


| Basic Information | |
|---|---|
| Family ID | F053540 |
| Family Type | Metagenome |
| Number of Sequences | 141 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MDIDTLNYLGYWEVFEISLYLAVMYTGKGFIDEFFNRRLK |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.85 % |
| % of genes near scaffold ends (potentially truncated) | 16.31 % |
| % of genes from short scaffolds (< 2000 bps) | 76.60 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (45.390 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (48.936 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.106 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (99.291 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF00085 | Thioredoxin | 7.09 |
| PF03851 | UvdE | 5.67 |
| PF00565 | SNase | 5.67 |
| PF07659 | DUF1599 | 1.42 |
| PF00730 | HhH-GPD | 1.42 |
| PF00478 | IMPDH | 1.42 |
| PF14743 | DNA_ligase_OB_2 | 1.42 |
| PF07700 | HNOB | 1.42 |
| PF08406 | CbbQ_C | 1.42 |
| PF02810 | SEC-C | 0.71 |
| PF02562 | PhoH | 0.71 |
| PF00011 | HSP20 | 0.71 |
| PF01327 | Pep_deformylase | 0.71 |
| PF12728 | HTH_17 | 0.71 |
| PF05838 | Glyco_hydro_108 | 0.71 |
| PF12705 | PDDEXK_1 | 0.71 |
| PF00156 | Pribosyltran | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 5.67 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.42 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 1.42 |
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 1.42 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.42 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 1.42 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 1.42 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.71 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.71 |
| COG3926 | Lysozyme family protein | General function prediction only [R] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.21 % |
| Unclassified | root | N/A | 29.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001949|GOS2238_1034528 | All Organisms → Viruses → Predicted Viral | 1536 | Open in IMG/M |
| 3300002482|JGI25127J35165_1026152 | All Organisms → Viruses → Predicted Viral | 1366 | Open in IMG/M |
| 3300002483|JGI25132J35274_1013423 | All Organisms → cellular organisms → Bacteria | 2000 | Open in IMG/M |
| 3300004097|Ga0055584_100209090 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
| 3300005057|Ga0068511_1008466 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300005057|Ga0068511_1033073 | Not Available | 802 | Open in IMG/M |
| 3300005400|Ga0066867_10248712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 644 | Open in IMG/M |
| 3300005427|Ga0066851_10135972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 788 | Open in IMG/M |
| 3300005430|Ga0066849_10210816 | Not Available | 754 | Open in IMG/M |
| 3300005514|Ga0066866_10191879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 719 | Open in IMG/M |
| 3300005523|Ga0066865_10380897 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005605|Ga0066850_10125031 | Not Available | 958 | Open in IMG/M |
| 3300005606|Ga0066835_10043022 | All Organisms → Viruses → Predicted Viral | 1329 | Open in IMG/M |
| 3300006024|Ga0066371_10013865 | All Organisms → Viruses → Predicted Viral | 2152 | Open in IMG/M |
| 3300006166|Ga0066836_10156715 | All Organisms → Viruses → Predicted Viral | 1342 | Open in IMG/M |
| 3300006735|Ga0098038_1005845 | All Organisms → Viruses → Predicted Viral | 4987 | Open in IMG/M |
| 3300006735|Ga0098038_1006538 | Not Available | 4714 | Open in IMG/M |
| 3300006735|Ga0098038_1165970 | Not Available | 728 | Open in IMG/M |
| 3300006735|Ga0098038_1199538 | Not Available | 648 | Open in IMG/M |
| 3300006735|Ga0098038_1299385 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006737|Ga0098037_1060566 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300006737|Ga0098037_1236864 | Not Available | 588 | Open in IMG/M |
| 3300006738|Ga0098035_1245811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 590 | Open in IMG/M |
| 3300006749|Ga0098042_1016287 | All Organisms → Viruses → Predicted Viral | 2242 | Open in IMG/M |
| 3300006751|Ga0098040_1045410 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300006752|Ga0098048_1030416 | All Organisms → Viruses → Predicted Viral | 1760 | Open in IMG/M |
| 3300006752|Ga0098048_1069613 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
| 3300006752|Ga0098048_1230534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 543 | Open in IMG/M |
| 3300006754|Ga0098044_1307017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 606 | Open in IMG/M |
| 3300006789|Ga0098054_1027036 | All Organisms → Viruses → Predicted Viral | 2258 | Open in IMG/M |
| 3300006789|Ga0098054_1105420 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
| 3300006789|Ga0098054_1364937 | Not Available | 510 | Open in IMG/M |
| 3300006793|Ga0098055_1169518 | Not Available | 836 | Open in IMG/M |
| 3300006793|Ga0098055_1222729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 713 | Open in IMG/M |
| 3300006921|Ga0098060_1222089 | Not Available | 513 | Open in IMG/M |
| 3300006924|Ga0098051_1166530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 580 | Open in IMG/M |
| 3300006928|Ga0098041_1182984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 672 | Open in IMG/M |
| 3300006928|Ga0098041_1238628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 580 | Open in IMG/M |
| 3300008050|Ga0098052_1050268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1802 | Open in IMG/M |
| 3300008952|Ga0115651_1136154 | All Organisms → Viruses → Predicted Viral | 1754 | Open in IMG/M |
| 3300009071|Ga0115566_10705271 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009376|Ga0118722_1403987 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300009423|Ga0115548_1135890 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300009476|Ga0115555_1021984 | All Organisms → cellular organisms → Bacteria | 3182 | Open in IMG/M |
| 3300009550|Ga0115013_10353176 | Not Available | 924 | Open in IMG/M |
| 3300010148|Ga0098043_1005577 | Not Available | 4322 | Open in IMG/M |
| 3300010148|Ga0098043_1017293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2335 | Open in IMG/M |
| 3300010148|Ga0098043_1023101 | All Organisms → Viruses → Predicted Viral | 1986 | Open in IMG/M |
| 3300010148|Ga0098043_1055373 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300010153|Ga0098059_1259455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 669 | Open in IMG/M |
| 3300010153|Ga0098059_1335737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 575 | Open in IMG/M |
| 3300012920|Ga0160423_10378673 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300012920|Ga0160423_10460980 | Not Available | 866 | Open in IMG/M |
| 3300012920|Ga0160423_10972817 | Not Available | 568 | Open in IMG/M |
| 3300012928|Ga0163110_10054118 | All Organisms → cellular organisms → Bacteria | 2540 | Open in IMG/M |
| 3300012928|Ga0163110_10129215 | All Organisms → Viruses → Predicted Viral | 1725 | Open in IMG/M |
| 3300012952|Ga0163180_10364522 | Not Available | 1046 | Open in IMG/M |
| 3300012953|Ga0163179_10423846 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1084 | Open in IMG/M |
| 3300012954|Ga0163111_12493314 | Not Available | 526 | Open in IMG/M |
| 3300012954|Ga0163111_12612226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 515 | Open in IMG/M |
| 3300017703|Ga0181367_1002536 | All Organisms → Viruses → Predicted Viral | 3371 | Open in IMG/M |
| 3300017705|Ga0181372_1028254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 952 | Open in IMG/M |
| 3300017708|Ga0181369_1122716 | Not Available | 526 | Open in IMG/M |
| 3300017717|Ga0181404_1181026 | Not Available | 504 | Open in IMG/M |
| 3300017721|Ga0181373_1077640 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300017731|Ga0181416_1149244 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300017757|Ga0181420_1000659 | Not Available | 13704 | Open in IMG/M |
| 3300017757|Ga0181420_1103454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 875 | Open in IMG/M |
| 3300017764|Ga0181385_1000068 | Not Available | 33824 | Open in IMG/M |
| 3300017764|Ga0181385_1007976 | All Organisms → cellular organisms → Archaea | 3468 | Open in IMG/M |
| 3300017771|Ga0181425_1154082 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300017775|Ga0181432_1025252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1562 | Open in IMG/M |
| 3300017775|Ga0181432_1274747 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300017967|Ga0181590_10759399 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300018049|Ga0181572_10555941 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300020247|Ga0211654_1023035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 995 | Open in IMG/M |
| 3300020247|Ga0211654_1060875 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300020251|Ga0211700_1028527 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300020280|Ga0211591_1012244 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300020334|Ga0211593_1010039 | All Organisms → cellular organisms → Bacteria | 2117 | Open in IMG/M |
| 3300020359|Ga0211610_1175823 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300020377|Ga0211647_10109431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 942 | Open in IMG/M |
| 3300020389|Ga0211680_10109400 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300020392|Ga0211666_10104428 | Not Available | 1139 | Open in IMG/M |
| 3300020400|Ga0211636_10019336 | Not Available | 3132 | Open in IMG/M |
| 3300020409|Ga0211472_10451495 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300020413|Ga0211516_10397026 | Not Available | 611 | Open in IMG/M |
| 3300020416|Ga0211644_10351786 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300020421|Ga0211653_10004421 | All Organisms → cellular organisms → Bacteria | 7337 | Open in IMG/M |
| 3300020421|Ga0211653_10166979 | Not Available | 970 | Open in IMG/M |
| 3300020421|Ga0211653_10191097 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300020436|Ga0211708_10407608 | Not Available | 557 | Open in IMG/M |
| 3300020436|Ga0211708_10467319 | Not Available | 518 | Open in IMG/M |
| 3300020437|Ga0211539_10030466 | All Organisms → Viruses → Predicted Viral | 2116 | Open in IMG/M |
| 3300020438|Ga0211576_10008970 | Not Available | 6417 | Open in IMG/M |
| 3300020438|Ga0211576_10202562 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
| 3300020439|Ga0211558_10296867 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300020442|Ga0211559_10010177 | All Organisms → Viruses → Predicted Viral | 4893 | Open in IMG/M |
| 3300020442|Ga0211559_10012481 | All Organisms → Viruses → Predicted Viral | 4375 | Open in IMG/M |
| 3300020442|Ga0211559_10073284 | All Organisms → Viruses → Predicted Viral | 1665 | Open in IMG/M |
| 3300020453|Ga0211550_10298356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 755 | Open in IMG/M |
| 3300020457|Ga0211643_10034105 | All Organisms → cellular organisms → Bacteria | 2565 | Open in IMG/M |
| 3300020470|Ga0211543_10482042 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 591 | Open in IMG/M |
| 3300020471|Ga0211614_10253016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 768 | Open in IMG/M |
| 3300020471|Ga0211614_10458326 | Not Available | 565 | Open in IMG/M |
| 3300021068|Ga0206684_1291585 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300021084|Ga0206678_10412329 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300021185|Ga0206682_10038696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2735 | Open in IMG/M |
| 3300021365|Ga0206123_10099819 | Not Available | 1389 | Open in IMG/M |
| 3300021365|Ga0206123_10420060 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300021368|Ga0213860_10121703 | All Organisms → Viruses → Predicted Viral | 1146 | Open in IMG/M |
| 3300025072|Ga0208920_1026869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1218 | Open in IMG/M |
| 3300025086|Ga0208157_1129742 | Not Available | 576 | Open in IMG/M |
| 3300025099|Ga0208669_1011703 | All Organisms → Viruses → Predicted Viral | 2424 | Open in IMG/M |
| 3300025099|Ga0208669_1055134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 899 | Open in IMG/M |
| 3300025101|Ga0208159_1006768 | All Organisms → Viruses → Predicted Viral | 3352 | Open in IMG/M |
| 3300025101|Ga0208159_1081762 | Not Available | 609 | Open in IMG/M |
| 3300025101|Ga0208159_1092926 | Not Available | 550 | Open in IMG/M |
| 3300025102|Ga0208666_1016479 | All Organisms → Viruses → Predicted Viral | 2413 | Open in IMG/M |
| 3300025110|Ga0208158_1104661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 663 | Open in IMG/M |
| 3300025110|Ga0208158_1149660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 530 | Open in IMG/M |
| 3300025127|Ga0209348_1000253 | Not Available | 30007 | Open in IMG/M |
| 3300025127|Ga0209348_1003259 | Not Available | 7400 | Open in IMG/M |
| 3300025127|Ga0209348_1039168 | All Organisms → Viruses → Predicted Viral | 1651 | Open in IMG/M |
| 3300025132|Ga0209232_1001252 | Not Available | 13952 | Open in IMG/M |
| 3300025132|Ga0209232_1037141 | All Organisms → Viruses → Predicted Viral | 1838 | Open in IMG/M |
| 3300025132|Ga0209232_1048307 | All Organisms → Viruses → Predicted Viral | 1564 | Open in IMG/M |
| 3300025133|Ga0208299_1232736 | Not Available | 528 | Open in IMG/M |
| 3300025151|Ga0209645_1000746 | Not Available | 16654 | Open in IMG/M |
| 3300026257|Ga0208407_1029767 | All Organisms → Viruses → Predicted Viral | 1900 | Open in IMG/M |
| 3300026257|Ga0208407_1094326 | Not Available | 952 | Open in IMG/M |
| 3300026260|Ga0208408_1071723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1077 | Open in IMG/M |
| 3300027702|Ga0209036_1201115 | Not Available | 560 | Open in IMG/M |
| 3300027830|Ga0209359_10137074 | Not Available | 1063 | Open in IMG/M |
| 3300028197|Ga0257110_1203680 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300029318|Ga0185543_1087669 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300029319|Ga0183748_1004821 | Not Available | 6570 | Open in IMG/M |
| 3300029319|Ga0183748_1005066 | Not Available | 6352 | Open in IMG/M |
| 3300029319|Ga0183748_1008738 | All Organisms → Viruses → Predicted Viral | 4384 | Open in IMG/M |
| 3300029319|Ga0183748_1042722 | All Organisms → Viruses → Predicted Viral | 1347 | Open in IMG/M |
| 3300032073|Ga0315315_10742424 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 48.94% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 25.53% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.38% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 4.96% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.84% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.13% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.42% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 1.42% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.42% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.42% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.42% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.71% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.71% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001949 | Marine microbial communities from Panama City, Panama - GS022 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005400 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008952 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009376 | Combined Assembly of Gp0137079, Gp0137080 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017703 | Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaG | Environmental | Open in IMG/M |
| 3300017705 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020247 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962) | Environmental | Open in IMG/M |
| 3300020251 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555940-ERR599040) | Environmental | Open in IMG/M |
| 3300020280 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX556044-ERR599114) | Environmental | Open in IMG/M |
| 3300020334 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX555938-ERR599091) | Environmental | Open in IMG/M |
| 3300020359 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX555921-ERR599117) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
| 3300020392 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300020409 | Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020453 | Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026260 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 (SPAdes) | Environmental | Open in IMG/M |
| 3300027702 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2238_10345282 | 3300001949 | Marine | MDLNALNTIGYWEIVEISVYLAVMYTGKGFIDEYFNRRLK* |
| JGI25127J35165_10261524 | 3300002482 | Marine | MDIEALNYLGYGEVFEISLWLAIMYAGKCYIDDFFNRRLK* |
| JGI25132J35274_10134234 | 3300002483 | Marine | MDIGALNTLGYGEVFEISLWLAVMYAGKCYIDDFFNRRLK* |
| Ga0055584_1002090903 | 3300004097 | Pelagic Marine | MDINALNAIGYMEIIEISFYLGIMYTAKGFIDEFFNRRLK* |
| Ga0068511_10084663 | 3300005057 | Marine Water | MDLEALNMIGYWEIIEISVYIAIMYTGKGFIDEFFNRRLK* |
| Ga0068511_10330733 | 3300005057 | Marine Water | MDIETLNYLGYGEVMEISLWIAVMYVGKGFIDEFFNRRLK* |
| Ga0066867_102487122 | 3300005400 | Marine | MDLNALNAIGYWEIVEISVYLAIMYTGKSFIDEFFNRRLK* |
| Ga0066851_101359722 | 3300005427 | Marine | MDLNALNTIGYWEIVEISVYLAIMYTGKGFIDEFFNRRLK* |
| Ga0066849_102108164 | 3300005430 | Marine | GNMDLNTLNTIGYWEIVEISIYLAVMYTGKGFIDEFFNRRLK* |
| Ga0066866_101918792 | 3300005514 | Marine | MDLNTLNTIGYWEIVEISVYLAIMYTGKGFIDEFFNRRLK* |
| Ga0066865_103808971 | 3300005523 | Marine | TLNYLGYGEVIEISLWLAVMYAGKCYIDDFFNRRLK* |
| Ga0066850_101250314 | 3300005605 | Marine | MDLNALNSIGYWEIVEISIYLAVMYIGKGFIDEFFNRRQ* |
| Ga0066835_100430224 | 3300005606 | Marine | MDIETLNYLGYGEVMEISLWIAVMYIGKGFIDEFFNRRLK* |
| Ga0066371_100138651 | 3300006024 | Marine | MDIDTLNYLGYWEVFEISLYLAVMYTGKGFIDEFFNRRLK* |
| Ga0066836_101567153 | 3300006166 | Marine | MDLNTLNSIGYWEIVEISIYLAVMYTGKGFIDEFFNRRLK* |
| Ga0098038_100584512 | 3300006735 | Marine | MDIEALNYLGYGEVFEISLWITIMYVGKGFIDEFFNRRLK* |
| Ga0098038_10065382 | 3300006735 | Marine | MDIDTLNYLGYWEVFEISLYLAVMYIGKNFIDEYFNRRLK* |
| Ga0098038_11659701 | 3300006735 | Marine | WGGNMDLNTLNTIGYWEIIEISIYLGIMYTGKSFIDEFFNRRLK* |
| Ga0098038_11995382 | 3300006735 | Marine | MDLDTLNTIGYWEIIEISIYLAVMYTGKGFIDEFFNRRLK* |
| Ga0098038_12993852 | 3300006735 | Marine | MDIGTLNMLGYEEIFEISLWLAVMYTGKSFIDEFFNRRLK* |
| Ga0098037_10605662 | 3300006737 | Marine | MDIDTLNYLGYWEVFEISLYLAVMYTGKNFIDEYFNRRLK* |
| Ga0098037_12368642 | 3300006737 | Marine | IETLNYLGYGEVLEISLWIAIMYVGKGFIDEFFNRRLK* |
| Ga0098035_12458112 | 3300006738 | Marine | MDLNSLNAIGYWEIVEISVYLAIMYTGKSFIDEFFNRRLK* |
| Ga0098042_10162874 | 3300006749 | Marine | MDIGTLNMLGYGEVFEISLWLAVMYTGKSFIDEFFNRRLK* |
| Ga0098040_10454102 | 3300006751 | Marine | MDLNALNAIGYWDIIEISVYIAIMYTGKGFIDEYFNRRLK* |
| Ga0098048_10304166 | 3300006752 | Marine | DLNALNSIGYWEIVEISIYLAVMYIGKGFIDEFFNRRQ* |
| Ga0098048_10696132 | 3300006752 | Marine | MDLNTLNAIGYWEIVEISVYLAIMYTGKGFIDEFFNRRLK* |
| Ga0098048_12305342 | 3300006752 | Marine | MDLNTLNTIGYWEIVEISIYLAVMYTGKGFIDEFFNRRLK* |
| Ga0098044_13070171 | 3300006754 | Marine | MDLNALNSIGYWEIVEISIYLAVMYIGKGFIDEFFNRR |
| Ga0098054_10270361 | 3300006789 | Marine | MDLNTLNDIGYYEIVEISIYLAMMYTGKGFIDEYFNRRLK* |
| Ga0098054_11054202 | 3300006789 | Marine | MDLDTLNTIGYWEIVEISIYLAVMYTGKGFIDEFFNRRLK* |
| Ga0098054_13649372 | 3300006789 | Marine | TLNYLGYWEVFEISLYLAVMYTGKGFIDEFFNRRLK* |
| Ga0098055_11695181 | 3300006793 | Marine | NMDLNTLNAIGYWEIVEISVYLAIMYTGKGFIDEFFNRRLK* |
| Ga0098055_12227291 | 3300006793 | Marine | MDLNALNSIGYWEIVEISIYLAVMYICKGFIDEFFNRRQ* |
| Ga0098060_12220893 | 3300006921 | Marine | MDLNALNSIGYWEIVEISIYLAVMYTGKGFIDEFFNRRLK* |
| Ga0098051_11665302 | 3300006924 | Marine | MDLNALNAIGYWEIVEISIYLAVMYIGKGFIDEFFNRRQ* |
| Ga0098041_11829842 | 3300006928 | Marine | MDIDTLNYLGYWEVFEISLYLAVMYIGKNFIDEFFNRRLK* |
| Ga0098041_12386283 | 3300006928 | Marine | MDLNALNAIGYWEIVEISIYLAVMYIGKGFIDEFFNRRLK* |
| Ga0098052_10502685 | 3300008050 | Marine | MDLNALNSIGYWEIVEISVYLAIMYTGKGFIDEFFNRRLK* |
| Ga0115651_11361541 | 3300008952 | Marine | IGYYEIVEISIYLAMMYTGKAFIDEYFNRRLKCY* |
| Ga0115566_107052712 | 3300009071 | Pelagic Marine | MDIDTLNYLGYWEVFEISLYLAVMYIGKSFVDEYFNRRLK* |
| Ga0118722_14039873 | 3300009376 | Marine | MDLNALNNIGYWDIIEISVYLAIMYTGKGLIDEFFNRRLK* |
| Ga0115548_11358902 | 3300009423 | Pelagic Marine | IVMDIDTLNYLGYWEVFEISLYLAVMYIGKSFVDEYFNRRLK* |
| Ga0115555_10219842 | 3300009476 | Pelagic Marine | MDINALNAIGYMEIIEISFYLGIMYTAKGFIDEIFNRRLK* |
| Ga0115013_103531763 | 3300009550 | Marine | MDIDTLNYLGYGEVFEISLYLAVMYIGKNFIDEFFNKRLK* |
| Ga0098043_10055777 | 3300010148 | Marine | MDIETLNYLGYGEVFEISLWIALMYIGKGFIDEFFNRRLK* |
| Ga0098043_10172932 | 3300010148 | Marine | MDLNALNTIGYWEIIEISVYIGIMYTGKGFIDEFFNRRLK* |
| Ga0098043_10231014 | 3300010148 | Marine | MDIGTLNMLGYGEVFEISLWLAVMYAGKGFIDEYFNRRLK* |
| Ga0098043_10553732 | 3300010148 | Marine | MDIETLNYLGYGEVFEISLWIAIMYAGKGFIDEFFNRRLK* |
| Ga0098059_12594552 | 3300010153 | Marine | MDLNTLNTIGYWEIVEISIYLAVMYIGKGFIDEFFNRRQ* |
| Ga0098059_13357372 | 3300010153 | Marine | MDIDTLNYLGYWEVFEISLCLAVMYTGKGFIDEFFNRRLK* |
| Ga0160423_103786731 | 3300012920 | Surface Seawater | MDIEALNYLGYAEVFEISLWLAVMYTGKGFIDEFFNGRLK* |
| Ga0160423_104609802 | 3300012920 | Surface Seawater | MDIETLNYLGYGEVVEISLWIAVMYAGKGFIDEFFNRRLK* |
| Ga0160423_109728171 | 3300012920 | Surface Seawater | MDIGTLNMLGYGEVFEISLWLAVMYAGKGFIDEFFNRRLK* |
| Ga0163110_100541185 | 3300012928 | Surface Seawater | VDIETLNYLGYGEVFEISLWLAVMYAGKGFIDEYFNRRLK* |
| Ga0163110_101292152 | 3300012928 | Surface Seawater | MMDIETLNYLGYGEVFEISLWIALMYIGKGFIDEFFNRRLK* |
| Ga0163180_103645223 | 3300012952 | Seawater | MDLNALNTIGYWEIVEISVYIAIMYTGKGFIDEYFNRRLK* |
| Ga0163179_104238462 | 3300012953 | Seawater | MDLNALNTIGYFEIMEISLYLAVMYTGKSFIDEFFNRRLK* |
| Ga0163111_124933141 | 3300012954 | Surface Seawater | WGGSMDLDTLNTIGYWEIIEISIYLAVMYTGKGFIDEFFNRRLK* |
| Ga0163111_126122262 | 3300012954 | Surface Seawater | MDLDTLNTIGYWEIIEISIYLAVMYTGKGFIDEFFN |
| Ga0181367_10025367 | 3300017703 | Marine | MDLNTLNAIGYWEIVEISVYLAIMYTGKSFIDEFFNRRLK |
| Ga0181372_10282542 | 3300017705 | Marine | MDLNTLNTIGYWEIVEISIYLAVMYIGKGFIDEFFNRRQ |
| Ga0181369_11227163 | 3300017708 | Marine | VMDLNTLNSIGYWEIVEISIYLTIMYIGKGFIDEYFNRRLK |
| Ga0181404_11810262 | 3300017717 | Seawater | MDLNALNTIGYWEIIEISVYLGIMYTGKSFIDEFFNRRLK |
| Ga0181373_10776401 | 3300017721 | Marine | MDIEALNYLGYGEVFEISLWITIMYVGKGFIDEFFNRRLKXIL |
| Ga0181416_11492441 | 3300017731 | Seawater | TLNYLGYGEVIEISLWLAIMYAGKGFIDEFFNRRLK |
| Ga0181420_10006593 | 3300017757 | Seawater | MDINALNAIGYMEIIEISCYLGMMYTAKGFIDEFFNRRLK |
| Ga0181420_11034542 | 3300017757 | Seawater | MDLNALNSIGYWEIVEISVYLAIMYTGKGFIDEFFNRRLK |
| Ga0181385_10000686 | 3300017764 | Seawater | MDLNVLNTIGYFEIMEISLYLAVMYTGKSFIDEFFNRRLK |
| Ga0181385_10079762 | 3300017764 | Seawater | MDIGALNTLGYGEVFEISLWLAAMYTGKCYIDDFFNRRLK |
| Ga0181425_11540823 | 3300017771 | Seawater | MDLNALNTIGYFEIMEISFYIAVMYVGKSFIDEFFNRRLK |
| Ga0181432_10252524 | 3300017775 | Seawater | MDLNALNDIGYYEIIEISIYIAAMYVGKGFIDEFFNRRQK |
| Ga0181432_12747472 | 3300017775 | Seawater | MDLNTLNAIGYWEIIEISVYIAIMYAGKGFVDEFFNRRLK |
| Ga0181590_107593993 | 3300017967 | Salt Marsh | MDIETLNYLGYGEVMEISLWIAVMYVGKGFIDEFFNRRLK |
| Ga0181572_105559412 | 3300018049 | Salt Marsh | VDIETLNYLGYGEVFEISLWIAVMYTGKGFIDEFFNRRLK |
| Ga0211654_10230352 | 3300020247 | Marine | MDLNTLNTIGYWEIIEISIYLAVMYTGKGFIDEFFNRRLK |
| Ga0211654_10608752 | 3300020247 | Marine | NRKKRLRKERRMDLNALNTIGYWEIIEISVYIGIMYTGKGFIDEFFNRRLK |
| Ga0211700_10285273 | 3300020251 | Marine | MDLNALNTVGYWEIVEISVYLAIMYTGKGFIDEYFNRRLK |
| Ga0211591_10122443 | 3300020280 | Marine | MDIETLNYLGYGEVFEISLWITIMYVGKGFIDEFFNRRLK |
| Ga0211593_10100394 | 3300020334 | Marine | MDIETLNYLGYGEVLEISLWITIMYVGKGFIDEFFNRRLK |
| Ga0211610_11758232 | 3300020359 | Marine | MDLETLNYIGYWEIIEISVYLAIMYTGKQFIDEYFNKRLK |
| Ga0211647_101094312 | 3300020377 | Marine | MDLDTLNTIGYWEIIEISIYLAVMYTGKGFIDEFFNRRLK |
| Ga0211680_101094002 | 3300020389 | Marine | VDLNALNAIGYYEIIEISIYLAVMYAGKGFVDEFFNRRQK |
| Ga0211666_101044284 | 3300020392 | Marine | MDLNALNTIGYWEIVEISVYLAIMYTGKGFIDEYFNRRLK |
| Ga0211636_1001933612 | 3300020400 | Marine | MDIEALNYLGYTEVFEISLWLAIMYTGKCYIDDFFNRRLK |
| Ga0211472_104514952 | 3300020409 | Marine | MDIETLNYLGYGEVFEISLWLAVMYAGKGFIDEFFNRRLK |
| Ga0211516_103970262 | 3300020413 | Marine | MDLNALNTIGYFEIMEISLYLAVMYTGKSFIDEFFNRRLK |
| Ga0211644_103517862 | 3300020416 | Marine | MDIGTLNMLGYGEVFEISLWLAIMYAGKCYIDDFFNRRLK |
| Ga0211653_100044216 | 3300020421 | Marine | MDLNALNTIGYWEIIEISLYIAVMYTGKSFIDEFFNRRLK |
| Ga0211653_101669794 | 3300020421 | Marine | MDIDTLNYLGYWEVFEISLYLAVMYIGKNFIDEFFNRRLK |
| Ga0211653_101910973 | 3300020421 | Marine | GVIVMDIDTLNYLGYWEVFEISLYLAVMYTGKNFIDEYFNRRLK |
| Ga0211708_104076081 | 3300020436 | Marine | MDIETLNYLGYGEVFEISLWIAVMYIGKGFIDEFFHRRLK |
| Ga0211708_104673192 | 3300020436 | Marine | MDLNALNTIGYWEMVEISIYLAVMYTGKGFIDEYFNRRLK |
| Ga0211539_100304667 | 3300020437 | Marine | MDIETLNYLGYGEVFELSLWITIMYVGKGFIDEFFNRRLK |
| Ga0211576_1000897011 | 3300020438 | Marine | MDINALNAIGYMEIIEISFYLGMMYTAKGFIDEFFNRRLK |
| Ga0211576_102025622 | 3300020438 | Marine | MDIDTLNYLGYWEVFEISLYLAVMYIGKSFVDEFFNRRLK |
| Ga0211558_102968671 | 3300020439 | Marine | MDIETLNYLGYGEVFEISLWLAVMYTGKGFIDEFFNRRLK |
| Ga0211559_1001017714 | 3300020442 | Marine | VDIETLNYLGYGEVFEISLWIAVMYAGKGFIDEFFNRRLK |
| Ga0211559_100124817 | 3300020442 | Marine | MDIETLNYLGYGEVVEISLWIAVMYAGKGFIDEFFNRRLK |
| Ga0211559_100732844 | 3300020442 | Marine | MDIEALNYLGYGEVFEISLWIALMYIGKGFIDEFFNRRLK |
| Ga0211550_102983562 | 3300020453 | Marine | MDLNALNSIGYWEIVEISIYLAVMYTGKGFIDEFFNRRLK |
| Ga0211643_100341053 | 3300020457 | Marine | MDIGTLNYLGYGEVFEISLWLAIMYAGKCYIDDFFNRRLK |
| Ga0211543_104820421 | 3300020470 | Marine | MDIEALNYLGYGEVLEISLWLAIMYAGKGFIDEFFNRRLK |
| Ga0211614_102530162 | 3300020471 | Marine | MDIDTLNYLGYWEVFEISLYIAVMYIGKNFIDEFFNRRLK |
| Ga0211614_104583261 | 3300020471 | Marine | MDLNALNTIGYWEIVEISVYLAVMYTGKGFIDEYFNKRLK |
| Ga0206684_12915852 | 3300021068 | Seawater | MDLNALNTIGYYEIIEISIYLAVMYAGKGFVDEFFNRRQK |
| Ga0206678_104123293 | 3300021084 | Seawater | MDLNALNTIGYYEIIEISIYLAVMYAGKGFVDEFFNRRQKXY |
| Ga0206682_100386962 | 3300021185 | Seawater | MDLNALNSIGYWEIVEISIYLAVMYIGKGFIDEFFNRRQ |
| Ga0206123_100998196 | 3300021365 | Seawater | MDIDTLNYLGYWEVFEISLYLAVMYIGKSFVDEYFNRRLK |
| Ga0206123_104200602 | 3300021365 | Seawater | MDINALNAIGYMEIIEISFYLGIMYTAKGFIDEFFNRRLK |
| Ga0213860_101217033 | 3300021368 | Seawater | MDIETLNYLGYGEVFEISLWIALMYIGKGFIDEFFNRRL |
| Ga0208920_10268692 | 3300025072 | Marine | MDLNALNAIGYWEIVEISVYLAIMYTGKSFIDEFFNRRLK |
| Ga0208157_11297422 | 3300025086 | Marine | MDIDTLNYLGYWEVFEISLYLAVMYTGKNFIDEYFNRRLK |
| Ga0208669_10117033 | 3300025099 | Marine | MDIDTLNYLGYWEVFEISLYLAVMYTGKGFIDEFFNRRLK |
| Ga0208669_10551342 | 3300025099 | Marine | MDLNTLNAIGYWEIVEISVYLAIMYTGKGFIDEFFNRRLK |
| Ga0208159_10067688 | 3300025101 | Marine | MDIGTLNMLGYGEVFEISLWLAVMYTGKSFIDEFFNRRLK |
| Ga0208159_10817623 | 3300025101 | Marine | MDIETLNYLGYGEVFEISLWIAIMYAGKGFIDEFFNRRLK |
| Ga0208159_10929261 | 3300025101 | Marine | LNYLGYGEVFEISLWIALMYIGKGFIDEFFNRRLK |
| Ga0208666_10164795 | 3300025102 | Marine | MDIEALNYLGYGEVFEISLWITIMYVGKGFIDEFFNRRLK |
| Ga0208158_11046611 | 3300025110 | Marine | MDLNALNAIGYWEIVEISIYLAVMYIGKGFIDEFFNRRLK |
| Ga0208158_11496601 | 3300025110 | Marine | MDLNTLNTIGYWEIVEISVYLAIMYIGKGFIDEFFNRRLK |
| Ga0209348_100025326 | 3300025127 | Marine | MDIEALNYLGYGEVFEISLWLAIMYAGKCYIDDFFNRRLK |
| Ga0209348_100325915 | 3300025127 | Marine | MDIETLNYLGYGEVMEISLWIAVMYIGKGFIDEFFNRRLK |
| Ga0209348_10391683 | 3300025127 | Marine | MDIETLNYLGYGEVFEISLWIALMYIGKGFIDEFFNRRLK |
| Ga0209232_10012525 | 3300025132 | Marine | MDIGTLNMLGYGEVFEISLWLAVMYAGKGFIDEYFNRRLK |
| Ga0209232_10371412 | 3300025132 | Marine | VDIETLNYLGYGEVFEISLWLAVMYAGKGFIDEYFNRRLK |
| Ga0209232_10483072 | 3300025132 | Marine | MDLNTLNSIGYWEIVEISIYLTIMYIGKGFIDEYFNRRLK |
| Ga0208299_12327362 | 3300025133 | Marine | MDLNTLNTIGYWEIVEISIYLAVMYIGKGFIDEFFNRRLK |
| Ga0209645_100074619 | 3300025151 | Marine | MDIGALNTLGYGEVFEISLWLAVMYAGKCYIDDFFNRRLK |
| Ga0208407_10297674 | 3300026257 | Marine | MDLNTLNAIGYWEIVEISIYLAVMYIGKGFIDEFFNRRLK |
| Ga0208407_10943261 | 3300026257 | Marine | MDLNTLNSIGYWEIVEISIYLAVMYTGKGFIDEFFNRRLK |
| Ga0208408_10717232 | 3300026260 | Marine | MDLNALNTIGYWEIVEISVYLAIMYTGKGFIDEFFNRRQ |
| Ga0209036_12011152 | 3300027702 | Marine | MDIGTLNMLGYGEVIEISLWLAAMYAGKGFIDEFFNRRLK |
| Ga0209359_101370741 | 3300027830 | Marine | GTLNMLGYGEVIEISLWLAAMYAGKGFIDEFFNRRLK |
| Ga0257110_12036803 | 3300028197 | Marine | MDLNALNAIGYFEIMEISFYIAVMYVGKSFIDEFFNRRLK |
| Ga0185543_10876691 | 3300029318 | Marine | EKIMDIETLNYLGYGEVLEISLWITIMYVGKGFIDEFFNRRLK |
| Ga0183748_100482112 | 3300029319 | Marine | MDIEALNYLGYGEVLEISLWITVMYVGKGFIDEFFNRRLK |
| Ga0183748_10050662 | 3300029319 | Marine | MDIETLNYLGYGEVFEISLWLAIMYAGKGFIDEFFNRRLK |
| Ga0183748_10087382 | 3300029319 | Marine | VDIEALNYLGYGEVFEISLWLAIMYAGKCYIDDFFNRRLK |
| Ga0183748_10427222 | 3300029319 | Marine | MDLNALNTIGYWEIVEISIYLAVMYTGKGFIDEYFNRRLK |
| Ga0315315_107424243 | 3300032073 | Seawater | KRLRKERRMDINALNAIGYMEIIEISFYLGMMYTAKGFIDEFFNRRLK |
| ⦗Top⦘ |