


| Basic Information | |
|---|---|
| Family ID | F053855 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 46 residues |
| Representative Sequence | AIKPLLAAAQPLHPTRGAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.43 % |
| % of genes near scaffold ends (potentially truncated) | 96.43 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.49% β-sheet: 0.00% Coil/Unstructured: 63.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF00436 | SSB | 2.14 |
| PF07883 | Cupin_2 | 2.14 |
| PF00583 | Acetyltransf_1 | 1.43 |
| PF13469 | Sulfotransfer_3 | 1.43 |
| PF07690 | MFS_1 | 1.43 |
| PF13148 | DUF3987 | 1.43 |
| PF00072 | Response_reg | 0.71 |
| PF00106 | adh_short | 0.71 |
| PF00120 | Gln-synt_C | 0.71 |
| PF05119 | Terminase_4 | 0.71 |
| PF14294 | DUF4372 | 0.71 |
| PF13561 | adh_short_C2 | 0.71 |
| PF00496 | SBP_bac_5 | 0.71 |
| PF04392 | ABC_sub_bind | 0.71 |
| PF01564 | Spermine_synth | 0.71 |
| PF00534 | Glycos_transf_1 | 0.71 |
| PF00383 | dCMP_cyt_deam_1 | 0.71 |
| PF13602 | ADH_zinc_N_2 | 0.71 |
| PF04542 | Sigma70_r2 | 0.71 |
| PF07681 | DoxX | 0.71 |
| PF06707 | DUF1194 | 0.71 |
| PF13586 | DDE_Tnp_1_2 | 0.71 |
| PF02705 | K_trans | 0.71 |
| PF13701 | DDE_Tnp_1_4 | 0.71 |
| PF07075 | DUF1343 | 0.71 |
| PF11149 | DUF2924 | 0.71 |
| PF04773 | FecR | 0.71 |
| PF05199 | GMC_oxred_C | 0.71 |
| PF01909 | NTP_transf_2 | 0.71 |
| PF13401 | AAA_22 | 0.71 |
| PF00589 | Phage_integrase | 0.71 |
| PF13419 | HAD_2 | 0.71 |
| PF13400 | Tad | 0.71 |
| PF02190 | LON_substr_bdg | 0.71 |
| PF12587 | DUF3761 | 0.71 |
| PF04909 | Amidohydro_2 | 0.71 |
| PF12762 | DDE_Tnp_IS1595 | 0.71 |
| PF13683 | rve_3 | 0.71 |
| PF01613 | Flavin_Reduct | 0.71 |
| PF13649 | Methyltransf_25 | 0.71 |
| PF02518 | HATPase_c | 0.71 |
| PF08241 | Methyltransf_11 | 0.71 |
| PF01070 | FMN_dh | 0.71 |
| PF13733 | Glyco_transf_7N | 0.71 |
| PF13440 | Polysacc_synt_3 | 0.71 |
| PF05860 | TPS | 0.71 |
| PF08443 | RimK | 0.71 |
| PF10979 | DUF2786 | 0.71 |
| PF00587 | tRNA-synt_2b | 0.71 |
| PF02515 | CoA_transf_3 | 0.71 |
| PF13495 | Phage_int_SAM_4 | 0.71 |
| PF13817 | DDE_Tnp_IS66_C | 0.71 |
| PF00561 | Abhydrolase_1 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 2.14 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 2.14 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.71 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.71 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.71 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.71 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.71 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.71 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.71 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.71 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.71 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.71 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.71 |
| COG3210 | Large exoprotein involved in heme utilization or adhesion | Intracellular trafficking, secretion, and vesicular transport [U] | 0.71 |
| COG3747 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.71 |
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.71 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|FZY7DQ102ICK6U | Not Available | 510 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100286972 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300004633|Ga0066395_10550712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 671 | Open in IMG/M |
| 3300005440|Ga0070705_100980265 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005454|Ga0066687_10387995 | Not Available | 805 | Open in IMG/M |
| 3300005541|Ga0070733_10420371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 890 | Open in IMG/M |
| 3300005552|Ga0066701_10103836 | Not Available | 1664 | Open in IMG/M |
| 3300005764|Ga0066903_103969871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia | 793 | Open in IMG/M |
| 3300005764|Ga0066903_105360165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300005921|Ga0070766_10025850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3154 | Open in IMG/M |
| 3300006059|Ga0075017_101221721 | Not Available | 589 | Open in IMG/M |
| 3300006854|Ga0075425_101594586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 736 | Open in IMG/M |
| 3300007258|Ga0099793_10491500 | Not Available | 609 | Open in IMG/M |
| 3300009089|Ga0099828_11196117 | Not Available | 674 | Open in IMG/M |
| 3300009137|Ga0066709_103581211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 563 | Open in IMG/M |
| 3300009143|Ga0099792_10284312 | Not Available | 976 | Open in IMG/M |
| 3300009147|Ga0114129_10585270 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300009147|Ga0114129_10734969 | Not Available | 1265 | Open in IMG/M |
| 3300009792|Ga0126374_11574867 | Not Available | 542 | Open in IMG/M |
| 3300010043|Ga0126380_10276687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1179 | Open in IMG/M |
| 3300010046|Ga0126384_10510948 | Not Available | 1037 | Open in IMG/M |
| 3300010047|Ga0126382_11080174 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300010048|Ga0126373_10282879 | Not Available | 1647 | Open in IMG/M |
| 3300010159|Ga0099796_10474011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300010359|Ga0126376_10041609 | Not Available | 3196 | Open in IMG/M |
| 3300010359|Ga0126376_10205218 | Not Available | 1637 | Open in IMG/M |
| 3300010359|Ga0126376_10316894 | Not Available | 1365 | Open in IMG/M |
| 3300010360|Ga0126372_10674071 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300010361|Ga0126378_10505909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1323 | Open in IMG/M |
| 3300010361|Ga0126378_11525910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300010361|Ga0126378_13127505 | Not Available | 527 | Open in IMG/M |
| 3300010362|Ga0126377_10472451 | Not Available | 1280 | Open in IMG/M |
| 3300010362|Ga0126377_11661080 | Not Available | 714 | Open in IMG/M |
| 3300010366|Ga0126379_12126116 | Not Available | 663 | Open in IMG/M |
| 3300010376|Ga0126381_100408897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. S8 | 1892 | Open in IMG/M |
| 3300010376|Ga0126381_100653870 | Not Available | 1500 | Open in IMG/M |
| 3300010376|Ga0126381_101825965 | Not Available | 877 | Open in IMG/M |
| 3300010376|Ga0126381_102020729 | Not Available | 831 | Open in IMG/M |
| 3300010376|Ga0126381_102094966 | Not Available | 814 | Open in IMG/M |
| 3300010376|Ga0126381_104455814 | Not Available | 541 | Open in IMG/M |
| 3300010398|Ga0126383_10178940 | Not Available | 2013 | Open in IMG/M |
| 3300010398|Ga0126383_10326444 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300010398|Ga0126383_11594731 | Not Available | 742 | Open in IMG/M |
| 3300011271|Ga0137393_11717190 | Not Available | 516 | Open in IMG/M |
| 3300012202|Ga0137363_10258596 | Not Available | 1417 | Open in IMG/M |
| 3300012202|Ga0137363_11720358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300012203|Ga0137399_11375589 | Not Available | 592 | Open in IMG/M |
| 3300012210|Ga0137378_11550137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300012211|Ga0137377_10780123 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300012362|Ga0137361_11431128 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
| 3300012363|Ga0137390_10753767 | Not Available | 933 | Open in IMG/M |
| 3300012685|Ga0137397_11091740 | Not Available | 582 | Open in IMG/M |
| 3300012925|Ga0137419_10414044 | Not Available | 1055 | Open in IMG/M |
| 3300012927|Ga0137416_10334106 | Not Available | 1266 | Open in IMG/M |
| 3300012929|Ga0137404_10542078 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300012929|Ga0137404_11844166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_67_14b | 563 | Open in IMG/M |
| 3300012929|Ga0137404_12235142 | Not Available | 512 | Open in IMG/M |
| 3300012948|Ga0126375_10029735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2688 | Open in IMG/M |
| 3300012948|Ga0126375_10376333 | Not Available | 1017 | Open in IMG/M |
| 3300012987|Ga0164307_11847182 | Not Available | 512 | Open in IMG/M |
| 3300016270|Ga0182036_11103801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300016294|Ga0182041_10091873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2203 | Open in IMG/M |
| 3300016294|Ga0182041_10093166 | All Organisms → cellular organisms → Bacteria | 2189 | Open in IMG/M |
| 3300016294|Ga0182041_10274929 | Not Available | 1383 | Open in IMG/M |
| 3300016294|Ga0182041_10624634 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300016319|Ga0182033_10052581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2770 | Open in IMG/M |
| 3300016341|Ga0182035_10033455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3346 | Open in IMG/M |
| 3300016357|Ga0182032_10788865 | Not Available | 802 | Open in IMG/M |
| 3300016357|Ga0182032_11310410 | Not Available | 625 | Open in IMG/M |
| 3300016357|Ga0182032_11432968 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → unclassified Nitrospirales → Nitrospirales bacterium | 599 | Open in IMG/M |
| 3300016371|Ga0182034_10103735 | All Organisms → cellular organisms → Bacteria | 2044 | Open in IMG/M |
| 3300016371|Ga0182034_10492188 | Not Available | 1021 | Open in IMG/M |
| 3300016371|Ga0182034_10583056 | Not Available | 942 | Open in IMG/M |
| 3300016371|Ga0182034_11838244 | Not Available | 534 | Open in IMG/M |
| 3300016387|Ga0182040_10279950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1267 | Open in IMG/M |
| 3300016445|Ga0182038_10574406 | Not Available | 970 | Open in IMG/M |
| 3300016445|Ga0182038_10608443 | Not Available | 944 | Open in IMG/M |
| 3300017943|Ga0187819_10617034 | Not Available | 614 | Open in IMG/M |
| 3300018085|Ga0187772_11340207 | Not Available | 530 | Open in IMG/M |
| 3300020580|Ga0210403_10810819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300020581|Ga0210399_10790357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 775 | Open in IMG/M |
| 3300020581|Ga0210399_11425073 | Not Available | 540 | Open in IMG/M |
| 3300021168|Ga0210406_10105104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2397 | Open in IMG/M |
| 3300021178|Ga0210408_10040439 | All Organisms → cellular organisms → Bacteria | 3662 | Open in IMG/M |
| 3300021178|Ga0210408_10252318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1405 | Open in IMG/M |
| 3300021401|Ga0210393_10450041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1051 | Open in IMG/M |
| 3300021405|Ga0210387_10088786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2566 | Open in IMG/M |
| 3300021406|Ga0210386_11638351 | Not Available | 533 | Open in IMG/M |
| 3300021478|Ga0210402_10239767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1672 | Open in IMG/M |
| 3300021560|Ga0126371_12245900 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300022720|Ga0242672_1121717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300025916|Ga0207663_11139128 | Not Available | 627 | Open in IMG/M |
| 3300026369|Ga0257152_1003996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1519 | Open in IMG/M |
| 3300026490|Ga0257153_1043272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 926 | Open in IMG/M |
| 3300026508|Ga0257161_1032572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1027 | Open in IMG/M |
| 3300028906|Ga0308309_11205612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 652 | Open in IMG/M |
| 3300030737|Ga0302310_10586673 | Not Available | 590 | Open in IMG/M |
| 3300031545|Ga0318541_10597180 | Not Available | 617 | Open in IMG/M |
| 3300031573|Ga0310915_10318579 | Not Available | 1100 | Open in IMG/M |
| 3300031573|Ga0310915_10612386 | Not Available | 771 | Open in IMG/M |
| 3300031668|Ga0318542_10542941 | Not Available | 605 | Open in IMG/M |
| 3300031724|Ga0318500_10488116 | Not Available | 618 | Open in IMG/M |
| 3300031744|Ga0306918_10689675 | Not Available | 799 | Open in IMG/M |
| 3300031747|Ga0318502_10963912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300031751|Ga0318494_10100612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. 131-2-5 | 1593 | Open in IMG/M |
| 3300031753|Ga0307477_10152883 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
| 3300031765|Ga0318554_10258220 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300031779|Ga0318566_10624716 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300031781|Ga0318547_10712559 | Not Available | 624 | Open in IMG/M |
| 3300031796|Ga0318576_10169822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1021 | Open in IMG/M |
| 3300031797|Ga0318550_10258319 | Not Available | 845 | Open in IMG/M |
| 3300031833|Ga0310917_10187224 | Not Available | 1380 | Open in IMG/M |
| 3300031846|Ga0318512_10470967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300031859|Ga0318527_10263971 | Not Available | 732 | Open in IMG/M |
| 3300031879|Ga0306919_10168265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1611 | Open in IMG/M |
| 3300031893|Ga0318536_10015595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3357 | Open in IMG/M |
| 3300031894|Ga0318522_10258402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300031910|Ga0306923_10045253 | All Organisms → cellular organisms → Bacteria | 4829 | Open in IMG/M |
| 3300031910|Ga0306923_10731916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1098 | Open in IMG/M |
| 3300031912|Ga0306921_10293343 | Not Available | 1904 | Open in IMG/M |
| 3300031912|Ga0306921_10316097 | Not Available | 1827 | Open in IMG/M |
| 3300031912|Ga0306921_10604962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1267 | Open in IMG/M |
| 3300031912|Ga0306921_10998307 | Not Available | 944 | Open in IMG/M |
| 3300031962|Ga0307479_11371698 | Not Available | 666 | Open in IMG/M |
| 3300032001|Ga0306922_10364025 | Not Available | 1550 | Open in IMG/M |
| 3300032001|Ga0306922_10507062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1285 | Open in IMG/M |
| 3300032001|Ga0306922_10833400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia ubonensis | 962 | Open in IMG/M |
| 3300032010|Ga0318569_10197231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 20-64-7 | 932 | Open in IMG/M |
| 3300032041|Ga0318549_10048477 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
| 3300032055|Ga0318575_10097409 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300032076|Ga0306924_10631688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Aliidongia → Aliidongia dinghuensis | 1209 | Open in IMG/M |
| 3300032076|Ga0306924_10925855 | Not Available | 962 | Open in IMG/M |
| 3300032091|Ga0318577_10463817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300032091|Ga0318577_10469589 | Not Available | 600 | Open in IMG/M |
| 3300032094|Ga0318540_10356521 | Not Available | 706 | Open in IMG/M |
| 3300032094|Ga0318540_10574302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300032261|Ga0306920_100485486 | Not Available | 1834 | Open in IMG/M |
| 3300032261|Ga0306920_100745195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia ubonensis | 1441 | Open in IMG/M |
| 3300032261|Ga0306920_103890719 | Not Available | 544 | Open in IMG/M |
| 3300033290|Ga0318519_10502352 | Not Available | 730 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 19.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.14% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.43% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.71% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.71% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.71% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_07414410 | 2170459002 | Grass Soil | ALLASNKATQNPSLAAAQPLHPARGTHNPKPIDAHYQAIQVAMQGVFHELGLAA |
| JGIcombinedJ26739_1002869721 | 3300002245 | Forest Soil | AIKPLLAAAQPLRPKRGAHNRKPIDLHYDAIQVAMKGVFHELGLAA* |
| Ga0066395_105507121 | 3300004633 | Tropical Forest Soil | VLRNKAIKPLLAAAQPLRPTGGAHNPRPIDTHYRVIQVAMHGLFHELGLAA* |
| Ga0070705_1009802651 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | DKAIKPLLAAAQPLRPTRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA* |
| Ga0066687_103879951 | 3300005454 | Soil | AAQPLHPARGAHNPKPIDAHYHAIEVAMKGVFHELGLAA* |
| Ga0070733_104203711 | 3300005541 | Surface Soil | PLLAAAQPLRPPRGAHNPTTLDTHYATIRVAMQGVFQELGLAA* |
| Ga0066701_101038364 | 3300005552 | Soil | RPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA* |
| Ga0066903_1039698712 | 3300005764 | Tropical Forest Soil | PLLAATRPLHPTHGGPNPKPIDAHYHALRFAMNGVFHELGIAA* |
| Ga0066903_1053601652 | 3300005764 | Tropical Forest Soil | VVLRNKAIKPLLAAAQPLRPTGGPHNPRPIDTHYRAIQVAMHGVFHELGLAA* |
| Ga0070766_100258505 | 3300005921 | Soil | LAAAQPLRPKRGAHNPKPIDLHYDAIQVAMKDVSMKDVFHELGLAA* |
| Ga0075017_1012217212 | 3300006059 | Watersheds | VLRPLLAAAQSLEPSRGAQNPTPIDHHYQVIRIGMQGVFHELGIGA* |
| Ga0075425_1015945861 | 3300006854 | Populus Rhizosphere | AAAQPLRPTGGAHNPRPIDTHYRAIQVAMHGLFHELGLAA* |
| Ga0099793_104915001 | 3300007258 | Vadose Zone Soil | LRPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA* |
| Ga0099828_111961171 | 3300009089 | Vadose Zone Soil | PLLAAAQPLRPTRGAHNPKPIDLHYHAIQAAMQGVFHELGIAA* |
| Ga0066709_1035812111 | 3300009137 | Grasslands Soil | KAIKPLLAAATAPTTAHNPQPIDLHYHTINVAMQGVFHELGLAA* |
| Ga0099792_102843121 | 3300009143 | Vadose Zone Soil | AAQPLRPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA* |
| Ga0114129_105852702 | 3300009147 | Populus Rhizosphere | LAAAQQLRPARGAQNPKALDTHYDAIRVAMQGVFHELGLAA* |
| Ga0114129_107349691 | 3300009147 | Populus Rhizosphere | KPLLAATQPLHPARGAHNPKPIDAHYQAIRVAMKGVFHEL* |
| Ga0126374_115748671 | 3300009792 | Tropical Forest Soil | KAIKPLLAAAQPHRPTGGAHNPRPIDTHYRVIQVAMHGVFHELGLAA* |
| Ga0126380_102766873 | 3300010043 | Tropical Forest Soil | VLRNKAIKPLLAAAQPLRPTGGAHNPRPIDTHYRVIQVAMHGLLHELGLAA* |
| Ga0126384_105109482 | 3300010046 | Tropical Forest Soil | RPARGAHNPKPIDLHYHTIAIAMQGVFHELGLAA* |
| Ga0126382_110801742 | 3300010047 | Tropical Forest Soil | ALLVLRNKAIKPLLAAAQPLRPTGGAHNPRPIDTHYRVIQVAMHGLLHELGLAA* |
| Ga0126373_102828791 | 3300010048 | Tropical Forest Soil | KAIKPLLAAALPLRPTRGAHNPRPIDTHYRTIQVAMQGVFHELGLAA* |
| Ga0099796_104740112 | 3300010159 | Vadose Zone Soil | AAQPLRPTRGAHNPKPIDLHYDTIQTAMQGVFHELGIAA* |
| Ga0126376_100416091 | 3300010359 | Tropical Forest Soil | RNKAIKPLLAAAQPLRPTGGAHNPRPIDTHYRAIQVAMHGLFHELGLAA* |
| Ga0126376_102052182 | 3300010359 | Tropical Forest Soil | KAIKPLLAAAQPLRPTGAAHNPRPIDTHYRAIQVAMHGVFHELGLAA* |
| Ga0126376_103168942 | 3300010359 | Tropical Forest Soil | RNKAIKPLLAAAQPLRPTGGAHNPRPIDTHYRAIQVAMHGLLHELGLAA* |
| Ga0126372_106740712 | 3300010360 | Tropical Forest Soil | VNKAIKPLLAAARPLHPTRGALNPKPIDAHYHALRFAMQGVFHELGIAA* |
| Ga0126378_105059091 | 3300010361 | Tropical Forest Soil | AIKPLLAAAQPLHPIRGSHNPKPIDHHYQTINLAMQGVFHELGLAA* |
| Ga0126378_115259102 | 3300010361 | Tropical Forest Soil | AIKPLLAAAQPLHPIRGSHNPKPIDHHYQTINLAMQGVFHELGRAA* |
| Ga0126378_131275052 | 3300010361 | Tropical Forest Soil | LLAAAQPLRPTGGAHNPRPIDTHYRAIQVAMHGLFHELGLAT* |
| Ga0126377_104724511 | 3300010362 | Tropical Forest Soil | LRPTGGAHNPRPIDTHYRAIQVAMHGLFHELGLAA* |
| Ga0126377_116610801 | 3300010362 | Tropical Forest Soil | LLVLRNKAIKPLLAAAQPLRPTGGAHNPRPIDTHYRVIQVAMHGLLHELGLAA* |
| Ga0126379_121261161 | 3300010366 | Tropical Forest Soil | VLRNKAIKPLLAAAQPLRPTGGPHNPRPIDTHYRAVQVAMHGVFHELGLAA* |
| Ga0126381_1004088971 | 3300010376 | Tropical Forest Soil | AIKPLLAATQELHPSHGAQNPRSLDTHYQTIYSGMRGVFHELGIAP* |
| Ga0126381_1006538703 | 3300010376 | Tropical Forest Soil | LRNKAIKPLLAAAQPLHPTGGPHNPGPIDTHYRAIQGAMHGVFHELGLAA* |
| Ga0126381_1018259651 | 3300010376 | Tropical Forest Soil | QPLRPTRGPHNPKPIDRHYHTINVAMDGVFHELGLAA* |
| Ga0126381_1020207292 | 3300010376 | Tropical Forest Soil | NKAIKPLLAAAQPLRPTGGAHNPRPIDTHYRAIQVAMHGLFHELGLAT* |
| Ga0126381_1020949662 | 3300010376 | Tropical Forest Soil | LRNKAIKPLLAAAQPLRPTRGPHNPKPIDRHYHTINVPMHGVFHELGLAA* |
| Ga0126381_1044558142 | 3300010376 | Tropical Forest Soil | AIKPLLAAARPLRPTRRASNPQPIDNHYRALQLAMQGVFHELGIAA* |
| Ga0126383_101789404 | 3300010398 | Tropical Forest Soil | LVVLRNKAIKPLLAAAQPLRPTGGAHNPRPIDTHYRAIQVAMHGLFHELGLAT* |
| Ga0126383_103264444 | 3300010398 | Tropical Forest Soil | ALLVLRNKAIKPLLAAAQPLRPTGGAHNPRPIDTHYRVIQVAMHGLFHELGLAA* |
| Ga0126383_115947312 | 3300010398 | Tropical Forest Soil | PLLAAAQPLHSTRGAHNPKPIDVHYQTIQVAMQGVFHELGLAA* |
| Ga0137393_117171901 | 3300011271 | Vadose Zone Soil | PLLAAAQPLRPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA* |
| Ga0137363_102585961 | 3300012202 | Vadose Zone Soil | KAIKPLLAAAQPLHPTRGAQNPKPIDAHYRALQLAMQCVFHQLGIAA* |
| Ga0137363_117203581 | 3300012202 | Vadose Zone Soil | KAIKPLLAAAQPLHPTRGAQNPKPIDAHYRALQLAMQCVFHELGIAA* |
| Ga0137399_113755891 | 3300012203 | Vadose Zone Soil | IKPLLAAAQPLRPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA* |
| Ga0137378_115501372 | 3300012210 | Vadose Zone Soil | AAQELRPARGPQNPKALDTHYDAIRVAMQGVFHELGLAA* |
| Ga0137377_107801232 | 3300012211 | Vadose Zone Soil | KPLLAAAQPLRPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA* |
| Ga0137361_114311281 | 3300012362 | Vadose Zone Soil | ATQPLHSARGAHNPKPIDAHYQAIRVAMKGVFHELGLAA* |
| Ga0137390_107537671 | 3300012363 | Vadose Zone Soil | AIKPLLAAAQPLRPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA* |
| Ga0137397_110917401 | 3300012685 | Vadose Zone Soil | KAIKPLLAAAQPLRPKRGAHNPKPIDLHYDAIQAAIKGVFHELGLAA* |
| Ga0137419_104140442 | 3300012925 | Vadose Zone Soil | VLRDKAIKPLLAAAQPLRPKRGAHNPKPIDLHYDAIQAAIKGVFHELGLAA* |
| Ga0137416_103341061 | 3300012927 | Vadose Zone Soil | PLLAAAQPLHPARGAHNPKPIDAHYHAIEVAMKGVFHELGLTA* |
| Ga0137404_105420781 | 3300012929 | Vadose Zone Soil | GQSSTPDHNPKPIDLHYGAIQAAMKGVFHELGLAA* |
| Ga0137404_118441661 | 3300012929 | Vadose Zone Soil | RNKAIKPLLAAAQELRPTRGAQNSRALDTHYDAIRVAMQGVFHELGIAA* |
| Ga0137404_122351422 | 3300012929 | Vadose Zone Soil | KPLLAAAQPLRPKRGAHNPKPIDLHYDAIQAAIKGVFHELGLAA* |
| Ga0126375_100297351 | 3300012948 | Tropical Forest Soil | LLVLRNKAIKPLLAAAQPLRPTGGAHNPRPIDTHYRVIQVAMHGLFHELGLAA* |
| Ga0126375_103763331 | 3300012948 | Tropical Forest Soil | VLRNKAIKPLLAAAQPLRPTGGAHNPRPIDTHYRAIQVAMHGLFHELGLAA* |
| Ga0164307_118471822 | 3300012987 | Soil | LAAAQARHPARAPHNPKPIDAHYKAIRVAMNGVFHELGLAA* |
| Ga0182036_111038011 | 3300016270 | Soil | NKAIKPLLAAAQPLHPTRGAHNPTPIDTHYQTIQVAMKGVFHELGPAA |
| Ga0182041_100918733 | 3300016294 | Soil | LRNKAIKPLLAAARPLRPIRRASNPQPINTHYRALQLAMHGVFHELGIAA |
| Ga0182041_100931663 | 3300016294 | Soil | LLRNKAIKPLLAAARPLHPTRGALNPKPIDAHYNTLRFAMQGVFHELGIAA |
| Ga0182041_102749292 | 3300016294 | Soil | LIVLRNKAIKPLLAAAQPLHPTRGAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0182041_106246342 | 3300016294 | Soil | AAAQEFKRTRGAQNPRPVDTHYQTIRIAMQGVFHELGITA |
| Ga0182033_100525811 | 3300016319 | Soil | AAQPLHPTRGAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0182035_100334551 | 3300016341 | Soil | LLAAARPLRPARGSHNPKPIDAHYQTIQGAMRGIFHELGLAA |
| Ga0182032_107888652 | 3300016357 | Soil | MTELVVLRNKAIKPLLAAAQPLHSTRGAHNPKAVDLHYQTIYVAMQSVFHELGLAA |
| Ga0182032_113104102 | 3300016357 | Soil | PLHPTRGAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0182032_114329682 | 3300016357 | Soil | TNKAIKPLLAAAQPLRPTRTAQNPQAIDAHNHALRVAMRGLFDELGVAA |
| Ga0182034_101037351 | 3300016371 | Soil | AAQPLHPTRGAHNPTPIDTHYQTIQVAMKGVFHEFGLAA |
| Ga0182034_104921881 | 3300016371 | Soil | NKAIKPLLAAAQPLHPTRGAHNPTPIDMHYQTIQVAMKGVFHELGLAA |
| Ga0182034_105830562 | 3300016371 | Soil | LHPTRGAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0182034_118382442 | 3300016371 | Soil | PLLAAAVPLRPPRGAHNPKPIDAHYHALRFAMQGIFHELGIAA |
| Ga0182040_102799503 | 3300016387 | Soil | LHPTHGAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0182038_105744061 | 3300016445 | Soil | LLAAAQPLHPTRGAHNPTPIDTHYQTIQVAMKGVFHELGIAA |
| Ga0182038_106084431 | 3300016445 | Soil | PLRPIRRASNPQPIDTHYRALQLAMHGVFHELGTAA |
| Ga0187819_106170341 | 3300017943 | Freshwater Sediment | NKAIKPLLAAAQRLRPTRGAHNPRAIDRHYDAMRLAMQGVFHELGLAA |
| Ga0187772_113402071 | 3300018085 | Tropical Peatland | KPLLAAARPLHPSRGGLNPKPIDAHYHALRFAMQGVFHELGIAA |
| Ga0210403_108108192 | 3300020580 | Soil | RDKAIKPLLAAAQPLRPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA |
| Ga0210399_107903572 | 3300020581 | Soil | HTRRYEPLLTGLRAMTALLILRDKAFKPLLAAAQPLRPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA |
| Ga0210399_114250731 | 3300020581 | Soil | LLAAAQPLRPKRGAHNPKPIDLHYDAIQAAMKGVFQELGLAA |
| Ga0210406_101051046 | 3300021168 | Soil | LRAMTALLILRDKAFKPLLAAAQPLQPKRGAHNPKPIDLHYDAIQATMKGAFHELGLAA |
| Ga0210408_100404397 | 3300021178 | Soil | IKPLLAAAQPLRPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA |
| Ga0210408_102523181 | 3300021178 | Soil | LQPKRGAHNPKPIDLYYDAIQAAMKGVFHELGLAA |
| Ga0210393_104500412 | 3300021401 | Soil | RNKAIKPLLAAAQPLRPTRGAHNPKPIDLHYYQIQAAMRGVFHELGLAA |
| Ga0210387_100887864 | 3300021405 | Soil | LLAAAQPLQPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA |
| Ga0210386_116383511 | 3300021406 | Soil | HQTLAPAAQPLRPTRGAHNPKPIDLHYDAIQAAMRGVFLELGLAA |
| Ga0210402_102397675 | 3300021478 | Soil | GLRAMTALLILRDKAFKPLLAAAQPLRPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA |
| Ga0126371_122459001 | 3300021560 | Tropical Forest Soil | PLRATRGAHNAKPIDAHYRTIRIAMNGVFHELALAA |
| Ga0242672_11217171 | 3300022720 | Soil | AQPLQPKRGAHNPKPIDLHYDAIQAAMKGVFHELELAA |
| Ga0207663_111391281 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LRDKAIKPLLAAAQPLQPKRGAHNPKPIDLYYDAIQAAMKGVFHELGLAA |
| Ga0257152_10039961 | 3300026369 | Soil | AAAQPLRPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA |
| Ga0257153_10432721 | 3300026490 | Soil | HFCSIIKPLLAAAQPLRPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA |
| Ga0257161_10325723 | 3300026508 | Soil | LTAIKPLLAAAQPLRPKRGAHNPKPIDLHYDAIQVAMKGVFHELGLAA |
| Ga0308309_112056121 | 3300028906 | Soil | AAQPLHPKRGAYNPTPIDLHYDAIQAAMKGVFHELGLAA |
| Ga0302310_105866732 | 3300030737 | Palsa | TTASLFTHHRAIKPLLAAAQDISPTRGGQNPRPIDRHYQDLRAAMKGVFHELGIAA |
| Ga0318541_105971801 | 3300031545 | Soil | PLLAAAQPLHPTGGPHNPRPIDTHYRAIQVAMHGVFHELGLAA |
| Ga0310915_103185791 | 3300031573 | Soil | IKPLLAAARPLHPTRGALNPKPIDAHYNTLRFAMQGVFHELGIAA |
| Ga0310915_106123862 | 3300031573 | Soil | TALIVLPNKAIKPFLAAAQPLHPTRGAHNPTPIDTHYQTIQGAMKGVFHELGLAA |
| Ga0318542_105429412 | 3300031668 | Soil | LPNKAIKPFLAAAQPLHPTRGAHNPTPIDTHYQTIQGAMKGVFHELGLAA |
| Ga0318500_104881162 | 3300031724 | Soil | IKPLLAAAQPLHPTRSAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0306918_106896751 | 3300031744 | Soil | QGDDRADRPPKQSHQTLLAAAQPLHPTRGAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0318502_109639121 | 3300031747 | Soil | LIVLRNKAIKPLLAAAQPLHPTRGAHNRTPIDTHYQTIQVAMKGVVHELGLTA |
| Ga0318494_101006121 | 3300031751 | Soil | LRPARGSHNPKPIDAHYQTIQGAMRGIFHELGLAA |
| Ga0307477_101528831 | 3300031753 | Hardwood Forest Soil | LRPTRGAHNPKPIDAHYRTIQIAMNGVFHELGLAA |
| Ga0318554_102582201 | 3300031765 | Soil | LAAAQPLHPTRGAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0318566_106247162 | 3300031779 | Soil | LSARTRAPHNPKPIDRHYHTINVAMKGVFHELRLAA |
| Ga0318547_107125592 | 3300031781 | Soil | LLLRNKAIKPLLAAARPLHPTRGALNPKPIDPHYHALRFAMQGVFHELGIAA |
| Ga0318576_101698221 | 3300031796 | Soil | RAMTALIVLRNKAIKPLLAAAQPLHPTRGAHNRTPIDTHYQTIQVAMKGVVHEFGLTA |
| Ga0318550_102583191 | 3300031797 | Soil | LHPTRGAHNPPPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0310917_101872241 | 3300031833 | Soil | KAIKPLLAAAQPLHPTHGAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0318512_104709672 | 3300031846 | Soil | NNAIKPLLAAAQPLHPTRGAHNRTPIDTHYQTIQVAMKGVVHELGLTA |
| Ga0318527_102639711 | 3300031859 | Soil | IKPLLAAAQPLHPTRGAHNPTPIDTHYQTIQGAMKGVFHELGLAA |
| Ga0306919_101682653 | 3300031879 | Soil | KAIKPLLAAARPIHPTRRASNPQPIDTHYRALQLAMQGVFNELGIAA |
| Ga0318536_100155955 | 3300031893 | Soil | ALIVLPNKAIKPLLAAAQPLHPTRGAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0318522_102584021 | 3300031894 | Soil | PLHPTRGAHNPTPIDTHYQTIQVAMKGVFHELALAA |
| Ga0306923_100452531 | 3300031910 | Soil | IKPLLAAARPLRPIRRASNPQPINTHYRALQLAMHGVFHELGIAA |
| Ga0306923_107319162 | 3300031910 | Soil | PLLAAAQPLHPTRGAHNPPPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0306921_102933433 | 3300031912 | Soil | IVLRNKAIKPLLAAAQPLHPTRGAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0306921_103160971 | 3300031912 | Soil | LLAAAQPLHPTRGAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0306921_106049621 | 3300031912 | Soil | KAIKPLLAAARPTRPTRRTHNPQPIDTHYRALQLAMQGVFHELGIAA |
| Ga0306921_109983072 | 3300031912 | Soil | RSPGDDRLLVLRNKAIKPLLAAAQPICPTRAPHNPKPIDRHYHTINVAIKGVFHELGLAA |
| Ga0307479_113716982 | 3300031962 | Hardwood Forest Soil | LRPKRGAHNPKPIDLHYDAIQAAMKGVFHELGLAA |
| Ga0306922_103640252 | 3300032001 | Soil | AAAQPLHPTRGAHNPPPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0306922_105070624 | 3300032001 | Soil | DRPPKQSHQTLLAAAQPLHPTRGAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0306922_108334002 | 3300032001 | Soil | LRNKAIKPLLAAAQPLHPTRGAHNPTPIDTHYQTIQVPMKGVFHELGLAA |
| Ga0318569_101972312 | 3300032010 | Soil | RNKAIKPLLAAAQPLHPTRGPHNPKPIDRHYHAINVAMHGVFQELGLAA |
| Ga0318549_100484774 | 3300032041 | Soil | KAIKPFLAAAQPLHPTRGAHNPTPIDTHYQTIQGAMKGVFHELGLAA |
| Ga0318575_100974092 | 3300032055 | Soil | MTALLVLRNKAIKPLLAAAQPLCPTRGPHNPKPIDRHYHTINVAMKGVFHELRARR |
| Ga0306924_106316881 | 3300032076 | Soil | LRNKAIKPLLAAAQTRHPARGAHNPKPIDVHYDALRRAMHGVFHELGIPA |
| Ga0306924_109258552 | 3300032076 | Soil | NKAIKPLLAAAQPLRPTRAALNQKPIDTYYQAIRAGMKGLFHELGIAA |
| Ga0318577_104638173 | 3300032091 | Soil | AIKPLLAAAQPLHPTRGAHNPTPIDTHYQTIQVAMKGVFHELGLAA |
| Ga0318577_104695891 | 3300032091 | Soil | LCPTRAPHNPKPIDCHYHTINVAIKGVFHELGLAA |
| Ga0318540_103565211 | 3300032094 | Soil | KPFLAAAQPLHPTRGAHNPTPIDTHYQTIQGAMKGVFHELGLAA |
| Ga0318540_105743022 | 3300032094 | Soil | QPLHPTGGPHNPRPIDTHYRAIQVAMHGVFHELGLAA |
| Ga0306920_1004854861 | 3300032261 | Soil | KAIKPLLAAARALHLIRGGLNPKPIDAHYHALRFAMQGIFHELGIAA |
| Ga0306920_1007451952 | 3300032261 | Soil | NKAIKPLLAAAQPLHPTRGAHNPTPIDTHYQTIQVPMKGVFHELGLAA |
| Ga0306920_1038907192 | 3300032261 | Soil | DKAIKPLLAAAQALRPRRGAHNPTLLDAHYDALRSAMRGVFHELGIAA |
| Ga0318519_105023521 | 3300033290 | Soil | PFLAAAQPLHPTRGAHNPTPIDTHYQTIQGAMKGVFHELGLAA |
| ⦗Top⦘ |