


| Basic Information | |
|---|---|
| Family ID | F053520 |
| Family Type | Metagenome |
| Number of Sequences | 141 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VGNWVNWLLVIGGIVCVIIELALGALTGFDLALLGASLAVGGGIGL |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.16 % |
| % of genes near scaffold ends (potentially truncated) | 98.58 % |
| % of genes from short scaffolds (< 2000 bps) | 87.94 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.745 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.113 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.496 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.809 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.46% β-sheet: 0.00% Coil/Unstructured: 40.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF14602 | Hexapep_2 | 42.55 |
| PF00132 | Hexapep | 25.53 |
| PF03331 | LpxC | 4.96 |
| PF12804 | NTP_transf_3 | 2.13 |
| PF13828 | DUF4190 | 1.42 |
| PF14534 | DUF4440 | 1.42 |
| PF04752 | ChaC | 0.71 |
| PF11706 | zf-CGNR | 0.71 |
| PF13180 | PDZ_2 | 0.71 |
| PF01152 | Bac_globin | 0.71 |
| PF00483 | NTP_transferase | 0.71 |
| PF04748 | Polysacc_deac_2 | 0.71 |
| PF06764 | DUF1223 | 0.71 |
| PF12681 | Glyoxalase_2 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 4.96 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.71 |
| COG2861 | Uncharacterized conserved protein YibQ, putative polysaccharide deacetylase 2 family | Carbohydrate transport and metabolism [G] | 0.71 |
| COG3703 | Gamma-glutamylcyclotransferase ChaC2 (glutathione degradation) | Inorganic ion transport and metabolism [P] | 0.71 |
| COG5429 | Uncharacterized conserved protein, DUF1223 domain | Function unknown [S] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.74 % |
| Unclassified | root | N/A | 4.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101234339 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300001356|JGI12269J14319_10212635 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300001356|JGI12269J14319_10277348 | Not Available | 613 | Open in IMG/M |
| 3300002908|JGI25382J43887_10197525 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300002910|JGI25615J43890_1102269 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005186|Ga0066676_10706552 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005332|Ga0066388_104080218 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005336|Ga0070680_100127204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2129 | Open in IMG/M |
| 3300005437|Ga0070710_10551044 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300005557|Ga0066704_10166235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1484 | Open in IMG/M |
| 3300005568|Ga0066703_10352517 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300005569|Ga0066705_10375499 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300005602|Ga0070762_10284145 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300005764|Ga0066903_107784645 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005983|Ga0081540_1305250 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006028|Ga0070717_11254684 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300006059|Ga0075017_100350347 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300006172|Ga0075018_10671624 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300006173|Ga0070716_100277456 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300006854|Ga0075425_102939446 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300006914|Ga0075436_100536324 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300009012|Ga0066710_102356973 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 773 | Open in IMG/M |
| 3300009012|Ga0066710_104413162 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009038|Ga0099829_11048529 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300009088|Ga0099830_10794006 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300009143|Ga0099792_10559420 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300010043|Ga0126380_10582232 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300010043|Ga0126380_11229788 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300010048|Ga0126373_10011552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7171 | Open in IMG/M |
| 3300010360|Ga0126372_11414653 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300010360|Ga0126372_12207238 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300010361|Ga0126378_13456447 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300010398|Ga0126383_11232928 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300010868|Ga0124844_1129917 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300011269|Ga0137392_10984324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300011270|Ga0137391_10411470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1155 | Open in IMG/M |
| 3300011270|Ga0137391_10429378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300011270|Ga0137391_11364564 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012189|Ga0137388_10139857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2130 | Open in IMG/M |
| 3300012198|Ga0137364_11466776 | Not Available | 503 | Open in IMG/M |
| 3300012203|Ga0137399_10805667 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300012205|Ga0137362_10092444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2537 | Open in IMG/M |
| 3300012205|Ga0137362_11000959 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300012206|Ga0137380_11488115 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012285|Ga0137370_10781716 | Not Available | 592 | Open in IMG/M |
| 3300012356|Ga0137371_10790600 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300012361|Ga0137360_10197080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1628 | Open in IMG/M |
| 3300012362|Ga0137361_10599734 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300012363|Ga0137390_10501804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
| 3300012582|Ga0137358_10145951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1610 | Open in IMG/M |
| 3300012582|Ga0137358_10837503 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012683|Ga0137398_10001127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10604 | Open in IMG/M |
| 3300012683|Ga0137398_10066291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2189 | Open in IMG/M |
| 3300012923|Ga0137359_10690367 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300012925|Ga0137419_11775232 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012929|Ga0137404_11508794 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012930|Ga0137407_11038770 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300012944|Ga0137410_10528728 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300012971|Ga0126369_12405958 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012972|Ga0134077_10140637 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300014325|Ga0163163_12528847 | Not Available | 571 | Open in IMG/M |
| 3300015264|Ga0137403_10627783 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300016294|Ga0182041_11584264 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300017924|Ga0187820_1077877 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300017933|Ga0187801_10461033 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300017933|Ga0187801_10471118 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300017936|Ga0187821_10497453 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300017955|Ga0187817_10350970 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300017995|Ga0187816_10026512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2319 | Open in IMG/M |
| 3300018015|Ga0187866_1045755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2010 | Open in IMG/M |
| 3300018047|Ga0187859_10062139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1969 | Open in IMG/M |
| 3300018088|Ga0187771_10474827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300018433|Ga0066667_10494032 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300018482|Ga0066669_10098269 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2025 | Open in IMG/M |
| 3300019890|Ga0193728_1077448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1570 | Open in IMG/M |
| 3300020062|Ga0193724_1050255 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300020170|Ga0179594_10225723 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300020199|Ga0179592_10037009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2208 | Open in IMG/M |
| 3300020579|Ga0210407_10923822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300020581|Ga0210399_11538396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300020582|Ga0210395_11384536 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300020583|Ga0210401_10238239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1678 | Open in IMG/M |
| 3300021168|Ga0210406_11388900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300021170|Ga0210400_10729736 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300021178|Ga0210408_11231792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300021181|Ga0210388_10682096 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300021401|Ga0210393_11270917 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300021402|Ga0210385_10146588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1686 | Open in IMG/M |
| 3300021420|Ga0210394_10938893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300021474|Ga0210390_10896421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300021475|Ga0210392_11270573 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300021478|Ga0210402_11114843 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300021560|Ga0126371_13139543 | Not Available | 559 | Open in IMG/M |
| 3300024232|Ga0247664_1000640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8371 | Open in IMG/M |
| 3300024232|Ga0247664_1143697 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300024330|Ga0137417_1473741 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300024331|Ga0247668_1103601 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300025910|Ga0207684_11718940 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300025915|Ga0207693_11445707 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300025917|Ga0207660_10102360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2141 | Open in IMG/M |
| 3300025927|Ga0207687_10151633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1769 | Open in IMG/M |
| 3300025928|Ga0207700_10213311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1633 | Open in IMG/M |
| 3300025929|Ga0207664_11199263 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300026121|Ga0207683_10390188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 1280 | Open in IMG/M |
| 3300026296|Ga0209235_1277673 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300026529|Ga0209806_1156424 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300026538|Ga0209056_10630088 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300026551|Ga0209648_10011015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7853 | Open in IMG/M |
| 3300026551|Ga0209648_10187325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1594 | Open in IMG/M |
| 3300026551|Ga0209648_10426272 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300026557|Ga0179587_10055970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2283 | Open in IMG/M |
| 3300027061|Ga0209729_1007219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1203 | Open in IMG/M |
| 3300027310|Ga0207983_1060448 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300027370|Ga0209010_1008190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1989 | Open in IMG/M |
| 3300027629|Ga0209422_1101544 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300027648|Ga0209420_1002016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9306 | Open in IMG/M |
| 3300027692|Ga0209530_1003241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5819 | Open in IMG/M |
| 3300027853|Ga0209274_10289473 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300027855|Ga0209693_10385306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300027884|Ga0209275_10776773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300027895|Ga0209624_10137650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1610 | Open in IMG/M |
| 3300028145|Ga0247663_1025251 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300028146|Ga0247682_1030306 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 961 | Open in IMG/M |
| 3300028536|Ga0137415_10231220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 1661 | Open in IMG/M |
| 3300028536|Ga0137415_10625412 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300028906|Ga0308309_10682757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300031057|Ga0170834_106339299 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300031057|Ga0170834_113185022 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300031122|Ga0170822_10227235 | Not Available | 519 | Open in IMG/M |
| 3300031718|Ga0307474_11123742 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300031720|Ga0307469_10138730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1796 | Open in IMG/M |
| 3300031740|Ga0307468_100973313 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300031754|Ga0307475_10438571 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300031823|Ga0307478_10781816 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300031823|Ga0307478_10849597 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300031962|Ga0307479_11216459 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300031962|Ga0307479_11485409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300032076|Ga0306924_10583731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1266 | Open in IMG/M |
| 3300032205|Ga0307472_101856809 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300032955|Ga0335076_10048887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4203 | Open in IMG/M |
| 3300033486|Ga0316624_11051936 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.13% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.71% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1012343392 | 3300000364 | Soil | MGNWVNWLLVIAGVLCVAAELALGALTGFDLALVGASLAAGGVVGLIAQSWQTGLVSAAI |
| JGI12269J14319_102126351 | 3300001356 | Peatlands Soil | VSNWVNWLLVIIGIIFVIVELALGALTGFDLALVGAALAVGGGI |
| JGI12269J14319_102773481 | 3300001356 | Peatlands Soil | VGNWVNWLLVIVGIICVIIELSLGALTGFDMALVGGSLAVGGAVGLVAGSAKIGL |
| JGI25382J43887_101975251 | 3300002908 | Grasslands Soil | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASLAAGGAIGLLTQSWHVG |
| JGI25615J43890_11022691 | 3300002910 | Grasslands Soil | VSNGVNWLLVIVGILFVIVELALGALTGFDLALVGAALTVGGGFGLLAGSANI |
| Ga0066676_107065521 | 3300005186 | Soil | MGNWLNWLLVIGGIVCVIAELALGAVTGFDLALIGGSPAS* |
| Ga0066388_1040802181 | 3300005332 | Tropical Forest Soil | MGNWVNWLLVIAGVLCLAAELALGAVTGFDLALVGASLAAGGVFGLIAQSWQTG |
| Ga0070680_1001272041 | 3300005336 | Corn Rhizosphere | VGNWVNWLLIIGGIICVIIELALGAFTGFDLALVGGSLAVGG |
| Ga0070710_105510442 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MWVNWLLVIGGIVCVIAELALGAMTGFDLALVGGSLAIGGVVGF |
| Ga0066704_101662351 | 3300005557 | Soil | VGNSVNWILVILGVICVIAELALGAITGFDLALVGASLVAGGVVGLVFG |
| Ga0066703_103525171 | 3300005568 | Soil | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASLAAGGAIGLLTQSWYA |
| Ga0066705_103754991 | 3300005569 | Soil | LGNWVNWLLVIVGVLFAAAELALGAITGFDLALVGASLAAGGVIGLVTQSWHAGLIS |
| Ga0070762_102841451 | 3300005602 | Soil | VGLWVNWALIIVGIVCVIAELAMGAMTGFDLALVGGSLAIGGGAGLLA |
| Ga0066903_1077846451 | 3300005764 | Tropical Forest Soil | VGNWVNWLLVIAGIICVIVELALGALTGFDLALVGGALAAGGALG |
| Ga0081540_13052502 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VGNWVNWLLVITGVLCAAAELALGALTGFDLALVGASLAAGGALGLFTQSWHVGLISSA |
| Ga0070717_112546842 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASLAAGGAIGLLTQSWHAGLIS |
| Ga0075017_1003503471 | 3300006059 | Watersheds | VGNWVNWLLVIGGIVCVIIELALGALTGFDLALLGASLAVGGGIGL |
| Ga0075018_106716241 | 3300006172 | Watersheds | VGNWVNWLLVIVGVLCAAAEIALGAITGFDLALVGA |
| Ga0070716_1002774562 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LSNLTNWLLLIIGVVCVIAELALGAITGFDLALVGGSLAVGGVI |
| Ga0075425_1029394461 | 3300006854 | Populus Rhizosphere | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASFAAGGAIGLLTQSWQAGLISA |
| Ga0075436_1005363241 | 3300006914 | Populus Rhizosphere | VGNWVNWLLVIAGVLSVAAELTLGALTGFDLALIGASLAGGGVIGLFTQSWH |
| Ga0066710_1023569732 | 3300009012 | Grasslands Soil | VGSSVNWSLAILGVICVIAELALGVMTGFDLALVGASLVAGG |
| Ga0066710_1044131621 | 3300009012 | Grasslands Soil | VGNWVNWSLVIAGIICVIIELAMGAMTGFDLALVGAALAVGGGIGLLTG |
| Ga0099829_110485292 | 3300009038 | Vadose Zone Soil | VGNWVNWSLVIAGIICVIIELAMGAMTGFDLALVGAAL |
| Ga0099830_107940062 | 3300009088 | Vadose Zone Soil | VGNWVNWLLVIGGIVCVIIELALGALTGFDLALLGASLAVGGGIGLLTGSA |
| Ga0099792_105594201 | 3300009143 | Vadose Zone Soil | VGHWVNWLLVIVGVICVIVELALGALTGFDLALVGAALAVGGGIGLLAGSANV |
| Ga0126380_105822322 | 3300010043 | Tropical Forest Soil | MLVIVGVICVIAELALGVATGFDLVLVGASLVAGGIVGLVFGSAN |
| Ga0126380_112297881 | 3300010043 | Tropical Forest Soil | VGNWVNWLLVIAGVLCAAIELALGAATGFDLALVGASLAGGGAIGL |
| Ga0126373_100115521 | 3300010048 | Tropical Forest Soil | VGNWVNWLLVIAGVLCAAAELAMGAVTGFDLALVGASLAAG |
| Ga0126372_114146531 | 3300010360 | Tropical Forest Soil | VGNSANWLLVILGIICVIAELALGVMTGFDLALVG |
| Ga0126372_122072382 | 3300010360 | Tropical Forest Soil | MGNWVNWLLVIAGVLCVAAELALGALTGFDLALVGASLAAG |
| Ga0126378_134564471 | 3300010361 | Tropical Forest Soil | LGNWVNWVLIIIGIVCVIIELALGALTGFDLALVGGSLTVGGAIGLF |
| Ga0126383_112329282 | 3300010398 | Tropical Forest Soil | MGNWVNWLLVIAGVLCVAGELALGALTGFDLALVGASLAAGG |
| Ga0124844_11299172 | 3300010868 | Tropical Forest Soil | MLVILGIISIIAELALGVMTGFDLALVGASLIAGGIV |
| Ga0137392_109843242 | 3300011269 | Vadose Zone Soil | VGNWVNWLLVIGGIACVTAELALGAATGFDLALIGGSLAIGG |
| Ga0137391_104114701 | 3300011270 | Vadose Zone Soil | VSNWVNWLLVIGGIVCVIIELALGALTGFDLALLGASLA |
| Ga0137391_104293782 | 3300011270 | Vadose Zone Soil | MGPWVNWFLVIAGIVCVIVELALGAMTGFDLALVGGS |
| Ga0137391_113645642 | 3300011270 | Vadose Zone Soil | VGNWVNWLLVIGGIVCVTVELALGAATGFDLALIGGS |
| Ga0137388_101398571 | 3300012189 | Vadose Zone Soil | VGNWVKWLLVIGGIVCVTVELALGAATGFDLALIGGSLAIGGA |
| Ga0137364_114667762 | 3300012198 | Vadose Zone Soil | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASLAAGGAIGLLTQSWHAGLISAAA |
| Ga0137399_108056671 | 3300012203 | Vadose Zone Soil | MGNWVNWLLVIGGIICAIIELAMGALMGFDLALVGASLTVGGAIGLFTGSAKIG |
| Ga0137362_100924441 | 3300012205 | Vadose Zone Soil | VGNWVNWSLVIAGIICVIIELAMGAMTGFDLALVGAALAV |
| Ga0137362_110009592 | 3300012205 | Vadose Zone Soil | VGNWVNWSLVIAGIICVIIELAMGAMTGFDLALVGAALAVG |
| Ga0137380_114881151 | 3300012206 | Vadose Zone Soil | VGNWVNWLLVIAGIVCVIIELALGALTGFDLALVGASLVAGGGIGLL |
| Ga0137370_107817161 | 3300012285 | Vadose Zone Soil | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASLAAGGVIGLLTLSWHAGLISAAL |
| Ga0137371_107906001 | 3300012356 | Vadose Zone Soil | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASLAAGGAIGLLTQSWHVGLISAAA |
| Ga0137360_101970801 | 3300012361 | Vadose Zone Soil | VGNWVNWSLVIAGIICVIIELAMGAMTGFDLALVGAA |
| Ga0137361_105997341 | 3300012362 | Vadose Zone Soil | VGNWVNWLLVIVGVLCVAAELALGALTGFDLALVGASLAAGGIIGLLAQSWHVG |
| Ga0137390_105018041 | 3300012363 | Vadose Zone Soil | VGHWVNWLLVIVGVNCVIVELALGALTGFDLALVG |
| Ga0137358_101459512 | 3300012582 | Vadose Zone Soil | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASLAA |
| Ga0137358_108375032 | 3300012582 | Vadose Zone Soil | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASLAAGGIIGLLAQSWQAGLISA |
| Ga0137398_100011271 | 3300012683 | Vadose Zone Soil | VGNSVNWILVILGVICVIAELALGVMTGFDLALVGASLVAGGIVGLV |
| Ga0137398_100662913 | 3300012683 | Vadose Zone Soil | VGNWVNWSLVIAGIICVIIELAMGAMTGFDLALVGA |
| Ga0137359_106903671 | 3300012923 | Vadose Zone Soil | VNWLLVIAGIICVIIELALGALTGFDLALLGASLAV |
| Ga0137419_117752322 | 3300012925 | Vadose Zone Soil | VKEWLSLGNVTNWLLLIIGVLCVIAELALGVITGFDLALVGGSLALGGIIGLVANS |
| Ga0137404_115087942 | 3300012929 | Vadose Zone Soil | VGNWVNWLLVIVGVLCVAAELALGALTGFDLALVGAS |
| Ga0137407_110387702 | 3300012930 | Vadose Zone Soil | VGNWVNWSLVIAGIICVIIELAMGAMTGFDLALVGAALAVGGGI |
| Ga0137410_105287282 | 3300012944 | Vadose Zone Soil | VDNWLNWVLVIGGIVCVIIELALGALTGFDLALVGASLAAGGAVGILFGSAN |
| Ga0126369_124059582 | 3300012971 | Tropical Forest Soil | VGNWVNWLLVIAGVLCAAAELALGAITGFDLALVGASLAAGGAVGLFTQSWRAGL |
| Ga0134077_101406372 | 3300012972 | Grasslands Soil | VGNWVNWSLVIAGIICVIIELAMGAMTGFDLALVGAALAVGGGIGLLTGSANV |
| Ga0163163_125288471 | 3300014325 | Switchgrass Rhizosphere | VGNWVNWLLVILGVLCVAAELALGVLTGFDLALVGAS |
| Ga0137403_106277831 | 3300015264 | Vadose Zone Soil | VGNWVNWSLVIAGIICVIIELAMGAMTGFDLALVGAALAVGGGIGLLTGSA |
| Ga0182041_115842641 | 3300016294 | Soil | VGNWVNWLLVIVGVLCAAAELVMGALTGLDLALVGASLAAGGIVGVARLD |
| Ga0187820_10778772 | 3300017924 | Freshwater Sediment | VGNWVNWLLVIGGIIFVIVELALGAMTGLDLALMG |
| Ga0187801_104610331 | 3300017933 | Freshwater Sediment | VSTWVSWILIIGGVVCVIAELALGAFTGFDLALIGGSLTLGGA |
| Ga0187801_104711182 | 3300017933 | Freshwater Sediment | MLVAMWVNWLLVIGGIVCVIIELALGAMTGFDLALIGGSLAVGGGIGLLLGSEKIG |
| Ga0187821_104974531 | 3300017936 | Freshwater Sediment | VGNWVNWLLVIVGALCAVAELALGAITGFDLALVGASLAAGGIVGL |
| Ga0187817_103509701 | 3300017955 | Freshwater Sediment | VGNWVNWLLVIGGIIFVIVELALGALTGFDLALVGASLAAGGAIGLFT |
| Ga0187816_100265123 | 3300017995 | Freshwater Sediment | LSNWVNWLLVIGGIIFVIFELALGALTGFDLALVGASLAAGG |
| Ga0187866_10457551 | 3300018015 | Peatland | VGTWVSWILIIGGVVCVIAELALGAITGFDLALIGGSLSLGGAIGLIAH |
| Ga0187859_100621391 | 3300018047 | Peatland | MWVNWLLVIGGIVCVIVELALGAMTGLDLALIGGSL |
| Ga0187771_104748271 | 3300018088 | Tropical Peatland | VSTWVSWILVIGGVVCVIVELALGAFTGFDLALIGASLTLGGAIGLIAHS |
| Ga0066667_104940321 | 3300018433 | Grasslands Soil | MGNWLNWLLVIGGIVCVIVELALGAVTGFDVALIGGSPAW |
| Ga0066669_100982693 | 3300018482 | Grasslands Soil | VGSSVNWILVILGVICVIAELALGVMTGFDLALVGASLVAG |
| Ga0193728_10774482 | 3300019890 | Soil | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASLAAGG |
| Ga0193724_10502552 | 3300020062 | Soil | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASLAAGGIIGLLAQSWQAG |
| Ga0179594_102257231 | 3300020170 | Vadose Zone Soil | VGMWVNWLLVIGGIVCVIVELALGAMTGFDLALIGGSLAIGGGIGF |
| Ga0179592_100370091 | 3300020199 | Vadose Zone Soil | VSNWVNWLLVIVGILFVIVELALGALTGFDLALVGAAL |
| Ga0210407_109238222 | 3300020579 | Soil | VGMWVNWLLIIGGIVCVIVELALGAMTGFDLALIGGSLAIGGGIGLLA |
| Ga0210399_115383962 | 3300020581 | Soil | VGMWVNWLLVIGGVVCVIVELALGAMTGFDLALVGGSLAIGGGIGLFVA |
| Ga0210395_113845361 | 3300020582 | Soil | VGMWVNWLLVIGGIVCVIVELALGAMTGLDLALIGGSCAIGGGIGLL |
| Ga0210401_102382391 | 3300020583 | Soil | VGNWVNWLLVIGGIVCVIIELALGALTGFDLALLGASLAVGGGVGLLAGSAKI |
| Ga0210406_113889001 | 3300021168 | Soil | VGLWVNWLLVIGGMACVIVELALGAMTGFDLALIGGSLAIGGGIGLLVVSEKVGL |
| Ga0210400_107297361 | 3300021170 | Soil | VGNWVNWLLVIGGLVCVIIELALGALTGLDLALVGGSLTVGGVIGLLAGS |
| Ga0210408_112317921 | 3300021178 | Soil | LGNWVNWLLVIGGIVCVIIELALGALSGFDLALLG |
| Ga0210388_106820961 | 3300021181 | Soil | VGNWVNWLLVIGGLICVIIELALGALTGLDLALVGGS |
| Ga0210393_112709171 | 3300021401 | Soil | VGNWVNWLLVIGGLICVIIELALGALTGLDLALVGASLTIGG |
| Ga0210385_101465881 | 3300021402 | Soil | VGLWVNWALVIVGIVCVIAELAMGAMTGFDLALIGGS |
| Ga0210394_109388931 | 3300021420 | Soil | VGMWVNWLLIIGGIVCVIVELALGAMTGLDLALIGGSLAI |
| Ga0210390_108964211 | 3300021474 | Soil | VGMWVNWLLIIGGIVCVIVELALGAMTGLDLALIGGSLAVGGGIGFLAGSEK |
| Ga0210392_112705732 | 3300021475 | Soil | VGNWVNWLLVIVGIVCVIIEVALGALTGFDLALVGGSLAIGGAIGLLSGSAKI |
| Ga0210402_111148431 | 3300021478 | Soil | VGTWVNWFLLIVGILCVIAEVALGATTGFDLALVGASL |
| Ga0126371_131395432 | 3300021560 | Tropical Forest Soil | LGNWVNWLVIIAGIVCVIIELALGTLTGFDLALVGASLTVGGAVGLL |
| Ga0247664_100064010 | 3300024232 | Soil | VGNWVNWLLVIFGVLCVAAELALGALTGFDLALVGASLAAGGVVGLITRS |
| Ga0247664_11436972 | 3300024232 | Soil | VGNWVNWLLVIVGVLCAAAEIALGAITGFDLALVGASLAAGGMVGLVAQS |
| Ga0137417_14737411 | 3300024330 | Vadose Zone Soil | VGNWVNWSLVIAGIICVIIELAMGAMTGFDLALVGAALAVGGGIGL |
| Ga0247668_11036012 | 3300024331 | Soil | VGNWVNWLLIIGGIICVIIELALGAFTGFDLALVGGSLAVGGAIGFLAG |
| Ga0207684_117189402 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASLAAG |
| Ga0207693_114457072 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASFAAGGAIG |
| Ga0207660_101023601 | 3300025917 | Corn Rhizosphere | VGNWVNWLLIIGGIICVIIELALGAFTGFDLALVGGSLAVGGAIGF |
| Ga0207687_101516332 | 3300025927 | Miscanthus Rhizosphere | VGSWVNWFLVIVGILCAIAELALGAITGFDLALVGA |
| Ga0207700_102133111 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASLAAGGVIGLLTFSWHV |
| Ga0207664_111992631 | 3300025929 | Agricultural Soil | VGNWVNWLLVILGVLCAAAELALGALTGFDLALVGASLAAGGIIGLLAQSWHVGLISAAF |
| Ga0207683_103901883 | 3300026121 | Miscanthus Rhizosphere | MGNWVNWLLVIAGVLCVAAELALGALTGFDLALVGASLAAGGVVGLIA |
| Ga0209235_12776732 | 3300026296 | Grasslands Soil | VGNWVNWLLVIVGIVCVIIELALGAFTGFDLALVGGSLTVGGAIGLF |
| Ga0209806_11564241 | 3300026529 | Soil | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASLAAGGAIGLLTQSWYAG |
| Ga0209056_106300881 | 3300026538 | Soil | VGNWVNWLLVIGGIVCVIMELALGALTGFDLALLGASLAVGGGIGLLT |
| Ga0209648_100110151 | 3300026551 | Grasslands Soil | LGNWVNWLLVIAGIICVIIELALGALTGLDLALVGASLAVGG |
| Ga0209648_101873251 | 3300026551 | Grasslands Soil | VGNWVNWLLVIGGIVCVIVELALGAMTGFDLALIGGSLAIGGGIGLLLGSEKIG |
| Ga0209648_104262721 | 3300026551 | Grasslands Soil | VGNWVNWLLVIAGIICVIIELALGALTGLDLALVGASLAVGG |
| Ga0179587_100559703 | 3300026557 | Vadose Zone Soil | VGNWVNWSLVIAGIICVIIELAMGAMSGFDLALVGAALAVGGGIG |
| Ga0209729_10072191 | 3300027061 | Forest Soil | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGASLAAGGIIGLLAQSWQ |
| Ga0207983_10604482 | 3300027310 | Soil | MGNSVSWLLVILGVICVIAELALGVITGFDLALVGASLVAGGIVGLAFGSANIG |
| Ga0209010_10081901 | 3300027370 | Forest Soil | VGLWVNWVLVIVGIVCVIAELAMGAMTGLDLALVGG |
| Ga0209422_11015442 | 3300027629 | Forest Soil | VGNWVNWLLVIGGLICVIIELALGALTGLDLALVGGSLTIGGTIGL |
| Ga0209420_10020161 | 3300027648 | Forest Soil | VGMWVNWLLVIGGIVCVIVELALGAMTGLDLALIGGSCAIGG |
| Ga0209530_10032415 | 3300027692 | Forest Soil | VGLWVNWVLVIVGIVCVIAELAMGAMTGLDLALVGGSLAIGGGIG |
| Ga0209274_102894732 | 3300027853 | Soil | VGNWVNWLLVIGGLICVIIELALGALTGLDLALVGGSLTIGGAIGLLAGSAR |
| Ga0209693_103853062 | 3300027855 | Soil | VGMWVNWLLIIGGIVCVIVELALGAMTGLDLALIGGS |
| Ga0209275_107767732 | 3300027884 | Soil | VGMWVNWLLIIGGIVCVIVELALGAMTGFDLALIGGSLAIG |
| Ga0209624_101376502 | 3300027895 | Forest Soil | VGLWVNWALVIVGIVCVIAELVMGAMTGFDLALIGGS |
| Ga0247663_10252512 | 3300028145 | Soil | VGNWVNWLLIIGGIICVIIELALGAFTGFDLALVGGSLAVGGAIGFLA |
| Ga0247682_10303063 | 3300028146 | Soil | VSNLTNWLLLIIGVVCVIAELALGAITGFDLALVGASLAVGGVIGLVAHSETTGLIA |
| Ga0137415_102312204 | 3300028536 | Vadose Zone Soil | VGNWLNWVLVIGGFVCVIIELALGALTGFDLALVGASLAAGGAVGLLFGS |
| Ga0137415_106254122 | 3300028536 | Vadose Zone Soil | VSNWVNWLLVIVGILFVIVELALGALTGFDLALVGAALTVGGGFGLLAGSANI |
| Ga0308309_106827572 | 3300028906 | Soil | VGMWVNWLLIIGGIVCVIVELALGAMTGFDLALIGGSLAIGGGIGFLAGSEKIGLL |
| Ga0170834_1063392992 | 3300031057 | Forest Soil | VGNWVNWLLVIVGMLCVAAELALGALTGFDLALVGASLAAGGIIGLLAQTKKRKRRY |
| Ga0170834_1131850221 | 3300031057 | Forest Soil | VGNWVNWLLVIIGVLCVAAEIALGAITGFDLALVGAS |
| Ga0170822_102272352 | 3300031122 | Forest Soil | VGNWVNWLLVIVGVLCAAAELTLGALTGFDLALVGASLAAGGII |
| Ga0307474_111237422 | 3300031718 | Hardwood Forest Soil | VGNWVNWLLVIVGVLCAAAELALGALTGFDLALVGA |
| Ga0307469_101387301 | 3300031720 | Hardwood Forest Soil | VGSWVNWFLVITGILCAIAEIALGAITGFDLALVGASLAA |
| Ga0307468_1009733132 | 3300031740 | Hardwood Forest Soil | MGNWVNWLLVIAGVLCVAAELALGALTGFDLALVGASLAAGGVVGLIAQSWQTGLSSAA |
| Ga0307475_104385711 | 3300031754 | Hardwood Forest Soil | LGNWVNWLLVIGGIVCVIIELALGALTGFDLALLGASLAVGGGIGLLAGS |
| Ga0307478_107818162 | 3300031823 | Hardwood Forest Soil | VGNWVNWLLVIAGIICVIIELALGALTGLDLALVGASLTVGGGIGLLADSANI |
| Ga0307478_108495971 | 3300031823 | Hardwood Forest Soil | VGNWVNWLLLIVGIICVIIELALGALTGLDLALVGASLAA |
| Ga0307479_112164592 | 3300031962 | Hardwood Forest Soil | MPVDNWVNWLLIIIGIVCVIVELALGALTGFDLALIGGSLAIGGGIGFLVGS |
| Ga0307479_114854091 | 3300031962 | Hardwood Forest Soil | VGNWVSWILIIGGLVCVTIELALGAATGLDLALVGA |
| Ga0306924_105837311 | 3300032076 | Soil | VGNWVNWLLVIVGALCAAAEIALGAITGFDLALAGASLAAGGAIG |
| Ga0307472_1018568092 | 3300032205 | Hardwood Forest Soil | VGNWLNWVLVIGGFVCVIIELALGALTGFDLALVGASLAAGGAVGLLFGSANVG |
| Ga0335076_100488871 | 3300032955 | Soil | VGTWVNWLLIIGGIVCVIVELALGALTGFDLALIGGSLTLGGFIGLIIGSEK |
| Ga0316624_110519361 | 3300033486 | Soil | VGNWVNWLLVIGGILCVIIELALGAFTGFDLALVGGS |
| ⦗Top⦘ |