEGALERSVGAGIFKSRNDGLVSKPVAPSAAA* |
| Ga0126372_103879721 | 3300010360 | Tropical Forest Soil | MNERKLDHGSRINAADKGALECSVGANVFERPNSRLVSKPVTPSVAA* |
| Ga0126378_105185001 | 3300010361 | Tropical Forest Soil | MNERKLDHRSRIDTADEGTFERSVGSGIFEIPNDGLISEPVTPSAAT* |
| Ga0126378_105617622 | 3300010361 | Tropical Forest Soil | MDERKLDHGSRIHTADEDTLERSVGSKVFEIVNDGLISKPITPSAAA* |
| Ga0126378_122985071 | 3300010361 | Tropical Forest Soil | VSERKLKRGSRINTGDEGAFERSVGPNMFESLDDGLVSKAVTPSAAA* |
| Ga0126378_130894601 | 3300010361 | Tropical Forest Soil | PQQACQPMNECKLDHGSRINTADEDTLERSVGSNVFEIGNDGLVSKPITPSAAA* |
| Ga0126378_132026861 | 3300010361 | Tropical Forest Soil | MNERKFDYGSRIDAADEGTLERSVGSGIFEIPNDGLISE |
| Ga0126377_104767171 | 3300010362 | Tropical Forest Soil | MSECKLDDGSRINAADEGTLERSVGSDTFESRDDGLVGKAVTPRPAA* |
| Ga0126379_119815481 | 3300010366 | Tropical Forest Soil | EEACHPISELELDHGPRINTADEATLERSVAPKMFEILNDGLVSKPVTPTAAA* |
| Ga0126379_122908102 | 3300010366 | Tropical Forest Soil | MNERKLQHGSRINTGDEGALKRSVGSGIFEIPNDNLISEPVTPSAAA* |
| Ga0126379_131885211 | 3300010366 | Tropical Forest Soil | TERKLDHGSRINTADEGTLERSVGSGIFEIPNDGLISEPVPPSAAT* |
| Ga0126379_136560911 | 3300010366 | Tropical Forest Soil | KLDHGSRINTADEDTLERSVGSNVFERRNDGLVSKPVTPSAAA* |
| Ga0126381_1035434961 | 3300010376 | Tropical Forest Soil | MNERKLDRGSGINTADEGTLERSVGANIFESPNDGFVSKPITPSAAA* |
| Ga0126381_1036052611 | 3300010376 | Tropical Forest Soil | MNERKLDHGSRINTADEDTLERSVGSNVFERRNDGLVSKPVTPSAAA* |
| Ga0126381_1043251041 | 3300010376 | Tropical Forest Soil | MNERKFDQRSRIDAADEGTLERSVAPSIFESLNDG |
| Ga0126381_1050891522 | 3300010376 | Tropical Forest Soil | DHGSRINTADEDTLERSVGSNVFEIANDGLVSKLITPSAAA* |
| Ga0126383_102312552 | 3300010398 | Tropical Forest Soil | MSERKLEHGSGINTADEGALERSVGAGIFKSRNDGLVSKPVTPSAAV* |
| Ga0126383_107931952 | 3300010398 | Tropical Forest Soil | MHERKLQHGSRINTGDEGALKRSVGSGIFEIPNDSLISEPVTPSAAA* |
| Ga0126383_110596752 | 3300010398 | Tropical Forest Soil | MNERKLDHGSRIHAADEDTLERSVGSNMFESRNDGLVSKPITPSAAA* |
| Ga0126383_118599802 | 3300010398 | Tropical Forest Soil | CQPMNERKLDHGSRINTADEDTLERSVGSNVFEIANDGLVSEPVTPSAAA* |
| Ga0126383_125448591 | 3300010398 | Tropical Forest Soil | MNELKLDHGSRINTSDEGTLERSVRPNIFESLNDRLVGKSVTPSAAAWSAASVLQINTGKV* |
| Ga0137391_105813271 | 3300011270 | Vadose Zone Soil | MNERKLDHCSRINIADQATLQRSVGPNIFKGLDDGLISKAVAPTAAA* |
| Ga0137383_101671433 | 3300012199 | Vadose Zone Soil | MNERKLEHGSRINSADEGALERSVGPNIFESLDDGLVSESVTPSAAT* |
| Ga0137363_100526522 | 3300012202 | Vadose Zone Soil | MNERKLERGSRINTADEGTLERPIASNIFESFNDGLVSKPVTPGATA* |
| Ga0137380_106244991 | 3300012206 | Vadose Zone Soil | MNERKFDHGSRIDTADKDTLERSVGPNMFESLDDGLVSKPVTPSAAA* |
| Ga0137376_116847471 | 3300012208 | Vadose Zone Soil | MNERKLEHGSRINSADEGALERSVGPNMFESLDDGLVSKAVTPCAAA* |
| Ga0137378_111153211 | 3300012210 | Vadose Zone Soil | MDELKLQHGSRINTADEDALECSVGANIFERLNDRLVSKPVMPSAAA* |
| Ga0137377_102967232 | 3300012211 | Vadose Zone Soil | MNERKLEHGSRINSADEGALERSVGPNIFESLDDGLVSESVTPSAAA* |
| Ga0137386_113069031 | 3300012351 | Vadose Zone Soil | MNERKLEHGSRINTADEGTLERSVGANIFESLNDGLVSKAVTPCAAA* |
| Ga0137369_110655521 | 3300012355 | Vadose Zone Soil | MNERKLEHGSRINTAQEGALERSVGPNIFEIPNNGLVSKPITP |
| Ga0137371_112990171 | 3300012356 | Vadose Zone Soil | MNERKFDRGPRINAADESALERSVGSNIFEIVDDGLISETVTPGAAA* |
| Ga0137368_106946142 | 3300012358 | Vadose Zone Soil | MNERKLEHGSRINTAQEGALERSVGPNIFEIPNNGLVSKPITSSAAALSAGFALQINPGKV* |
| Ga0137385_104853851 | 3300012359 | Vadose Zone Soil | MNERKLDHGSRINTADEGTLERSVRPSIFETINDGLVSKPVTPSAAA* |
| Ga0137375_107160442 | 3300012360 | Vadose Zone Soil | MNERKLDHGSRINTADEGTLERSVGANIFVIPNDGLLSKPVTPSAAA* |
| Ga0137360_105430782 | 3300012361 | Vadose Zone Soil | PMNERKLDHGSRINTADEGTLERSVGPSIFESLDDGLVSKPVTPSAAA* |
| Ga0137360_109331371 | 3300012361 | Vadose Zone Soil | MNERKLQHGSRINTADEGALEPSVGPNILESLDDGLVSKPVTPSAAA* |
| Ga0137359_100957366 | 3300012923 | Vadose Zone Soil | MNERKLERGSRINTADEGTLERPIASNIFERLNDSLVGKPIAKRGGAIGGVC |
| Ga0137404_114877931 | 3300012929 | Vadose Zone Soil | MNERKLEHGSRINTADEGTLERSVGSNIFEILDDGLVGESITPSAPA* |
| Ga0137407_119772152 | 3300012930 | Vadose Zone Soil | IDAADEGPLEHSVGPNIFEIANYGLVSEPITPSAAA* |
| Ga0126375_103216502 | 3300012948 | Tropical Forest Soil | MNERKLQHGSRINTADEGTLERAVGSNIFENLNDGLVSKPVTPRAAA* |
| Ga0126375_110339231 | 3300012948 | Tropical Forest Soil | MNERKFEQGSRINTADEGTRERSVEAGIFKILNDGLVSKPVTPSATA* |
| Ga0126375_117820321 | 3300012948 | Tropical Forest Soil | MNERKLQHGSRIDAADEGTLECSVGPSIFESLNDGLVSKPVTPCAAV* |
| Ga0126369_107102651 | 3300012971 | Tropical Forest Soil | MNERKFEQGSRINAADGGTLERSVGAGIFKILNDGLVSKPVTPSATA* |
| Ga0126369_124413491 | 3300012971 | Tropical Forest Soil | QQACQPMNELELDHCSRINTADEDTLERSVGPNIFEIPNDGLVGKPVAPNTAA* |
| Ga0164309_111686162 | 3300012984 | Soil | LRISTADESALERSVGPNIFETLNDGLVSKPVTPSVAA* |
| Ga0132258_121598651 | 3300015371 | Arabidopsis Rhizosphere | MNERKLQHGAGIDAADESTLVGSVGSNIFETVNDGLVSETVTPGAPA* |
| Ga0132256_1025239611 | 3300015372 | Arabidopsis Rhizosphere | RISTADEDTLERSVGPNIFEIRNYGLLAEPIAPSAAA* |
| Ga0182041_120701141 | 3300016294 | Soil | MNERKLDRCSRINTADEGTLERSVRPNIFESLDDGLV |
| Ga0182040_118438601 | 3300016387 | Soil | MNERKLDHGSRIDAADEGTLERPVGPNFFNVPNNGLVGEPITPSAAT |
| Ga0182037_110243561 | 3300016404 | Soil | MNECKLDHGSRINTANEDTLERSVGSNVFEIANDGLVSKP |
| Ga0182037_118559961 | 3300016404 | Soil | KLDHGSRINTADEDTLERSVGSNIFEIANDGLVSKPITPSAAA |
| Ga0066662_127057391 | 3300018468 | Grasslands Soil | MNERKFEQGSRINTADEGTLERSVGANIFESLNDGLVSKPIAPSAPARSAAFALGIDTG |
| Ga0066669_113737291 | 3300018482 | Grasslands Soil | MNERKLEHGSRINTADEGTLERSVGSNIFKSLNDG |
| Ga0126371_118408822 | 3300021560 | Tropical Forest Soil | MNELKLEHGSRVNTADEGALECSVGPNIFDNLNDGLVSKPIAPSAAA |
| Ga0126371_136796681 | 3300021560 | Tropical Forest Soil | GSRINTGDEGALERSVGANIFDNLNDGLVSKPITPSAAA |
| Ga0318515_104552871 | 3300031572 | Soil | MNERKLEHGSRINTADEDTLERSVGSSMFEGLNDGLVSKPIAPSAAA |
| Ga0310915_100351503 | 3300031573 | Soil | MNERKFEQGSRINTADEGTLERSVGAGIFKILNDGLVSKPMTPSATA |
| Ga0306918_100010462 | 3300031744 | Soil | MNERKFDYGPRIDTADERTLERAVGPSIFESLNDGLVSKPVTPWAAA |
| Ga0306918_102919922 | 3300031744 | Soil | MNERKLDHCSRINSADEATLERSVGSDIFEMPDDGLISKAVTPSAA |
| Ga0318502_107380042 | 3300031747 | Soil | QQACQSMTERELEHGSRINTADEGTLERSVGSNIFESFNDGLVSKPVTPRAAA |
| Ga0318521_106538071 | 3300031770 | Soil | MNERKLQHGSRINAADQGTLERSVGPNIFEGLNDGLVGEPITPSAAARSAAFAPRIDTGKAC |
| Ga0318548_104268252 | 3300031793 | Soil | LQHGSRINTADEGPLERSVGPNIFDNLNDGLVSKPITPSAAA |
| Ga0318557_100651624 | 3300031795 | Soil | MNELKLDHGSRINTADEDTLERSVGSNVFETANDGLVSKPITPSAAA |
| Ga0318568_107957282 | 3300031819 | Soil | MNELELDHGSRINAADEDTLERSVGPNMFEILNDGLVSKPVTPGAAA |
| Ga0318567_102090232 | 3300031821 | Soil | SPQHACQPMNERKLEHGSRINTADEDTLERSVGSSMFEGRNDGLVSKPIAPSAAA |
| Ga0310917_105404582 | 3300031833 | Soil | MNERKFDYGPRIDTADERTLERAVGPSIFESLNDGLVSKPVTP |
| Ga0310917_110368731 | 3300031833 | Soil | ECKLDHGSRINTADEDTLERSVGSNVFEIANDGLVSKPITPSAAA |
| Ga0318511_101792621 | 3300031845 | Soil | MNERKFEQGSRINTADEGTLERSVGANIFESLNDGLVSKAV |
| Ga0318512_103177161 | 3300031846 | Soil | MNERKFDYGPRIDTADERTLERAVGPSIFESLNDGLVSKPV |
| Ga0318495_104130811 | 3300031860 | Soil | MNERKFEQGSRINTADEGTLERSVGANIFESLNDGLVS |
| Ga0318495_104612582 | 3300031860 | Soil | TGTTKAPEETCQPMNKLKLDHGPRINTADEDTLERSVGPNMFEILNDGLVSKPVTPGAAA |
| Ga0306919_100263304 | 3300031879 | Soil | MNERKLQHGSRINTADEGPLERSVGPNIFDNLDDGLVSKPITPSAAA |
| Ga0306925_100625951 | 3300031890 | Soil | MNERKLQHGSRINTADEGPLERSVGPNIFDNLNDGLVSKPITPSAAA |
| Ga0318520_100479881 | 3300031897 | Soil | MNERKFDYGPRIDTADERTLERAVGPSIFESLNDGLVSKPVTPW |
| Ga0306921_113638481 | 3300031912 | Soil | MNERKLDHCSRINSADEATLERSVGSDIFEMPDDGLISKAVTPS |
| Ga0306921_116805922 | 3300031912 | Soil | ESMNERKLDHGSRIDIADEGTLERSVGPSIFNIPNDGLVGKPITPCAAA |
| Ga0306921_118490022 | 3300031912 | Soil | MNECQLEHGSRVNTADEGTLECSVGWDTFESLNDG |
| Ga0310916_112824502 | 3300031942 | Soil | MTERELEHGSRINTADEGTLERSVGSNIFESFNDGLVSKPVTPRAAA |
| Ga0310916_115538671 | 3300031942 | Soil | MNERKLDHCSRINSADEATLERSVGSDIFEMPDDG |
| Ga0310913_102741782 | 3300031945 | Soil | MNELELDHGSRINAADEDTLVRSVGPNMFEILNDGLVSKPVTPGAAA |
| Ga0310910_101405491 | 3300031946 | Soil | NTADEDTLERSVGSNVFETANDGLVSKPITPSAAA |
| Ga0310910_109934301 | 3300031946 | Soil | MNELELDHCSRINTADEDTLERSVGPNIFEIPNDGLVGKPVAPSTAA |
| Ga0310909_114242161 | 3300031947 | Soil | INTTNEGALERAIGSNMFESRNDGLVSKPVTPGATA |
| Ga0306926_101577101 | 3300031954 | Soil | MNEREFDHGSRINTADEGTLERSVGPNMFEILNDGLVSKPVTPCAAA |
| Ga0306926_122662532 | 3300031954 | Soil | MNERELEHGSRINTAYEGALERSVGPHIFESLDDGLVSKPVTPSAAA |
| Ga0310911_100020868 | 3300032035 | Soil | MNERKLDHGSRINTADEGTLERSVGPSIFESLDDGLVSKPVTPGAAA |
| Ga0310911_108459131 | 3300032035 | Soil | ACEPMNERKLDHGSRINTADEGTFERSVGPNMFEILNDGLVSKSITPSAAA |
| Ga0318504_104135491 | 3300032063 | Soil | MNERKLQHGSRINAADQGTLERSVGPNIFEGLNDGLVGEPITPSAAARSAAFAPRIDTGKACDIL |
| Ga0306924_122320521 | 3300032076 | Soil | MNERKLDYGSRINTADKSTLERSVRACIFKRLNNSLVSKPVT |
| Ga0306920_1001383953 | 3300032261 | Soil | MNKRKVEGGSRINTADEGPLECPIASNIFESLNDGLVSKPIAPSAAARSAAFALGIDTGK |
| ⦗Top⦘ |