


| Basic Information | |
|---|---|
| Family ID | F053869 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MILSILVTLAFVATLAFMLVRAFTGPVRHRHSRPVH |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.00 % |
| % of genes near scaffold ends (potentially truncated) | 33.57 % |
| % of genes from short scaffolds (< 2000 bps) | 71.43 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.286 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (27.143 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (30.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 58.33% β-sheet: 0.00% Coil/Unstructured: 41.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF00282 | Pyridoxal_deC | 19.29 |
| PF10009 | DUF2252 | 17.86 |
| PF00999 | Na_H_Exchanger | 5.00 |
| PF04978 | DUF664 | 2.86 |
| PF12840 | HTH_20 | 2.86 |
| PF00106 | adh_short | 1.43 |
| PF13399 | LytR_C | 1.43 |
| PF13191 | AAA_16 | 0.71 |
| PF02604 | PhdYeFM_antitox | 0.71 |
| PF17164 | DUF5122 | 0.71 |
| PF13474 | SnoaL_3 | 0.71 |
| PF05977 | MFS_3 | 0.71 |
| PF04542 | Sigma70_r2 | 0.71 |
| PF13586 | DDE_Tnp_1_2 | 0.71 |
| PF13701 | DDE_Tnp_1_4 | 0.71 |
| PF00665 | rve | 0.71 |
| PF02371 | Transposase_20 | 0.71 |
| PF12728 | HTH_17 | 0.71 |
| PF08450 | SGL | 0.71 |
| PF00437 | T2SSE | 0.71 |
| PF13964 | Kelch_6 | 0.71 |
| PF14358 | DUF4405 | 0.71 |
| PF01725 | Ham1p_like | 0.71 |
| PF06182 | ABC2_membrane_6 | 0.71 |
| PF10604 | Polyketide_cyc2 | 0.71 |
| PF09587 | PGA_cap | 0.71 |
| PF11695 | DUF3291 | 0.71 |
| PF07885 | Ion_trans_2 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 19.29 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 5.00 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 5.00 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 5.00 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 5.00 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 5.00 |
| COG0127 | Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family | Nucleotide transport and metabolism [F] | 0.71 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.71 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.71 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.71 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.71 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.71 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.71 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.71 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.71 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.71 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.71 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
| COG3694 | ABC-type uncharacterized transport system, permease component | General function prediction only [R] | 0.71 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.71 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.29 % |
| Unclassified | root | N/A | 30.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000858|JGI10213J12805_10316548 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300003203|JGI25406J46586_10208475 | Not Available | 571 | Open in IMG/M |
| 3300003373|JGI25407J50210_10174630 | Not Available | 530 | Open in IMG/M |
| 3300005562|Ga0058697_10006291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3810 | Open in IMG/M |
| 3300005562|Ga0058697_10052352 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300005562|Ga0058697_10245589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 832 | Open in IMG/M |
| 3300005562|Ga0058697_10549395 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005937|Ga0081455_10039084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4196 | Open in IMG/M |
| 3300005937|Ga0081455_10662632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 670 | Open in IMG/M |
| 3300005981|Ga0081538_10001653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 22830 | Open in IMG/M |
| 3300005981|Ga0081538_10002981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 16140 | Open in IMG/M |
| 3300005981|Ga0081538_10004598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 12685 | Open in IMG/M |
| 3300005981|Ga0081538_10005421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 11462 | Open in IMG/M |
| 3300005981|Ga0081538_10006715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10071 | Open in IMG/M |
| 3300005981|Ga0081538_10007256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9612 | Open in IMG/M |
| 3300005981|Ga0081538_10009241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8257 | Open in IMG/M |
| 3300005981|Ga0081538_10021043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4781 | Open in IMG/M |
| 3300005981|Ga0081538_10071607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1906 | Open in IMG/M |
| 3300005981|Ga0081538_10153078 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300005981|Ga0081538_10179833 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005981|Ga0081538_10257375 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300005981|Ga0081538_10363900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300005981|Ga0081538_10371001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 517 | Open in IMG/M |
| 3300005985|Ga0081539_10001841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 33456 | Open in IMG/M |
| 3300005985|Ga0081539_10046167 | All Organisms → cellular organisms → Bacteria | 2499 | Open in IMG/M |
| 3300006046|Ga0066652_100266306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1507 | Open in IMG/M |
| 3300006049|Ga0075417_10002772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5370 | Open in IMG/M |
| 3300006844|Ga0075428_100986979 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300006845|Ga0075421_101599786 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300006854|Ga0075425_101189119 | Not Available | 867 | Open in IMG/M |
| 3300006854|Ga0075425_101920937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300009100|Ga0075418_10011053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10088 | Open in IMG/M |
| 3300009100|Ga0075418_10659739 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300009147|Ga0114129_13168383 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300009162|Ga0075423_11800237 | Not Available | 660 | Open in IMG/M |
| 3300009789|Ga0126307_10046245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3393 | Open in IMG/M |
| 3300009789|Ga0126307_10242354 | Not Available | 1449 | Open in IMG/M |
| 3300009813|Ga0105057_1004456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1793 | Open in IMG/M |
| 3300009816|Ga0105076_1005289 | Not Available | 2069 | Open in IMG/M |
| 3300009840|Ga0126313_10011825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5553 | Open in IMG/M |
| 3300009840|Ga0126313_10024514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4060 | Open in IMG/M |
| 3300009840|Ga0126313_10227035 | Not Available | 1441 | Open in IMG/M |
| 3300009840|Ga0126313_10655646 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300010036|Ga0126305_10084254 | Not Available | 1879 | Open in IMG/M |
| 3300010038|Ga0126315_10008727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4712 | Open in IMG/M |
| 3300010038|Ga0126315_10026354 | All Organisms → cellular organisms → Bacteria | 2985 | Open in IMG/M |
| 3300010041|Ga0126312_10296018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium | 1141 | Open in IMG/M |
| 3300010041|Ga0126312_10329258 | Not Available | 1080 | Open in IMG/M |
| 3300010044|Ga0126310_10521217 | Not Available | 872 | Open in IMG/M |
| 3300010145|Ga0126321_1073758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 782 | Open in IMG/M |
| 3300010145|Ga0126321_1079603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 618 | Open in IMG/M |
| 3300011000|Ga0138513_100015392 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300012021|Ga0120192_10002866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2200 | Open in IMG/M |
| 3300012021|Ga0120192_10018340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1083 | Open in IMG/M |
| 3300012204|Ga0137374_10427895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1045 | Open in IMG/M |
| 3300012938|Ga0162651_100058507 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300012938|Ga0162651_100093580 | Not Available | 510 | Open in IMG/M |
| 3300012941|Ga0162652_100010510 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300012941|Ga0162652_100076757 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300014487|Ga0182000_10002862 | All Organisms → cellular organisms → Bacteria | 3586 | Open in IMG/M |
| 3300014487|Ga0182000_10037991 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300017965|Ga0190266_10155251 | Not Available | 1035 | Open in IMG/M |
| 3300017965|Ga0190266_11172076 | Not Available | 530 | Open in IMG/M |
| 3300018027|Ga0184605_10127672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1135 | Open in IMG/M |
| 3300018027|Ga0184605_10500682 | Not Available | 529 | Open in IMG/M |
| 3300018031|Ga0184634_10021494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2456 | Open in IMG/M |
| 3300018031|Ga0184634_10278360 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300018072|Ga0184635_10022756 | All Organisms → cellular organisms → Bacteria | 2309 | Open in IMG/M |
| 3300018076|Ga0184609_10001039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8552 | Open in IMG/M |
| 3300018081|Ga0184625_10012265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Sciscionella → Sciscionella marina | 3968 | Open in IMG/M |
| 3300018081|Ga0184625_10019731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3208 | Open in IMG/M |
| 3300018422|Ga0190265_10040244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3979 | Open in IMG/M |
| 3300018432|Ga0190275_13016964 | Not Available | 544 | Open in IMG/M |
| 3300018465|Ga0190269_10136509 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300018465|Ga0190269_10892610 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300018466|Ga0190268_11117123 | Not Available | 643 | Open in IMG/M |
| 3300018466|Ga0190268_11649964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300018469|Ga0190270_10477156 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300018469|Ga0190270_10794075 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300019377|Ga0190264_10177740 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300022195|Ga0222625_1323024 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300022534|Ga0224452_1052091 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300022756|Ga0222622_10240738 | Not Available | 1221 | Open in IMG/M |
| 3300022756|Ga0222622_10313283 | Not Available | 1084 | Open in IMG/M |
| 3300026667|Ga0208347_100389 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300026790|Ga0208710_104209 | Not Available | 691 | Open in IMG/M |
| 3300027561|Ga0209887_1006167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3339 | Open in IMG/M |
| 3300027577|Ga0209874_1139444 | Not Available | 553 | Open in IMG/M |
| 3300027750|Ga0209461_10045439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces ipomoeae | 879 | Open in IMG/M |
| 3300027750|Ga0209461_10096613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 665 | Open in IMG/M |
| 3300027809|Ga0209574_10038424 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300027873|Ga0209814_10005443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4851 | Open in IMG/M |
| 3300028587|Ga0247828_10240777 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300028589|Ga0247818_10049336 | All Organisms → cellular organisms → Bacteria | 2705 | Open in IMG/M |
| 3300028590|Ga0247823_10103162 | All Organisms → cellular organisms → Bacteria | 2185 | Open in IMG/M |
| 3300028592|Ga0247822_10063695 | All Organisms → cellular organisms → Bacteria | 2598 | Open in IMG/M |
| 3300028705|Ga0307276_10019047 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300028717|Ga0307298_10040974 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300028718|Ga0307307_10212132 | Not Available | 614 | Open in IMG/M |
| 3300028719|Ga0307301_10000903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8517 | Open in IMG/M |
| 3300028720|Ga0307317_10050476 | Not Available | 1332 | Open in IMG/M |
| 3300028722|Ga0307319_10003056 | All Organisms → cellular organisms → Bacteria | 5123 | Open in IMG/M |
| 3300028722|Ga0307319_10130953 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300028722|Ga0307319_10299652 | Not Available | 532 | Open in IMG/M |
| 3300028744|Ga0307318_10193188 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300028771|Ga0307320_10076887 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300028778|Ga0307288_10143479 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300028878|Ga0307278_10010999 | All Organisms → cellular organisms → Bacteria | 4228 | Open in IMG/M |
| 3300028878|Ga0307278_10011750 | All Organisms → cellular organisms → Bacteria | 4089 | Open in IMG/M |
| 3300028881|Ga0307277_10003906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5725 | Open in IMG/M |
| 3300030496|Ga0268240_10012798 | Not Available | 1467 | Open in IMG/M |
| 3300030510|Ga0268243_1003582 | All Organisms → cellular organisms → Bacteria | 2639 | Open in IMG/M |
| 3300030514|Ga0268253_10349852 | Not Available | 524 | Open in IMG/M |
| 3300030783|Ga0102752_1006015 | Not Available | 537 | Open in IMG/M |
| 3300030829|Ga0308203_1035421 | Not Available | 712 | Open in IMG/M |
| 3300030829|Ga0308203_1045828 | Not Available | 651 | Open in IMG/M |
| 3300030830|Ga0308205_1024571 | Not Available | 710 | Open in IMG/M |
| 3300030830|Ga0308205_1027569 | Not Available | 682 | Open in IMG/M |
| 3300030830|Ga0308205_1037217 | Not Available | 614 | Open in IMG/M |
| 3300030902|Ga0308202_1038066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → Nitriliruptoraceae → Nitriliruptor → unclassified Nitriliruptor → Nitriliruptor sp. | 840 | Open in IMG/M |
| 3300030903|Ga0308206_1069565 | Not Available | 738 | Open in IMG/M |
| 3300030903|Ga0308206_1151369 | Not Available | 559 | Open in IMG/M |
| 3300030903|Ga0308206_1200702 | Not Available | 505 | Open in IMG/M |
| 3300031039|Ga0102760_11003839 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300031058|Ga0308189_10191728 | Not Available | 734 | Open in IMG/M |
| 3300031091|Ga0308201_10275974 | Not Available | 589 | Open in IMG/M |
| 3300031091|Ga0308201_10333083 | Not Available | 551 | Open in IMG/M |
| 3300031422|Ga0308186_1019018 | Not Available | 653 | Open in IMG/M |
| 3300031548|Ga0307408_100091786 | All Organisms → cellular organisms → Bacteria | 2294 | Open in IMG/M |
| 3300031548|Ga0307408_100332923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1283 | Open in IMG/M |
| 3300031548|Ga0307408_101037176 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300031903|Ga0307407_11031179 | Not Available | 637 | Open in IMG/M |
| 3300031995|Ga0307409_100352383 | Not Available | 1389 | Open in IMG/M |
| 3300031995|Ga0307409_100967555 | Not Available | 868 | Open in IMG/M |
| 3300031995|Ga0307409_101385458 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300031995|Ga0307409_102520468 | Not Available | 543 | Open in IMG/M |
| 3300032002|Ga0307416_102123868 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300032002|Ga0307416_102684702 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300032159|Ga0268251_10055770 | Not Available | 1309 | Open in IMG/M |
| 3300032159|Ga0268251_10315817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 27.14% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 10.71% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 8.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.14% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 7.14% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.71% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 5.71% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 3.57% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.86% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.14% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.43% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.43% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 1.43% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300026667 | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN613 (SPAdes) | Environmental | Open in IMG/M |
| 3300026790 | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN607 (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300030514 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030783 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031039 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10213J12805_103165482 | 3300000858 | Soil | MILSVLVTLAFVATLLWMLVRAFTGPIRPRHRRPVH* |
| JGI25406J46586_102084752 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MILSILVTLAFVATLAFMLVRAFTGPVRHRHSRPVHDAGRP |
| JGI25407J50210_101746301 | 3300003373 | Tabebuia Heterophylla Rhizosphere | PTERSRRMILSILVTLAFVATLLFMLVRAFTGPVRHRHGRPVH* |
| Ga0058697_100062913 | 3300005562 | Agave | MILSVFVTLAFVATLLWMLVRAFTGPMRHRHRRPVH* |
| Ga0058697_100523522 | 3300005562 | Agave | MILSILVTLAFVATLAFMLVRAFTGPVRPRHGRPVH* |
| Ga0058697_102455892 | 3300005562 | Agave | MILSILVTLAFVATLAFMLVRAFTGPVRHRHSRPVH* |
| Ga0058697_105493952 | 3300005562 | Agave | MILSILVTLAFVTTLAFMLVRAFTGPVRHRHSRPVH* |
| Ga0081455_100390842 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MILSILVTLAFVATLLFMLVRAFTGPIRHRHGRPVH* |
| Ga0081455_106626322 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MILSVLVTLAFVVTLLWMLVRAFTGPIRHRHHRPVH* |
| Ga0081538_1000165326 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MILSILVTLAFVATLLFMLVRAFTGPVRPRRSRPVH* |
| Ga0081538_1000298123 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MILSILVTLLFVATLAFMLVRAFTGPIRHRHGRPVH* |
| Ga0081538_100045982 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MILSILVTLAFVATLAFMLVRAFTGPLRRRHGRPVH* |
| Ga0081538_100054215 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MVLSILVTLAFVATLLFMVVRAFTGPLRHRHRRRPVH* |
| Ga0081538_100067156 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MILSILVTLAFVATLAFMLVRAFTGPVRHRHGRPVH* |
| Ga0081538_100072564 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MILSILVTLAFVATLLFMLVRAFTGPVRHRHGRPVH* |
| Ga0081538_100092417 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MVLSLLVTLAFVATLLWMVVRAFTGPVRHRQRRPVH* |
| Ga0081538_100210434 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MILSILATLVFVAALAFMLVRAFTGPVRHRHGRAVH* |
| Ga0081538_100716072 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MILSVLVTLAFVATLLWMLVRAFTGPVRHRHRRPAH* |
| Ga0081538_101530782 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MILSILVTLGFVATLVFMLVRAFTGPVRHRHGRPVH* |
| Ga0081538_101798333 | 3300005981 | Tabebuia Heterophylla Rhizosphere | PTERSRRMILSILVTLAFVATLAFMLVRAFTGPVRPRRSRPVH* |
| Ga0081538_102573752 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MILSILATLVFVAALVFMLVRAFTGPVRHRHGRPVH* |
| Ga0081538_103639002 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MILSILVTLAFVATLAFMLVRAFTGPVRHRHGRALH* |
| Ga0081538_103710012 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MILSILVTLAFVATLAFMLVRAFTGPVRHRRGRPVH* |
| Ga0081539_1000184140 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MILSILVTLAFVATLAFMLVRAFTGPVRPRRGRPVH* |
| Ga0081539_100461672 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MILSILVALAFVATLAFMLVRAFTGPVRSRHSRPVH* |
| Ga0066652_1002663062 | 3300006046 | Soil | MILSILVTLAFVTTLAFMLVRAFTGPVRPRHGRPVH* |
| Ga0075417_100027724 | 3300006049 | Populus Rhizosphere | MILSILVTLAFVAALAFMLVRAFTGPVRHRRGRPVH* |
| Ga0075428_1009869792 | 3300006844 | Populus Rhizosphere | MILSILVTLAFVATLAFMLVRAFTGPVRHRRSRPVH* |
| Ga0075421_1015997861 | 3300006845 | Populus Rhizosphere | MILSILVTLVFVALLAFILVRAFTGPVRHRHSRPVH* |
| Ga0075425_1011891192 | 3300006854 | Populus Rhizosphere | RMILSILVTLAFVATLAFVLVRAFTGPVRHRHGRPVH* |
| Ga0075425_1019209372 | 3300006854 | Populus Rhizosphere | MILSILVTLAFVAALASMLVRAFTGPVRHRRGRPVH* |
| Ga0075418_100110534 | 3300009100 | Populus Rhizosphere | MILSILVTLAFVAALAFMLVRAFTGPVRHRRGWPVH* |
| Ga0075418_106597392 | 3300009100 | Populus Rhizosphere | MILSILVTLVFVALLAFILVRAFTGPVRHRHGRPVH* |
| Ga0114129_131683832 | 3300009147 | Populus Rhizosphere | MILSILVTLVFVALLAFILVRAFTGPVRHRHSRPIR* |
| Ga0075423_118002371 | 3300009162 | Populus Rhizosphere | MILSILVTLAFVATLAFMLVRAFTGPVRSRHSRPLH* |
| Ga0126307_100462452 | 3300009789 | Serpentine Soil | MILSILVALAFVATLAFMLVRAFTGPARPRHSRAVH* |
| Ga0126307_102423541 | 3300009789 | Serpentine Soil | NGRERGMILSILVTLAFVATLLWMLVRAFTGPIRHRHRLPVH* |
| Ga0105057_10044563 | 3300009813 | Groundwater Sand | RTEPTEGRRGMILSVLVTLAFVATLLWMLVRAFTGPIRHRHRRPVH* |
| Ga0105076_10052891 | 3300009816 | Groundwater Sand | MILSVLVTLAFVATLLWMVVRAFTGPIHHRHRRSVH* |
| Ga0126313_100118254 | 3300009840 | Serpentine Soil | MVLSILVTSAFVATLLFMVVRAFTGPLRHRHRRRLVH* |
| Ga0126313_100245144 | 3300009840 | Serpentine Soil | MILSILVALTFVATLLFMLVRAFTGPVRPRHSRPVH* |
| Ga0126313_102270352 | 3300009840 | Serpentine Soil | MILSILVTLAFVATLLWMLVRAFTGPIRHRHRLPVH* |
| Ga0126313_106556462 | 3300009840 | Serpentine Soil | WQREPTERSRRMILSILVTLAFVATLLFMLVRAFTGPIRHRHSRPVH* |
| Ga0126305_100842542 | 3300010036 | Serpentine Soil | MILSILVTLAFVATLLWMLVRAFTSPMRHQHRRPVH* |
| Ga0126315_100087275 | 3300010038 | Serpentine Soil | MILSILVTLAFVATLLFMLVRAFTGPIRHRHSRPVH* |
| Ga0126315_100263544 | 3300010038 | Serpentine Soil | MILSILVTLAFVTTLAFMLVRAFTGPARHRHGRPVH* |
| Ga0126312_102960182 | 3300010041 | Serpentine Soil | MVLSILVTLAFVATLLFMVVRAFTGPLRHRHRRRLVH* |
| Ga0126312_103292581 | 3300010041 | Serpentine Soil | RMILSILVTLAFVATLLFMLVRAFTGPIRHRHSRPVH* |
| Ga0126310_105212171 | 3300010044 | Serpentine Soil | MILSILVTLAFAATLAFMLVRAFTGPVRHRHSRPVH* |
| Ga0126321_10737581 | 3300010145 | Soil | NGRRRGMILSVFVTLAFVATLLWMLVRAFTGPMRHRHRRPVH* |
| Ga0126321_10796031 | 3300010145 | Soil | MILSVLVTLAFVATLLWMLVRAFTGPIRHRHRRPAH* |
| Ga0138513_1000153922 | 3300011000 | Soil | MILSILVTLAFVATLLWMLVRAFTSPIRHWHRRPVHH* |
| Ga0120192_100028663 | 3300012021 | Terrestrial | MILSVLVTLAFVATLLWMLVRAFTGPIRHRHRRVVH* |
| Ga0120192_100183403 | 3300012021 | Terrestrial | MVLSILVTLAFVATLLFMVVRAFTGPMRHRHRRRPGHRPP |
| Ga0137374_104278956 | 3300012204 | Vadose Zone Soil | MILSVLVTLGFVATLLWMLVRAFTGPIRHRHRRMVH* |
| Ga0162651_1000585071 | 3300012938 | Soil | MILSILVTLAFVATLAFMLVRAFTGPVRSRHGRPVH* |
| Ga0162651_1000935802 | 3300012938 | Soil | MILSVLVTLAFVAALLWMLVRAITGPMRHQHRRVVH* |
| Ga0162652_1000105102 | 3300012941 | Soil | MILSILVTLAFVATLLWMLVRAFTSPMRHQHRRVVH* |
| Ga0162652_1000767572 | 3300012941 | Soil | MILSILVTLAFVALLAFILVRAFTGPVRHRHSRPVH* |
| Ga0182000_100028623 | 3300014487 | Soil | MILSILVALAFVTTLAFMLVRAFTGPVRPRHSRPVH* |
| Ga0182000_100379912 | 3300014487 | Soil | MILSILVTLAFVATLAFMLVRAFTGPVRPRRSRPVH* |
| Ga0190266_101552511 | 3300017965 | Soil | TEGRRRMILSILVTLAFVATLAFMLVRAFTGPVRHRHSRPVH |
| Ga0190266_111720762 | 3300017965 | Soil | MILSILVTLAFVATLAFMLVRAFTGPVRHRHSRPVH |
| Ga0184605_101276721 | 3300018027 | Groundwater Sediment | MILSILVTLAFVATLLWMLVRAFTSPMRHQHRRPVH |
| Ga0184605_105006821 | 3300018027 | Groundwater Sediment | MILSILVTLAFVATLVFMLVRAFTGPVRHRHSRPVH |
| Ga0184634_100214941 | 3300018031 | Groundwater Sediment | MILSVLVTLAFVATLLWMLVRAFTGPIRHRHRRPVH |
| Ga0184634_102783602 | 3300018031 | Groundwater Sediment | MILSILVTLVFVALLAFILVRAFTGPVRHRHSRPVH |
| Ga0184635_100227561 | 3300018072 | Groundwater Sediment | ILSILVTLVFVALLAFILVRAFTGPVRHRHSRPVH |
| Ga0184609_100010396 | 3300018076 | Groundwater Sediment | MLLSILVTLVFVAMLLFMLVRAFTGPVRHRHSRPVR |
| Ga0184625_100122652 | 3300018081 | Groundwater Sediment | MILSILVTLAFVATLLWTLVRAFTGPIRHRHRLPVH |
| Ga0184625_100197314 | 3300018081 | Groundwater Sediment | MILSVLVTLAFVATLLWMLVRAFTGPIRHWHRRPVHH |
| Ga0190265_100402442 | 3300018422 | Soil | MILSILVTLAFVATLAFMLVRAFTGPVRHRHGRPVH |
| Ga0190275_130169641 | 3300018432 | Soil | RSRRMILSILVTLAFVATLLFMLVRAFTGPIRHRHSRPVH |
| Ga0190269_101365092 | 3300018465 | Soil | MILSILVTLAFVALLAFILVRAFTGPVRHRHSRPVH |
| Ga0190269_108926101 | 3300018465 | Soil | MILSVLVTLAFVAALLWMLVRAFTGPMRHQHRRVVH |
| Ga0190268_111171232 | 3300018466 | Soil | MILSILVPLAFVATLAFMLVRAFTGPVRHRHGRPVH |
| Ga0190268_116499642 | 3300018466 | Soil | MILSILVTLAFVATLLFMLVRAFTGPIRHRHSRPVH |
| Ga0190270_104771562 | 3300018469 | Soil | ERSRRMILSILVTLVFVALLAFILVRAFTGPVRHRHSRPVH |
| Ga0190270_107940752 | 3300018469 | Soil | MILSILVTLVFVALLAFILVRAFTGPVRHRHSRPVR |
| Ga0190264_101777402 | 3300019377 | Soil | MILSILVTLAFVATLLFMLVRAFTGPVRHRHGRPVH |
| Ga0222625_13230241 | 3300022195 | Groundwater Sediment | ERGRRMLLSILVTLVFVALLLFMLVRAFTGPVRHRHSRPVR |
| Ga0224452_10520911 | 3300022534 | Groundwater Sediment | SRRMILSILVTLVFVALLAFILVRAFTGPVRHRHSRPVH |
| Ga0222622_102407383 | 3300022756 | Groundwater Sediment | MILSVLVTLAFVATLLWMVVRAFTGPIHHRHRRLVH |
| Ga0222622_103132831 | 3300022756 | Groundwater Sediment | EPTERSRRMILSILVTLAFVATLAFMLVRAFTGPVRHRHSRPVH |
| Ga0208347_1003892 | 3300026667 | Soil | MILSILVTLAFVATLLFMLVRAFTGPVRHRHSRPVH |
| Ga0208710_1042092 | 3300026790 | Soil | MVLSILVTLAFVATLAFMLVRAFTGPVRHRHGRPVH |
| Ga0209887_10061673 | 3300027561 | Groundwater Sand | MILSVLVTLAFVTTLLWMLVRAFTGPIRHRHRRPVH |
| Ga0209874_11394441 | 3300027577 | Groundwater Sand | MILSVLVTLAFVTTLLWMLVRAFTGPIRHRHRRVVH |
| Ga0209461_100454391 | 3300027750 | Agave | NRMSNGRRRRMILSILVTLAFVATLAFMLVRAFTGPVRPRHGRPVH |
| Ga0209461_100966131 | 3300027750 | Agave | RGMILSVFVTLAFVATLLWMLVRAFTGPMRHRHRRPVH |
| Ga0209574_100384242 | 3300027809 | Agave | MILSILVTLAFVTTLAFMLVRAFTGPVRHRHSRPVH |
| Ga0209814_100054433 | 3300027873 | Populus Rhizosphere | MILSILVTLAFVAALAFMLVRAFTGPVRHRRGRPVH |
| Ga0247828_102407772 | 3300028587 | Soil | MILSILVTLLFVALLAFILVRAFTGPVRHRHSRPIR |
| Ga0247818_100493362 | 3300028589 | Soil | MILSILVTLLFVALLAFILVRAFTGPVRRRHSRPIR |
| Ga0247823_101031622 | 3300028590 | Soil | MILSILVTLVFVALLAFILVRAFTGPVRHRHSRPIR |
| Ga0247822_100636953 | 3300028592 | Soil | MILSILVTLVFVALLAFILVRAFTGPVRRRHSRPIR |
| Ga0307276_100190471 | 3300028705 | Soil | TNGRSRRMILSILVTLAFVATLVFMLVRAFTGPVRHRHSRPVH |
| Ga0307298_100409741 | 3300028717 | Soil | TERSRRMILSILVTLAFVATLVFMLVRAFTGPVRHRHSRPVH |
| Ga0307307_102121322 | 3300028718 | Soil | MILSILVALAFVATLAFMLVRAFTGPVRHRHSRPVH |
| Ga0307301_100009031 | 3300028719 | Soil | MILSILVTLAFVASLLWMLVRAFTGPIRHRHRLPVH |
| Ga0307317_100504761 | 3300028720 | Soil | HEPTERSGRMILSILVTLAFVATLVFMLVRAFTGPVRRRHSRPVH |
| Ga0307319_100030561 | 3300028722 | Soil | MILSVLVTLAFVATLLWMVVRAFTGPIHHRHRRPVH |
| Ga0307319_101309531 | 3300028722 | Soil | MILSILVTLAFVATLAFMLVRAFTGPVRNRHSRPVH |
| Ga0307319_102996521 | 3300028722 | Soil | TTEGRRGMILSVLVTLAFVATLLWMLVRAFTGPIRHWHRRPVHH |
| Ga0307318_101931881 | 3300028744 | Soil | MILSILVTLAFVATLAFMLVRAFTGPVRPRHGRPVH |
| Ga0307320_100768872 | 3300028771 | Soil | MILSILVTLVFVALLAFILVRAFTGPVRHRHSRPIH |
| Ga0307288_101434792 | 3300028778 | Soil | MILSILVTLAFVATLVFMLVRAFTGPVRRRHSRPVH |
| Ga0307278_100109991 | 3300028878 | Soil | RSRRMILSILVTLAFVATLAFMLVRAFTGPVRHRHSRPVH |
| Ga0307278_100117502 | 3300028878 | Soil | MILSILVTLAFAATLAFMLVRAFTGPVRHRHSRPIH |
| Ga0307277_100039061 | 3300028881 | Soil | ERGMILSILVTLAFVASLLWMLVRAFTGPVRHRHRLPVH |
| Ga0268240_100127982 | 3300030496 | Soil | MILSILVTLAFVATLAFMLVRAFTGPVRSRRSRPVH |
| Ga0268243_10035823 | 3300030510 | Soil | MILSILVALAFVTTLAFMLVRAFTGPVRPRHSRPVH |
| Ga0268253_103498522 | 3300030514 | Agave | MILSILVTLAFVATLAFMLVRAFTGPVRPRRSRPVH |
| Ga0102752_10060152 | 3300030783 | Soil | NRRETEMILSILVTLAFVATLAFMLVRAFTGPVRHRHGRPVH |
| Ga0308203_10354211 | 3300030829 | Soil | GRERGMILSILVTLAFVASLLWMLVRAFTGPIRHRHRLPVH |
| Ga0308203_10458281 | 3300030829 | Soil | EGRRGMILSVLVTLAFVATLLWMVVRAFTGPIHHRHRRLVH |
| Ga0308205_10245711 | 3300030830 | Soil | RGMILSILVTLAFVASLLWMLVRAFTGPIRHRHRLPVH |
| Ga0308205_10275692 | 3300030830 | Soil | EGRRGMILSVLVTLAFVATLLWMLVRAFTGPIRHRHRRPVYH |
| Ga0308205_10372171 | 3300030830 | Soil | QRRRGMILSVLVTLAFVAALLWMLVRAFTGPMRHQHRRVVH |
| Ga0308202_10380662 | 3300030902 | Soil | RGMILSVLVTLAFVATLLWMLVRAFTGPIRHRRPVHH |
| Ga0308206_10695651 | 3300030903 | Soil | ILSILVTLAFVATLLWMLVRAFTSPMRHQHRRPVH |
| Ga0308206_11513691 | 3300030903 | Soil | GRRGMILSVLVTLAFVATLLWMLVRAFTGPIRHRHRRPVH |
| Ga0308206_12007021 | 3300030903 | Soil | GRERGMILTILVTLAFVATLLWMLVRAFTGPIRHRHRLPVHH |
| Ga0102760_110038391 | 3300031039 | Soil | PNRRETEMILSILVTLAFVATLAFMLVRAFTGPVRHRHGRPVH |
| Ga0308189_101917281 | 3300031058 | Soil | GRERGMILSILVTLAFVASLLWMLVRAFTGPVRHRHRLPVH |
| Ga0308201_102759742 | 3300031091 | Soil | EGRRGMILSVLVTLAFVATLLWMLVRAFTSPIRHRHRRPVH |
| Ga0308201_103330831 | 3300031091 | Soil | ERGMILSILVTLAFVATLLWMLVRAFTGPIRHRHHLPVH |
| Ga0308186_10190181 | 3300031422 | Soil | ERGMILSILVTLAFVASLLWMLVRAFTGPIRHRHRLPVH |
| Ga0307408_1000917862 | 3300031548 | Rhizosphere | MILSILVTLLFVATLAFMLVRAFTGPIRHRHGRPVH |
| Ga0307408_1003329232 | 3300031548 | Rhizosphere | MVLSILVTLAFVATLLFMVVRAFTGPLRHRHRRRLVH |
| Ga0307408_1010371762 | 3300031548 | Rhizosphere | MILSILVALAFVATLAFMLVRAFTGPARPRHSRPVH |
| Ga0307407_110311792 | 3300031903 | Rhizosphere | MILSILVALAFVATLAFMLVRAFTGPARHRHSRPVH |
| Ga0307409_1003523831 | 3300031995 | Rhizosphere | MILSILVALAFVATLLFMLVRAFTGPVRPRHSRPVH |
| Ga0307409_1009675551 | 3300031995 | Rhizosphere | WRHEPTEGRRRMILSILVTLAFVATLAFMLVRAFTGPVRHRHGRPVH |
| Ga0307409_1013854582 | 3300031995 | Rhizosphere | MILSILVALAFVATLAFMLVRAFTGPVRPRHSRPVH |
| Ga0307409_1025204681 | 3300031995 | Rhizosphere | RHEPTERSRRMILSILVALAFVATLAFMLVRAFTGPARPRHSRPVH |
| Ga0307416_1021238682 | 3300032002 | Rhizosphere | PTGRRRRMILSILVTLAFVATLAFMLVRAFTGPVRHRHGRPVH |
| Ga0307416_1026847021 | 3300032002 | Rhizosphere | ILSILVTLAFVATLAFMLVRAFTGPVRHRHGRPVH |
| Ga0268251_100557701 | 3300032159 | Agave | MILSVFVTLAFVATLLWMLVRAFTGPMRHRHRRPVH |
| Ga0268251_103158172 | 3300032159 | Agave | MILSILVTLAFVATLAFMLVRAFTGPVVRHRHGRPVH |
| ⦗Top⦘ |