


| Basic Information | |
|---|---|
| Family ID | F053633 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNKPKVTAVGRILRPKHGEPRKHQVIKVDEDGKARIVKDVTLP |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 72.34 % |
| % of genes near scaffold ends (potentially truncated) | 23.40 % |
| % of genes from short scaffolds (< 2000 bps) | 67.38 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (82.270 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (29.787 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.447 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (63.121 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 33.80% Coil/Unstructured: 66.20% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF13264 | DUF4055 | 18.44 |
| PF14250 | AbrB-like | 9.93 |
| PF04233 | Phage_Mu_F | 6.38 |
| PF03237 | Terminase_6N | 5.67 |
| PF04883 | HK97-gp10_like | 0.71 |
| PF01402 | RHH_1 | 0.71 |
| PF01555 | N6_N4_Mtase | 0.71 |
| PF05939 | Phage_min_tail | 0.71 |
| PF05866 | RusA | 0.71 |
| PF12684 | DUF3799 | 0.71 |
| PF11160 | Hva1_TUDOR | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.71 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.71 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.71 |
| COG4718 | Phage tail protein | Mobilome: prophages, transposons [X] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 82.27 % |
| All Organisms | root | All Organisms | 17.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 29.79% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.22% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 7.09% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 5.67% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.96% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.96% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.26% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.55% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.84% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.13% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.13% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.13% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.13% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.13% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.13% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.42% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 1.42% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.71% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.71% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.71% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.71% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.71% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.71% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.71% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.71% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.71% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.71% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.71% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019717 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_8-9_MG | Environmental | Open in IMG/M |
| 3300019730 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MG | Environmental | Open in IMG/M |
| 3300019745 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022140 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v3) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100253592 | 3300000116 | Marine | MTRPVVTAVGRLLQPKHGEPRKHQLIQIDADGRAKIIKDQPA* |
| DelMOSpr2010_100813932 | 3300000116 | Marine | MKKPEVTAVGRRVKSKHGELRKHQVIKIDADGKVKIVKDQVLR* |
| DelMOSpr2010_101551242 | 3300000116 | Marine | MTRPIVTAVGRLLQPKHGEPRKHQLIKVDANGRAKIIKDQPA* |
| DelMOSpr2010_101697272 | 3300000116 | Marine | MNKPKVTAVGRILRPKHGEPRKHQVIKVDENGKACIVKDVTLP* |
| DelMOWin2010_100048156 | 3300000117 | Marine | VNKPKVTAVGRILRPKHGEPRKHQVIKVDENGKARIVKDVTLP* |
| DelMOWin2010_100309673 | 3300000117 | Marine | MTRPIVTAVGRLLQPKHGEPRKHQLIQVDANGRAKIIKDQPA* |
| DelMOWin2010_100350132 | 3300000117 | Marine | MTRPVVTAVGRLLQPKHGEPRKHQLIQVDANGRAKIIKDQPA* |
| JGI24006J15134_100386423 | 3300001450 | Marine | MNKPKVTAVGRILRPKHGEPRKHQVIKVDESGKARIVKDVTLP* |
| JGI11772J19994_10276952 | 3300001748 | Saline Water And Sediment | KMKKPEVTAVGRLLKPKHGEPRKHQVIKVDANGKARIVKDKTLDNLTAPAD* |
| Ga0073579_119068232 | 3300005239 | Marine | MTRPVVTAVGRLLQPKHGEPRKHQLIQVDADGRAKIIKDQPA* |
| Ga0074648_10169614 | 3300005512 | Saline Water And Sediment | MKKPEVTAVGRLLKSKHGEPRKHQVIKVDANGKARIVKDKTLDNLTAPAD* |
| Ga0074648_10302672 | 3300005512 | Saline Water And Sediment | MKMKKPEVTAVGRLLKPKHGEPRKHQVIKVDANGKARIVKDKTLDNLTAPAD* |
| Ga0074648_10463133 | 3300005512 | Saline Water And Sediment | MKPEVTAVGRRLKPKHGEPRKHQVIKIDADGKAKIIKDQVLK* |
| Ga0074648_10581751 | 3300005512 | Saline Water And Sediment | MKKPEVTAVGRLLKPKHGEPRKHQVIKVDANGKARIVKD |
| Ga0074648_11099553 | 3300005512 | Saline Water And Sediment | MKKPEVTAVGRRLKSKHGELRKHQVIKIDADGKAKITKDQVLK* |
| Ga0074648_11710373 | 3300005512 | Saline Water And Sediment | MKKPEVTAVGRLLKSKHGEPRKHQVIKVDANGKARIV |
| Ga0074648_12202973 | 3300005512 | Saline Water And Sediment | MKKPEVTAVGRLLKPKHGEPRKHQVIKVDANGNARIVKDKTLDNLTAPA |
| Ga0068877_106401162 | 3300005525 | Freshwater Lake | MKPTVTAVGRILKPKGNEPRKHQVIKVDAAGKAKIVKDQILQ* |
| Ga0068872_104365403 | 3300005528 | Freshwater Lake | MQKPEVTAVGRLLKPKGAEPRKHQVIKVDAAGKAKIVKDQILQ* |
| Ga0076924_11953922 | 3300005747 | Marine | MNKPKVTAVGRILRPKHGEPRKHQVIKVDENGKARIVKDVTLP* |
| Ga0075474_100393253 | 3300006025 | Aqueous | MIRHPQITAVGRLLKSKHGEPRKHQVIKIDSDGKAKITIDKTLDNG* |
| Ga0075474_101225453 | 3300006025 | Aqueous | MKPKVTAVGRLLKSKHGEPRKHQVIKIDADGKAQITKNKTLDNG* |
| Ga0075474_101356182 | 3300006025 | Aqueous | MKPKVTAVGRLLKSKHGEPRKHQVIKIDADGKAKITIDKTLDNG* |
| Ga0075478_101758362 | 3300006026 | Aqueous | MSKPVVTAVGRLLKSKHGEPRKHQVIKIDADGKAKIAIDKTLDNG* |
| Ga0075466_10369072 | 3300006029 | Aqueous | MTQPIVTAVGRLLQPKHGEPRKHQLIKVDANGRAKIIKDQPA* |
| Ga0098038_11210642 | 3300006735 | Marine | MNRPKVTAVGRILRPKHGEPRKHQVLKVDANGKAKIVKDVTLP* |
| Ga0098037_12435101 | 3300006737 | Marine | MNKPKVTAVGRILQPKHGEPRKHQVLKVDANGNAKIVKDVTLP* |
| Ga0070754_1000795612 | 3300006810 | Aqueous | MKPKVTAVGRLLKSKHGEPRKHQVIKIDSDGSSRIVVDKTLDNA* |
| Ga0070754_102087342 | 3300006810 | Aqueous | MIRHPQITAVGRLLKSKHGELRKHQVIKIDSDGKAKITIDKTLDNG* |
| Ga0070754_103384452 | 3300006810 | Aqueous | MTRRPQITAVGRLLKSKHGEPRKHQVIKIDADGKAKIAIDKTLDNG* |
| Ga0070750_103198901 | 3300006916 | Aqueous | MNRPVVTAVGRILKPKHGEPRVHSVIKISKDGTAKETRREVLKD* |
| Ga0070748_10723335 | 3300006920 | Aqueous | MTRPVVTAVGRLLQPKHGEPRKHQLIKVDANGRAKIIK |
| Ga0098060_10905962 | 3300006921 | Marine | MNRPKVTAVGRILRPKHGEPRKHQVLKVDANGNAKIVKDVTLP* |
| Ga0070745_13648402 | 3300007344 | Aqueous | MTRRPQITAVGRLLKSKHGEPRKHQLIKIDADGKAKIAIDKTLDNG* |
| Ga0099849_10389382 | 3300007539 | Aqueous | MTRRPQITAVGRLLKSKHGEPRKHQVIKIDADGNAKITIDKTLDNG* |
| Ga0099849_11987173 | 3300007539 | Aqueous | TEHKITAVGRRLKSKHGEPRKHQIIKVDSDGNAKIVKDQPLDRG* |
| Ga0099847_10779132 | 3300007540 | Aqueous | MTEHKITAVGRLLKSKHGEPRKHQVIKIDADGKAKIAIDKTLDNC* |
| Ga0102861_10009353 | 3300007544 | Estuarine | MTRPIVTAVGRALKPKGDEPRKHQVIKVDSTGQARITIDRVLPQ* |
| Ga0070751_13403832 | 3300007640 | Aqueous | MSKPVVTAVGRLLKPKHGEPRKHQVIKIDADGKAKIAIDKTLDNG* |
| Ga0099850_13951041 | 3300007960 | Aqueous | MTRPVVTAVGRLLQPKHGEPRKHQLIQVDANGRAKIIKYQPA* |
| Ga0075480_105583492 | 3300008012 | Aqueous | MTEHKVTAVGRILKPKHGEPRKHQVIKIDADGKARIAKNKTLDNG* |
| Ga0114340_10137297 | 3300008107 | Freshwater, Plankton | MKPTVTAVGRILKPKGSEPRKHQVIKVDAAGKAKIV |
| Ga0114350_10429843 | 3300008116 | Freshwater, Plankton | MTKPIVTAVGRLLKPKGNEPRKHQVIKVDAAGKAKIVKDQILQ* |
| Ga0114351_11542513 | 3300008117 | Freshwater, Plankton | VTKPTVTSVGRILKPKGNEPRKHQVIKVDAAGKAKIVKDQILQ* |
| Ga0114354_11805481 | 3300008119 | Freshwater, Plankton | MTKPIVTAVGRLLKPKGNEPRKHQVIKVDAAGKAKIVKDQIL |
| Ga0114355_10910172 | 3300008120 | Freshwater, Plankton | VGRILKPKGNEPRKHQVIKVDAAGKAKIVKDQILQ* |
| Ga0114841_10581401 | 3300008259 | Freshwater, Plankton | MNPTVTAVGRILKPKGSEPRKHQVIKVDAAGKAKIVKDQILQ* |
| Ga0114337_12692421 | 3300008262 | Freshwater, Plankton | MTKPIVTSVGRLLKPKGNEPRKHQVIKVDAAGKAKIVKDQILQ* |
| Ga0102815_100587781 | 3300009080 | Estuarine | VTRPVVTAVGRLLQPKHGEPRKHQLIQVDANGRAKIIKD |
| Ga0118687_101909892 | 3300009124 | Sediment | MTEHKVTAVGRLLKSKHGEPRKHQVIKIDADGKARITKNKTLDNG* |
| Ga0114918_104448423 | 3300009149 | Deep Subsurface | MTRPIVTAVGRLLQPKHGEPRKHQLIQVDADGRAKIIKDQPA* |
| Ga0114980_100035414 | 3300009152 | Freshwater Lake | MTCPIVTAVGRALKPKGDEPRKHQVIKVDSTGQARITIDRVLPQ* |
| Ga0115565_100086824 | 3300009467 | Pelagic Marine | MTRPVVTAVGRLLQPKHGEPRKHQLIKVDANGRAKIIKDQPA* |
| Ga0129348_10607442 | 3300010296 | Freshwater To Marine Saline Gradient | MTEHKVTAVGRLLKSKHGEPRKHQVIKIDADGKAKITIDKTLDNG* |
| Ga0129351_12600892 | 3300010300 | Freshwater To Marine Saline Gradient | MSKPVVTAVGRILKPKHGEPRKHQVIKIDADGKAKITIDKTLDNG* |
| Ga0129324_101483522 | 3300010368 | Freshwater To Marine Saline Gradient | MIKPVVTAVGRVLKPKHGEPRKHQVIKIDPDGKAKITIDKTLDNA* |
| Ga0136549_100066694 | 3300010389 | Marine Methane Seep Sediment | MKKPEVTGVGRRLKAKHGEPRKHQVIKIAADGKAKIVKDQTL* |
| Ga0181412_10281033 | 3300017714 | Seawater | MNKPKVTAVGRILRPKHGEPRKHQVIKVDEDGKARIVKDVTLP |
| Ga0181398_10042174 | 3300017725 | Seawater | MNRPKVTSVGRILRPKHGEPRKHQVLKVDANGKAKIVKDVTLP |
| Ga0181419_100006722 | 3300017728 | Seawater | MNKPKVTAVGRILWPKHGEPRKHQVIKVDEDGKARIVKDVTLP |
| Ga0181419_10075802 | 3300017728 | Seawater | MNNPKVTAVGRILRPKHGEPRKHQVLKVDANGKAKIVKDVTLP |
| Ga0181419_10089273 | 3300017728 | Seawater | MNKPKVTAVGRILLPKHGEPRKHQVLKVDAKGNAKIVKDVTLP |
| Ga0181389_10414492 | 3300017746 | Seawater | MNKPKVTAVGRILRPKHGEPRKHQVLKVDANGNAKIVKDVTLP |
| Ga0181400_12180041 | 3300017752 | Seawater | MTRPVVTAVGRLLQPKHGEPRKHQLIQVDANGRAK |
| Ga0181411_10418422 | 3300017755 | Seawater | MSLKMQKSKVTAVGRILRPKHGEPRKHQVIKVDENGKARIVKDVTLP |
| Ga0181382_11034231 | 3300017756 | Seawater | MKKPKVTAVGRILRPKHGEPRKHQTIKVDQNGNARIVKDVVLP |
| Ga0181420_10737103 | 3300017757 | Seawater | VNLPVVTAIGRRLKPKNGEPRKYQLIQIDENGRAKIIKDQLT |
| Ga0181409_11961022 | 3300017758 | Seawater | MNNPKVTAVGRILRPKHGEPRKHQVLKVDANGNAKIVKDVTLP |
| Ga0181410_10084642 | 3300017763 | Seawater | MNRPIVTAVGRLLQPKHGEPRKHQLIQVDANGRAKIIKDQPA |
| Ga0181380_10141582 | 3300017782 | Seawater | MTRPVVTAVGRLLQPKHGEPRKRQLIQVDANGRAKIIKDQPA |
| Ga0181577_100559461 | 3300017951 | Salt Marsh | PVVTAVGRVLESKHGEPRKHQVIKIDADGKAKITIDKTLDNG |
| Ga0181577_101054933 | 3300017951 | Salt Marsh | MKMKKPEVTAVGRLLKSKHGEPRKHQVIKVDANGKARIAKDQSL |
| Ga0181577_101736822 | 3300017951 | Salt Marsh | MTKPVVTAVGRILKPKHGEPRKHQVIKIDSDGNSRIVVDKTLDNA |
| Ga0181577_103474622 | 3300017951 | Salt Marsh | MIQSNVTAVGRILKPKHGEPRKHQVIRINSDGGSYIAIDKILNEATTTTAAD |
| Ga0181577_105573802 | 3300017951 | Salt Marsh | MTRPVVTAVGRLLQPKHGEPRKHQLIKVDANGRAKIIKDQPA |
| Ga0181563_100654481 | 3300018420 | Salt Marsh | RRGNSMTRPVVTAVGRLLQPKHGEPRKHQLIQVDANGRAKIIKDQPA |
| Ga0181591_103901693 | 3300018424 | Salt Marsh | MIKPVVTAVGRVLKPKHGEPRKHQVIKINADGKAKITIDKTLDNG |
| Ga0188851_10027703 | 3300018682 | Freshwater Lake | MTRPVVTAVGRLLQPKHGEPRKHQLIQVDENGKARILKDVTLP |
| Ga0181562_104287041 | 3300019459 | Salt Marsh | QMNRPVVTAVGRILKSKHGEPRVHSVIKISKDGTAKETRREVLKD |
| Ga0193972_10011162 | 3300019717 | Sediment | MTRPVVTAVGRLLQPKHGEPRKHQLIQVDANGRAKIIKDQPA |
| Ga0194001_10023982 | 3300019730 | Sediment | MTQPIVTAVGRLLQPKHGEPRKHQLIKVDANGRAKIIKDQPA |
| Ga0194002_10391191 | 3300019745 | Sediment | MKPKVTAVGRLLKSTHGEPRKHQVIKIDADGKAKITIDKTLDNG |
| Ga0194024_10465071 | 3300019765 | Freshwater | MSKPVVTAVGRLLKSKHGEPRKHQVIKIDADGKAKIAIDKTLDNG |
| Ga0194024_10577102 | 3300019765 | Freshwater | MTEHKVTAVGRLLKSKHGEPRKHQVIKIDADGKAKITIDKTLDNG |
| Ga0181359_10577581 | 3300019784 | Freshwater Lake | MTRPIVTAVGRALKPKGDEPRKHQVIKVDSTGQARITID |
| Ga0211529_100014717 | 3300020258 | Marine | MNKPKVTAVGRILRPKNGEPRKHQLIKVDESGKAKIVKDVTLP |
| Ga0211557_1000091540 | 3300020418 | Marine | MSKPKVTAVGRILRPKNGEPRKHQLIKVDENGKAKIVKDVTLP |
| Ga0211558_1000010927 | 3300020439 | Marine | MKPKVTAVGRMLQPKNGKPRKHQVIKVDANGKAKIIKDKTLDN |
| Ga0211545_100499671 | 3300020452 | Marine | MNRPKVTAVGRILRPKHGEPRKHQVLKVDANGKAKIVKDVTLP |
| Ga0213858_100469333 | 3300021356 | Seawater | MKPKVTAVGRLLKSKHGEPRKHQVIKVDADGKARIVKDETLDN |
| Ga0222718_100320433 | 3300021958 | Estuarine Water | MTEHKVTAVGRLLKSKHGEPRKHQVIKIDADGKARITKNKTLDNG |
| Ga0196883_10283421 | 3300022050 | Aqueous | MIKPVVTAVGRVLKSRHGEPRKHQVIKIDADGKARITKNKTLD |
| Ga0212025_10249082 | 3300022057 | Aqueous | MIRHPQITAVGRLLKSKHGEPRKHQVIKIDSDGKAKITIDKTLDNG |
| Ga0212024_10904432 | 3300022065 | Aqueous | SKQKTSWIQNAERNEKVNKPKVTAVGRILRPKHGEPRKHQVIKVDENGKARIVKDVTLP |
| Ga0212021_10064283 | 3300022068 | Aqueous | VNKPKVTAVGRILRPKHGEPRKHQVIKVDENGKARIVKDVTLP |
| Ga0212021_10184393 | 3300022068 | Aqueous | MTRPIVTAVGRLLQPKHGEPRKHQLIKVDANGRAKI |
| Ga0196885_1009842 | 3300022140 | Aqueous | RRRGNSMTRPIVTAVGRLLQPKHGEPRKHQLIKVDANGRAKIIKDQPA |
| Ga0212027_10364381 | 3300022168 | Aqueous | HPQITAVGRLLKSKHGEPRKHQVIKIDSDGKAKITIDKTLDNG |
| Ga0196899_10510452 | 3300022187 | Aqueous | MSKPVVTAVGRALKPKHGEPRKHQVIKIDADGNAKITIDKTLDNG |
| Ga0196899_11156903 | 3300022187 | Aqueous | MKPKVTAVGRLLKSKHGEPRKHQVIKIDSDGSSRIVVDKTLD |
| Ga0196899_12050402 | 3300022187 | Aqueous | MKPKVTAVGRLLKSKHGEPRKHQVIKIDADGKAKITIDKTLDNG |
| Ga0181354_10978501 | 3300022190 | Freshwater Lake | ESSMTRPIVTAVGRALKPKGDEPRKHQVIKVDSTGQARITIDRVLPQ |
| Ga0255752_102711802 | 3300022929 | Salt Marsh | MNRPVVTAVGRILKSKHGEPRVHSVIKISKDGTAKETRREVLKD |
| Ga0255781_100089724 | 3300022934 | Salt Marsh | MKKPEVTAVGRLLKSKHGEPRKHQVIKVDANGKARIAKDQSL |
| (restricted) Ga0233438_100110987 | 3300024255 | Seawater | MTRPVVTAVGRLLQPKHGEPRKHQLIQVDANGRAKIIKDEPA |
| Ga0209535_11123712 | 3300025120 | Marine | MNKPKVTAVGRILRPKHGEPRKHQVIKVDESGKARIVKDVTLP |
| Ga0208303_10138792 | 3300025543 | Aqueous | MTRPIVTAVGRLLQPKHGEPRKHQLIKVDANGRAKIIKDQPA |
| Ga0208303_10632382 | 3300025543 | Aqueous | MTEHKITAVGRLLKSKHGEPRKHQVIKIDADGKAKIAIDKTLDNC |
| Ga0208643_11150161 | 3300025645 | Aqueous | MTRPIVTAVGRLLQPKHGEPRKHQLIKVDANGRAKII |
| Ga0208898_10135213 | 3300025671 | Aqueous | MKPKVTAVGRLLKSKHGEPRKHQVIKIDSDGSSRIVVDKTLDNA |
| Ga0208898_11356562 | 3300025671 | Aqueous | MKPKVTAVGRLLKSKHGEPRKHQVIKIDADGKAQITKNKTLDNG |
| Ga0208162_10619953 | 3300025674 | Aqueous | MTRRPQITAVGRLLKSKHGEPRKHQVIKIDADGNAKITIDKTLDNG |
| Ga0208543_10128191 | 3300025810 | Aqueous | RGNSMTRPIVTAVGRLLQPKHGEPRKHQLIKVDANGRAKIIKDQPA |
| Ga0208785_10212433 | 3300025815 | Aqueous | PIVTAVGRLLQPKHGEPRKHQLIKVDANGRAKIIKDQPA |
| Ga0208544_101764121 | 3300025887 | Aqueous | IQDAKGDALMNRPKVTAVGRILRPKHGEPRKHQVLKVDANGKAKIVKDVTLP |
| Ga0208671_100474401 | 3300027757 | Estuarine | VTRPVVTAVGRLLQPKHGEPRKHQLIQVDANGRAKIIKDQP |
| Ga0209088_1000077739 | 3300027763 | Freshwater Lake | MTCPIVTAVGRALKPKGDEPRKHQVIKVDSTGQARITIDRVLPQ |
| Ga0209500_100224741 | 3300027782 | Freshwater Lake | RRGSSMTCPIVTAVGRALKPKGDEPRKHQVIKVDSTGQARITIDRVLPQ |
| Ga0183755_10425322 | 3300029448 | Marine | MSKPKVTAVGRILRPKNGEPRKHQLIKVDESGKAKIVKDVTLP |
| Ga0183755_10732602 | 3300029448 | Marine | MNRPKVTAVGRILRPKHGEPRKHQVLKVDANGKAK |
| Ga0307488_1000066732 | 3300031519 | Sackhole Brine | MTRPVVTAVGRLLQSKHGEPRKHQLIQVDANGRAKIIKDEPA |
| Ga0307488_100152713 | 3300031519 | Sackhole Brine | MTRPVVTAVGRLLQPKHGEPRKHQLIQVDADGRAKIIKDQPA |
| Ga0307488_101193243 | 3300031519 | Sackhole Brine | MNKPKVTAVGRILRPKHGEPRKHQVIKVDENGKARIVKDVTLP |
| Ga0315291_103020302 | 3300031707 | Sediment | RRRRRGSSMTRPIVTAVGRALKPKGDEPRKHQVIKVDSTGQAQITIDRVLPQ |
| Ga0315907_101526831 | 3300031758 | Freshwater | MQKPEVTAVGRLLKPKGAEPRKHQVIKVDAAGKAKIVKDQILQ |
| Ga0315907_103354781 | 3300031758 | Freshwater | MKPTVTAVGRILKPKGNEPRKHQVIKVDAAGKAKIVKDQILQ |
| Ga0315907_105782482 | 3300031758 | Freshwater | VTKPTVTSVGRILKPKGNEPRKHQVIKVDAAGKAKIVKDQILQ |
| Ga0315907_106052203 | 3300031758 | Freshwater | MKPTVTAVGRILKPKGSEPRKHQVIKVDAAGKAKIVKDQILQ |
| Ga0315278_115706421 | 3300031997 | Sediment | MTRPIVTAVGRALKPKGDEPRKHQVIKVDSTGQARITIDR |
| Ga0315274_110269371 | 3300031999 | Sediment | TRPIVTAVGRALKPKGDEPRKHQVIKVDSTGQARITIDRVLPQ |
| Ga0315315_111181612 | 3300032073 | Seawater | MKKPKVTAVGRILRPKNGEPRKHQLIKVDESGKAKIVKDVTLP |
| Ga0316201_105122753 | 3300032136 | Worm Burrow | MIKPVVTAVGRVLKSKHGEPHKHQVIKIDADGKARITKNKTLDNG |
| Ga0316201_110770903 | 3300032136 | Worm Burrow | MKLKVTAVGRLLKSKHGEPRKHQVIKIDADGKAKITIDKTLDNG |
| Ga0314858_043379_847_978 | 3300033742 | Sea-Ice Brine | VNKPKVTTVGRILRPKHGEPRKHQVIKVDENGKARIVKDVTLP |
| Ga0310130_0071180_847_984 | 3300034073 | Fracking Water | MTKPTVTAVGRILKPKGSEPRKHQVIKVYPDGQAFIVIDRVLTAT |
| Ga0348335_007449_2320_2460 | 3300034374 | Aqueous | MTMKPKVTAVGRLLKSKHGEPRKHQVIKIDADGKAQITKNKTLDNG |
| Ga0348335_012289_4325_4462 | 3300034374 | Aqueous | MIKPVVTAVGRVLKSRHGEPRKHQVIKIDADGKARITKNKTLDNG |
| Ga0348335_020081_2251_2382 | 3300034374 | Aqueous | MKKPEVTAVGRRVKSKHGELRKHQVIKIDADGKVKIVKDQVLR |
| Ga0348336_115372_768_872 | 3300034375 | Aqueous | MTRPIVTAVGRLLQPKHGEPRKHQLIKVDANGRAK |
| Ga0348336_161194_38_178 | 3300034375 | Aqueous | MTMKPKVTAVGRLLKSKHGEPRKHQVIKIDSDGSSRIVVDKTLDNA |
| Ga0348336_171534_21_161 | 3300034375 | Aqueous | MTRRPQITAVGRLLKSKHGEPRKHQVIKIDADGNAKITIDKALDNG |
| ⦗Top⦘ |