


| Basic Information | |
|---|---|
| Family ID | F053433 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ANLIWSPVAFVDVGIEGAWGHRVVVSNLKGDAWTLQSSMKFRF |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.42 % |
| % of genes near scaffold ends (potentially truncated) | 97.16 % |
| % of genes from short scaffolds (< 2000 bps) | 95.04 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.291 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (34.752 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.043 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.553 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.89% β-sheet: 0.00% Coil/Unstructured: 52.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF11964 | SpoIIAA-like | 54.61 |
| PF04551 | GcpE | 2.84 |
| PF00501 | AMP-binding | 1.42 |
| PF00903 | Glyoxalase | 1.42 |
| PF12679 | ABC2_membrane_2 | 1.42 |
| PF02530 | Porin_2 | 1.42 |
| PF02515 | CoA_transf_3 | 1.42 |
| PF00873 | ACR_tran | 0.71 |
| PF04392 | ABC_sub_bind | 0.71 |
| PF13458 | Peripla_BP_6 | 0.71 |
| PF01979 | Amidohydro_1 | 0.71 |
| PF09489 | CbtB | 0.71 |
| PF04773 | FecR | 0.71 |
| PF13464 | DUF4115 | 0.71 |
| PF00211 | Guanylate_cyc | 0.71 |
| PF00005 | ABC_tran | 0.71 |
| PF00180 | Iso_dh | 0.71 |
| PF13533 | Biotin_lipoyl_2 | 0.71 |
| PF13358 | DDE_3 | 0.71 |
| PF00291 | PALP | 0.71 |
| PF13577 | SnoaL_4 | 0.71 |
| PF02653 | BPD_transp_2 | 0.71 |
| PF07885 | Ion_trans_2 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 2.84 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.42 |
| COG3637 | Opacity protein LomR and related surface antigens | Cell wall/membrane/envelope biogenesis [M] | 1.42 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.71 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.29 % |
| Unclassified | root | N/A | 0.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005177|Ga0066690_10946331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300005179|Ga0066684_10413184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 906 | Open in IMG/M |
| 3300005179|Ga0066684_10614755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 730 | Open in IMG/M |
| 3300005445|Ga0070708_101410864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300005451|Ga0066681_10248822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1078 | Open in IMG/M |
| 3300005554|Ga0066661_10170472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1339 | Open in IMG/M |
| 3300005554|Ga0066661_10495587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300005560|Ga0066670_10889473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300005561|Ga0066699_10615889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300005566|Ga0066693_10129184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 935 | Open in IMG/M |
| 3300005566|Ga0066693_10437323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300005568|Ga0066703_10846168 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300005569|Ga0066705_10176827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1325 | Open in IMG/M |
| 3300005602|Ga0070762_10833148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300006028|Ga0070717_11174085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300006031|Ga0066651_10012811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3446 | Open in IMG/M |
| 3300006032|Ga0066696_10791314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300006032|Ga0066696_11016147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300006046|Ga0066652_100089882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2448 | Open in IMG/M |
| 3300006046|Ga0066652_100259527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1525 | Open in IMG/M |
| 3300006046|Ga0066652_101018499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 786 | Open in IMG/M |
| 3300006046|Ga0066652_101956921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300006175|Ga0070712_101492106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300006800|Ga0066660_10139627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1781 | Open in IMG/M |
| 3300006800|Ga0066660_10258981 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1365 | Open in IMG/M |
| 3300006800|Ga0066660_10923991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
| 3300006854|Ga0075425_102294982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300007076|Ga0075435_100070831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2846 | Open in IMG/M |
| 3300007788|Ga0099795_10276904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 731 | Open in IMG/M |
| 3300009012|Ga0066710_103839496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300009038|Ga0099829_10411641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1118 | Open in IMG/M |
| 3300009038|Ga0099829_11469041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300009088|Ga0099830_10254053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1392 | Open in IMG/M |
| 3300009089|Ga0099828_11758691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300009090|Ga0099827_10246822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1499 | Open in IMG/M |
| 3300009137|Ga0066709_101208295 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1113 | Open in IMG/M |
| 3300009143|Ga0099792_10035714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2335 | Open in IMG/M |
| 3300009143|Ga0099792_10646705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 679 | Open in IMG/M |
| 3300009143|Ga0099792_11017466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300010322|Ga0134084_10274567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 617 | Open in IMG/M |
| 3300010335|Ga0134063_10462487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300010364|Ga0134066_10072661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 940 | Open in IMG/M |
| 3300010376|Ga0126381_100373446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1978 | Open in IMG/M |
| 3300011270|Ga0137391_10499151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
| 3300011270|Ga0137391_10516847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1009 | Open in IMG/M |
| 3300011271|Ga0137393_10070523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2786 | Open in IMG/M |
| 3300012096|Ga0137389_10068737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2732 | Open in IMG/M |
| 3300012189|Ga0137388_11250522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300012198|Ga0137364_10784382 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300012199|Ga0137383_11337476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300012200|Ga0137382_10367247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1011 | Open in IMG/M |
| 3300012200|Ga0137382_10476891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 885 | Open in IMG/M |
| 3300012204|Ga0137374_10170471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1915 | Open in IMG/M |
| 3300012205|Ga0137362_10641770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
| 3300012205|Ga0137362_11620005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300012208|Ga0137376_11744184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300012209|Ga0137379_11379409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300012210|Ga0137378_10680803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium | 939 | Open in IMG/M |
| 3300012210|Ga0137378_11009098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
| 3300012211|Ga0137377_10407247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1298 | Open in IMG/M |
| 3300012211|Ga0137377_10741602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 916 | Open in IMG/M |
| 3300012211|Ga0137377_10884634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
| 3300012211|Ga0137377_11212987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300012211|Ga0137377_11313416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
| 3300012212|Ga0150985_119189793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
| 3300012350|Ga0137372_10978033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
| 3300012354|Ga0137366_10138425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1835 | Open in IMG/M |
| 3300012362|Ga0137361_10409343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1246 | Open in IMG/M |
| 3300012363|Ga0137390_10220274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1884 | Open in IMG/M |
| 3300012685|Ga0137397_10966803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300012685|Ga0137397_11346072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300012918|Ga0137396_10877722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300012922|Ga0137394_10969064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 708 | Open in IMG/M |
| 3300012923|Ga0137359_10998425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300012929|Ga0137404_11679035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300012961|Ga0164302_10348417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 989 | Open in IMG/M |
| 3300012975|Ga0134110_10572129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300012987|Ga0164307_10789152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
| 3300014166|Ga0134079_10054779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1413 | Open in IMG/M |
| 3300015241|Ga0137418_10499692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 973 | Open in IMG/M |
| 3300015264|Ga0137403_11152842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300015356|Ga0134073_10213038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300015371|Ga0132258_12060546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1435 | Open in IMG/M |
| 3300015374|Ga0132255_101823133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 924 | Open in IMG/M |
| 3300016387|Ga0182040_11060256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 678 | Open in IMG/M |
| 3300017972|Ga0187781_10561146 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300017975|Ga0187782_11068525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300018001|Ga0187815_10010694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4031 | Open in IMG/M |
| 3300018001|Ga0187815_10144667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1005 | Open in IMG/M |
| 3300018064|Ga0187773_10101238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1420 | Open in IMG/M |
| 3300018482|Ga0066669_10318318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1273 | Open in IMG/M |
| 3300018482|Ga0066669_11402184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
| 3300018482|Ga0066669_11855636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300020581|Ga0210399_11560332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300021358|Ga0213873_10109053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 803 | Open in IMG/M |
| 3300021432|Ga0210384_10698738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 908 | Open in IMG/M |
| 3300021432|Ga0210384_11908537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300022509|Ga0242649_1038632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300022525|Ga0242656_1056420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300022532|Ga0242655_10201522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300022533|Ga0242662_10047687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1096 | Open in IMG/M |
| 3300022533|Ga0242662_10329041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300022712|Ga0242653_1035349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 765 | Open in IMG/M |
| 3300022717|Ga0242661_1072747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300024331|Ga0247668_1044815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 902 | Open in IMG/M |
| 3300025915|Ga0207693_10330732 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300025922|Ga0207646_11636254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300025928|Ga0207700_11423720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300026547|Ga0209156_10120699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1287 | Open in IMG/M |
| 3300026557|Ga0179587_10430754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 862 | Open in IMG/M |
| 3300027546|Ga0208984_1009555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1830 | Open in IMG/M |
| 3300027684|Ga0209626_1055695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 993 | Open in IMG/M |
| 3300027738|Ga0208989_10248296 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300027775|Ga0209177_10361136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300027862|Ga0209701_10107931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1734 | Open in IMG/M |
| 3300027862|Ga0209701_10229532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1094 | Open in IMG/M |
| 3300027875|Ga0209283_10170325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1445 | Open in IMG/M |
| 3300027875|Ga0209283_10977334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300028536|Ga0137415_10242155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1614 | Open in IMG/M |
| 3300028536|Ga0137415_11315876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300030743|Ga0265461_12012144 | Not Available | 659 | Open in IMG/M |
| 3300030989|Ga0308196_1045702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
| 3300031015|Ga0138298_1347921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 714 | Open in IMG/M |
| 3300031057|Ga0170834_111585429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300031058|Ga0308189_10436717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300031093|Ga0308197_10337041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300031096|Ga0308193_1080472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300031097|Ga0308188_1014360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 715 | Open in IMG/M |
| 3300031114|Ga0308187_10232825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 661 | Open in IMG/M |
| 3300031231|Ga0170824_123868687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
| 3300031421|Ga0308194_10277859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
| 3300031421|Ga0308194_10291487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
| 3300031421|Ga0308194_10342000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300031446|Ga0170820_17303907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300031469|Ga0170819_14891713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 589 | Open in IMG/M |
| 3300031474|Ga0170818_101635653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1255 | Open in IMG/M |
| 3300031720|Ga0307469_11806798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300031754|Ga0307475_11339883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300031833|Ga0310917_10152721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1524 | Open in IMG/M |
| 3300031962|Ga0307479_12189183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300032180|Ga0307471_103134089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 34.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.13% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.13% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.71% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031015 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031097 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066690_109463312 | 3300005177 | Soil | ANLIWSPVAFVDLGVEGAWGHRVTVGNQRGDAWTLQSSMKFRF* |
| Ga0066684_104131841 | 3300005179 | Soil | IWSPVAFVDLGIEGAWGHRVTVGNQRGDAWTLQSSLKFRF* |
| Ga0066684_106147551 | 3300005179 | Soil | AHLNLIWSPVAFVDLGIEGAWGHRQVVSNLKGDAYTLQSRMTFRF* |
| Ga0070708_1014108642 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LIWSPVAFVDLGVEGAWGHRVTVSNLKGDAWTLQTSMKFRF* |
| Ga0066681_102488221 | 3300005451 | Soil | IWSPVAFVDLGVEGAWGHRVTVGNQRGDAWTLQSTMKFRF* |
| Ga0066661_101704724 | 3300005554 | Soil | AFVDVGIEGAWGHRVVVSNLKGDAYTLQSALKFRF* |
| Ga0066661_104955871 | 3300005554 | Soil | IWSPVAFVDLGVEGAWGHRVVVSNVKGDAWTLQSSLKFRF* |
| Ga0066670_108894731 | 3300005560 | Soil | IWSPVAFVDLGIEGAWGHRVTVGNQRGDAWTMQSSLKFRF* |
| Ga0066699_106158893 | 3300005561 | Soil | FVDLGVEGAWGHRVTVANTKGDAWTLQTSMKFRF* |
| Ga0066693_101291841 | 3300005566 | Soil | LAHANLIWSPVAFVDLGIEGAWGHRVTVGNQRGDAWTLQSSLKFRF* |
| Ga0066693_104373232 | 3300005566 | Soil | ANNKELALAHVNLIWSPVAFVDLGIEGGWGHREVVSNLKGDAWTMQSSLKFRF* |
| Ga0066703_108461682 | 3300005568 | Soil | ANLIWSPVAFVDLGVEGAWGHRVTVANQKGDAWTLQTSMKFRF* |
| Ga0066705_101768271 | 3300005569 | Soil | AFVDIGVEGAWGHRVVVSNVKGDAWTLQSSLKFRF* |
| Ga0070762_108331482 | 3300005602 | Soil | HANLIWSPVAFVDLGLEGAWGHRVTVANQKGDAWTLQTSMKFRF* |
| Ga0070717_111740853 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IWSPVAFVDLGIEGAWGHRVTVGNQRGDAWTLQSSMKFRF* |
| Ga0066651_100128114 | 3300006031 | Soil | ANLIWSPVAFVDVGIEGAWGHRVVVSNLKGDAFTLQSSLKFRF* |
| Ga0066696_107913142 | 3300006032 | Soil | ANKELNLAHANLIWSPVAFVDLGVEGAWGHRVTVGNQRGDAWTLQSTMKFRF* |
| Ga0066696_110161472 | 3300006032 | Soil | ANLIWSPVAFVDVGIEGAWGHRVVVSNLKGDAWTLQSSMKFRF* |
| Ga0066652_1000898821 | 3300006046 | Soil | LSLAHANLIWSPVAFVDVGIEGAWGHRVVVSNLKGDAFTLQSSLKFRF* |
| Ga0066652_1002595274 | 3300006046 | Soil | IWSPVAFVDVGIEGAWGHRVVVSNIKGDAYTLQSALKFRF* |
| Ga0066652_1010184991 | 3300006046 | Soil | NLAHANLIWSPVAFVDLGLEGAWGHRVTVGNQRGDAWTMQSSLKFRF* |
| Ga0066652_1019569211 | 3300006046 | Soil | NLIWSPVAFVDLGVEGAWGHRQTVNNLRGDAWTLQSSMKFRF* |
| Ga0070712_1014921061 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LIWSPVAFVDVGIEGAWGHRVVVSNLKGDAYTLQSSLKFRF* |
| Ga0066660_101396273 | 3300006800 | Soil | HVNLIWSPVAFVDLGIEGGWGHREVVSNLKGDAFTMQSSLKFRF* |
| Ga0066660_102589811 | 3300006800 | Soil | NLIWSPVAFVDVGIEGAWGHRVVVSNLKGDAYTLQSALKFRF* |
| Ga0066660_109239911 | 3300006800 | Soil | AFVDLGIEAAWGHRQTVSNLRGDAWTLQSSMKFRF* |
| Ga0075425_1022949821 | 3300006854 | Populus Rhizosphere | NKELNLAHANLIWSPVAFVDLGIEGAWGHRVNVANQKGDAWTLQSSMKFRF* |
| Ga0075435_1000708311 | 3300007076 | Populus Rhizosphere | FVDLGIEGAWGHRVVVSNLKGDAYTLQSSLKFRF* |
| Ga0099795_102769043 | 3300007788 | Vadose Zone Soil | WIWSPVAVVDGGIEGAGGHRVVVSNLKGDAYTLQSALKFRF* |
| Ga0066710_1038394961 | 3300009012 | Grasslands Soil | KELSLAHANLIWSPVAFVDVGVEGAWGHRVVVSNLKGDAWTLQSSLKFRF |
| Ga0099829_104116411 | 3300009038 | Vadose Zone Soil | NLIWSPVAFVDVGIEGAWGHRQVVSNLRGDAYTMQTSMKVRF* |
| Ga0099829_114690411 | 3300009038 | Vadose Zone Soil | LSVSHANLIWSPVAFVDLGLEGAWGHRVTVANQKGDAWTLQTSLKFRF* |
| Ga0099830_102540533 | 3300009088 | Vadose Zone Soil | VSHANLIWSPVAFVDVGIEGAWGHRVTVSNLKGDAWTLQSSMKFRF* |
| Ga0099828_117586911 | 3300009089 | Vadose Zone Soil | THLNLIWSPVAFVDIGIEGAWGHRQVVSNLRGDAYTMQTSMKVRF* |
| Ga0099827_102468223 | 3300009090 | Vadose Zone Soil | VAFVDIGIEGAWGHRQVVSNLRGDAYTMQTSMKVRF* |
| Ga0066709_1012082953 | 3300009137 | Grasslands Soil | HANLIWSPVAFVDVGVEGAWGHRVTVANVRGDAWTMQTSLKFRF* |
| Ga0099792_100357144 | 3300009143 | Vadose Zone Soil | AFVDLGIEGAWGHRVTVSNLRGDAWTLQTSMKFRF* |
| Ga0099792_106467052 | 3300009143 | Vadose Zone Soil | NKELSLTHLNLIWSPVAFVDLGIEGVWGHRKVVSNARGDAYTLQSSLKVRF* |
| Ga0099792_110174662 | 3300009143 | Vadose Zone Soil | IWSPVAFVDLGVEGAWGHRVTVANTKGDAWTLQTSMKFRF* |
| Ga0134084_102745672 | 3300010322 | Grasslands Soil | LAHANLIWSPVAFVDLGIEGAWGHRVTVGNQRGDAWTMQSSMKFRF* |
| Ga0134063_104624871 | 3300010335 | Grasslands Soil | LAHANLIWSPVAFVDVGVEGAWGHRVTVGNQRGDAWTMQSSLKFRF* |
| Ga0134066_100726613 | 3300010364 | Grasslands Soil | ELNLAHANLIWSPVAFVDLGIEGAWGHRVTVGNQRGDAWTMQSSMKFRF* |
| Ga0126381_1003734461 | 3300010376 | Tropical Forest Soil | AFVDVGVEGAWGHRVVVSNLKGDAWTLQTSMKFRF* |
| Ga0137391_104991511 | 3300011270 | Vadose Zone Soil | INLIWSPVAFVDIGIEGAWGHRQVVSNLRGDAYTVQSSMKVRF* |
| Ga0137391_105168473 | 3300011270 | Vadose Zone Soil | SPVAFVDIGIEGAWGHRQVVSNLRGDAYTMQTSMKVRF* |
| Ga0137393_100705235 | 3300011271 | Vadose Zone Soil | LVNKELSLTHINLIWSPVAFVDIGIEGAWGHRQVVSNLRGDAYTVQSSMKVRF* |
| Ga0137389_100687371 | 3300012096 | Vadose Zone Soil | SLTHINLIWSPVAFVDIGIEGAWGHRQVVSNLRGDAYTVQSSMKVRF* |
| Ga0137388_112505221 | 3300012189 | Vadose Zone Soil | VNKELSLTHLNLIWSPVAVVDIGIEGAWGHRQVVSNLGGDAYTMQTSMKVRF* |
| Ga0137364_107843821 | 3300012198 | Vadose Zone Soil | PVAFVDLGIDGGWGHREVVSNLKGDAFTMQSSLKFRF* |
| Ga0137383_113374761 | 3300012199 | Vadose Zone Soil | LIWSPVAFVDLGIEGAWGHREVVNNQKGDAWTMQSSLKFRF* |
| Ga0137382_103672473 | 3300012200 | Vadose Zone Soil | FVDVGIEGAWGHRVVVSNLKGDAYTLESSLKFRF* |
| Ga0137382_104768912 | 3300012200 | Vadose Zone Soil | LIWSPVAFVDIGVEGAWGHRVTVGNQKGDAWTLQSSMKFRF* |
| Ga0137374_101704711 | 3300012204 | Vadose Zone Soil | KELNLAHANLIWSPVAFVDLGVEGAWGHRVTVANVRGDAWTFQTSMKFRF* |
| Ga0137362_106417701 | 3300012205 | Vadose Zone Soil | PVAFVDLGLEGAWGHRQVVSNARGDCYAVQTSLKVRF* |
| Ga0137362_116200051 | 3300012205 | Vadose Zone Soil | NKELSLAHANLIWSPVAFVDVGVEGAWGHRQVVSNLKGDAWTLQSSLKFRF* |
| Ga0137376_117441841 | 3300012208 | Vadose Zone Soil | VAFVDLGVEGAWGHRVTVANVRGDAWTMQTSLKFRF* |
| Ga0137379_113794092 | 3300012209 | Vadose Zone Soil | GAANKELTLTHLNLIWSPVAFVDIGIEGAWGHRQVASNARGDAYTVQSSMKVRF* |
| Ga0137378_106808032 | 3300012210 | Vadose Zone Soil | WSPVAFVDLGIEGAWGHRVTVANNRGDTYSVQSSMKVRF* |
| Ga0137378_110090982 | 3300012210 | Vadose Zone Soil | WSPVAFVDIGIEGAWGHRQVASNARGDAYTVQSSMKVRF* |
| Ga0137377_104072471 | 3300012211 | Vadose Zone Soil | NLIWSPVAFVDLGVEGAWGHRVTVANVRGDAWTLQTSMKFRF* |
| Ga0137377_107416021 | 3300012211 | Vadose Zone Soil | LALAHVNLIWSPVAFVDVGIEGGWGHREVVSNLKGDAWTMQSSLKFRF* |
| Ga0137377_108846342 | 3300012211 | Vadose Zone Soil | ANLIWSPVAFVDLGVEGAWGHRVTVANVKGDAWTLQTSLKFRF* |
| Ga0137377_112129873 | 3300012211 | Vadose Zone Soil | ANLIWSPVAFVDLGLEGAWGHRVTVANVRGDAWTLQTSMKFRF* |
| Ga0137377_113134162 | 3300012211 | Vadose Zone Soil | IWSPVAFVDVGIEGAWGHRVVVSNLKGDAYTLQSALKFRF* |
| Ga0150985_1191897931 | 3300012212 | Avena Fatua Rhizosphere | NLVWSPVAFVDLGVEGAWGHRVTVGNQRGDAWTLQSSMKFRF* |
| Ga0137372_109780332 | 3300012350 | Vadose Zone Soil | IWSPVAFVDIGIEGAWGHRQVASNARGDAYTVQSSMKVRF* |
| Ga0137366_101384254 | 3300012354 | Vadose Zone Soil | AFVDLGIEGAWGHRQVAGNARGDCYTVQSSLKVRF* |
| Ga0137361_104093431 | 3300012362 | Vadose Zone Soil | HANLIWSPVAFVDLGVEGAWGHRVTVSNLRGDAWTMQTSLKFRF* |
| Ga0137390_102202741 | 3300012363 | Vadose Zone Soil | VNKELSVSHANLIWSPVAFVDVGIEGAWGHRVTVSNLKGDAWTLQSSMKFRF* |
| Ga0137397_109668031 | 3300012685 | Vadose Zone Soil | LIWSPVAFVDLGIEGAWGHRVTVGNQKGDAWTLQSSMKFRF* |
| Ga0137397_113460721 | 3300012685 | Vadose Zone Soil | NLIWSPVAFVDLGVEGAWGHRVTVANTKGDAWTLQPSMKFRF* |
| Ga0137396_108777222 | 3300012918 | Vadose Zone Soil | FVDLGVEGAWGHRVTVGNQKGDAWTLQTSMKFRF* |
| Ga0137394_109690641 | 3300012922 | Vadose Zone Soil | HANLIWSPVAFVDLGVEGAWGHRQTVANVRGDAWTLQTSMKFRF* |
| Ga0137359_109984251 | 3300012923 | Vadose Zone Soil | LSLAHANLIWSPVAFVDVGVEGAWGHRVVVSNLKGDAWTLQSSLKFRF* |
| Ga0137404_116790351 | 3300012929 | Vadose Zone Soil | NLAHANFIWSPVAFVDLGVEGAWGHRVTVSNLRGDAWTLQTSMKFRF* |
| Ga0164302_103484171 | 3300012961 | Soil | NLIWSPVAFVDLGIEGGWGHREVVSNLKGDAWTMQSSLKFRF* |
| Ga0134110_105721291 | 3300012975 | Grasslands Soil | LIWSPVAFVDIGIEGGWGHREVVSNLKGDAWTMQSSLKFRF* |
| Ga0164307_107891521 | 3300012987 | Soil | ANLIWSPVAFVDLGIEGAWGHRVTVGNQKGDAWTMQSSLKFRF* |
| Ga0134079_100547791 | 3300014166 | Grasslands Soil | IWSPVAFVDVGVEGAWGHRVVVSNLKGDVWTLQSSLKFRF* |
| Ga0137418_104996923 | 3300015241 | Vadose Zone Soil | LNLAHANLIWSPVAFVALGAESAWGHRVTVSNLRGDAWTMQTSLKFRF* |
| Ga0137403_111528421 | 3300015264 | Vadose Zone Soil | NLAHANFIWSPVAFVDLGVEGAWGHRVTVGNQKGDAWTLQSSMKFRF* |
| Ga0134073_102130382 | 3300015356 | Grasslands Soil | LIWSPVAFVDVGIEGAWGHRVVVSNLKGDAFTLQSSLKFRF* |
| Ga0132258_120605461 | 3300015371 | Arabidopsis Rhizosphere | NKEVALAHANLIWSPVAFVDLGIEGAWGHRVTVNNLKGDAWTLQSSMKFRF* |
| Ga0132255_1018231331 | 3300015374 | Arabidopsis Rhizosphere | AFVDIGVEGAWGHRVNVANQKGDAWTMQSSMKFRF* |
| Ga0182040_110602561 | 3300016387 | Soil | HANLIWSPVAFVDLGIEYAWGHRVITTNFKGDAYSLQGSMRVRF |
| Ga0187781_105611463 | 3300017972 | Tropical Peatland | LIWSPLAFVDVGVEGTWGHRLVVSNLRGDAYSLQGEFKVRF |
| Ga0187782_110685251 | 3300017975 | Tropical Peatland | IWSPVAFVDIGIEGAWGHRVVVSNLKGDAYTVQSAMKVRF |
| Ga0187815_100106941 | 3300018001 | Freshwater Sediment | AANNKELDLTHLNLIWSPVAFVDLGIEGAWGHRQVVSNTRGDAYTLQTSMKVRF |
| Ga0187815_101446672 | 3300018001 | Freshwater Sediment | AANNKELDLTHLNLIWSPVAFVDLGIEGAWGHRQVVSNTRVDAYTLQTSMKVRF |
| Ga0187773_101012381 | 3300018064 | Tropical Peatland | AHANLIWSPVSFIDTGIEYTWGHRVTLANLKSDANTLAANFRVKF |
| Ga0066669_103183183 | 3300018482 | Grasslands Soil | NLIWSPVAFVDLGIEGAWGHREVVSNLKGDAYTLQSRMTFRF |
| Ga0066669_114021842 | 3300018482 | Grasslands Soil | LAHANLIWSPVAFVDVGVEGAWGHRVTVGNQKGDAWTLQSSMKFRF |
| Ga0066669_118556362 | 3300018482 | Grasslands Soil | HANLIWSPVAFVDLGIEGAWGHRVTVGNQRGDAWTMESSMKFRF |
| Ga0210399_115603321 | 3300020581 | Soil | KELDLTHLNLLWSPVAFVDLGIEGAWGHRQVVTNLRGDAYTIQTAMKVRF |
| Ga0213873_101090531 | 3300021358 | Rhizosphere | SPVAFVDLGVEGAWGHRVVVSNLKGDAWTLQTSLKFRF |
| Ga0210384_106987381 | 3300021432 | Soil | RLANNKELSVAHANLIWSPVAFVDLGLEGAWGHRVTVANQKGDAWTLQTSMKFRF |
| Ga0210384_119085371 | 3300021432 | Soil | NKELSIAHANLIWSPVAFVDLGVEGAWGHRVTVANQKGDAWTLQTSMKFRF |
| Ga0242649_10386322 | 3300022509 | Soil | HLNLIWSPVAFVDLGVEGAWGHRVVVSNLRGDAYTLQTAMKVRF |
| Ga0242656_10564202 | 3300022525 | Soil | AATNKELDLTHLNLIWSPVAFVDLGIEGAWGHRQVVSNTRGDAYTLQTSMKVRF |
| Ga0242655_102015221 | 3300022532 | Soil | LTHANLIWSPVAFVDLGIEGAWGHRVTVANQKGDAWTLQSSLKFRF |
| Ga0242662_100476871 | 3300022533 | Soil | AINKELSVSHANLIWSPVAFVDLGIEGAWGHRVTVANQKGDAWTLQSSLKFRF |
| Ga0242662_103290411 | 3300022533 | Soil | HANLIWSPVAFVDLGIEGAWGHRVTVANQKGDAWTLQTSMKFRF |
| Ga0242653_10353493 | 3300022712 | Soil | KELSVAHANLIWSPVAFVDLGLEGAWGHRVTVANQKGDAWTLQSSMKFRF |
| Ga0242661_10727472 | 3300022717 | Soil | VHLNLIWSPVAFVDLGVEGAWGHRVVVNNNRGNAYTLQTAMKVRF |
| Ga0247668_10448151 | 3300024331 | Soil | LSLAHLNLIWSPVAFVDVGIEGAWGHRVVVSNLKGDAYTLQSSLKFRF |
| Ga0207693_103307321 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ANNKELSLAHVNLIWSPVAFVDVGIEGAWGHRVVVSNLKGDAYTLQSSLKFRF |
| Ga0207646_116362542 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ANLIWSPVAFVDLGVEGAGGHRVVVSNLKGDAWTLQTSMKFRF |
| Ga0207700_114237201 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ANLIWSPVAFVDLGVEGAWGHRVTVSNLRGDAWTMQTSLKFRF |
| Ga0209156_101206991 | 3300026547 | Soil | PVAFVDLGVEGAWGHRVTVGNQRGDAWTLQSSMKFRF |
| Ga0179587_104307543 | 3300026557 | Vadose Zone Soil | LNLAHANLIWSPVAFVDLGVEGAWGHRVTVGNQKGDAWTLQTSMKFRF |
| Ga0208984_10095551 | 3300027546 | Forest Soil | LAHANLIWSPVAFVDLGVEGAWGHRVTVSNLRGDAWTMQTSLKFRF |
| Ga0209626_10556953 | 3300027684 | Forest Soil | SVAHANLIWSPVAFVDLGLEGAWGHRVTVANQKGDAWTLQSSLKFRF |
| Ga0208989_102482962 | 3300027738 | Forest Soil | LALAHVNLIWSPVAFVDLGIEGGWGHREVVSNLKGDAFTMQSSLKFRF |
| Ga0209177_103611362 | 3300027775 | Agricultural Soil | LAHVNLIWSPVAFVDLGIEGGWGHREVVSNLKGDAWTMQSSLKFRF |
| Ga0209701_101079311 | 3300027862 | Vadose Zone Soil | IWSPVAFVDIGIEGAWGHRQVVSNLRGDAYTVQSSMKVRF |
| Ga0209701_102295323 | 3300027862 | Vadose Zone Soil | AVNKELSLTHLNLIWSPVAFVDIGIEGAWGHRQVVSNLRGDAYTMQTSMKVRF |
| Ga0209283_101703251 | 3300027875 | Vadose Zone Soil | WSPVAFVDIGIEGAWGHRQVVSNLRGDAYTVQSSMKVRF |
| Ga0209283_109773342 | 3300027875 | Vadose Zone Soil | ELSLTHINLIWSPVAFVDIGIEGAWGHRQVVSNLRGDAYTVQSSMKVRF |
| Ga0137415_102421551 | 3300028536 | Vadose Zone Soil | PVAFVDLGVEGAWGHRVTVANTKGDAWTLQTSMKFRF |
| Ga0137415_113158762 | 3300028536 | Vadose Zone Soil | IWSPVAFVDLGIEGGWGHREVVSNLKGDAFTMQSSLKFRF |
| Ga0265461_120121441 | 3300030743 | Soil | LVGAGTTNNKYLTLTHVNLIWSPVGFVDFGLEYAYGHRVVTSGLRGDAYTVESTMRVRF |
| Ga0308196_10457022 | 3300030989 | Soil | RNTSNKELNLAHANLIWSPVAFVDLGLEGAWGHRVTVGNQRGDAWTMQSSMKFRF |
| Ga0138298_13479212 | 3300031015 | Soil | PGTTNNKLLSMTHANLIWSPVAFVDLGVEGAWGHRVTVSNLRGDAWTMQTSLKFRF |
| Ga0170834_1115854291 | 3300031057 | Forest Soil | NLIWSPVAFVDIGIEGAWGHRVVVSNLKGDAYTMQTSMKFRF |
| Ga0308189_104367172 | 3300031058 | Soil | ARNNANKELNLAHANLIWSPVAFVDLGIEGAWGHRVTVGNQRGDAWTLQSSMKFRF |
| Ga0308197_103370412 | 3300031093 | Soil | ANLIWSPVAFVDLGVEGAWGHRVTVSNLKGDAWTLQTSMRFRF |
| Ga0308193_10804721 | 3300031096 | Soil | ANLIWSPVAFVDLGIEGAWGHRVTVGNQKGDAWTMQSSMKFRF |
| Ga0308188_10143602 | 3300031097 | Soil | VAFVDVGIEGAWGHRVVVSNLKGDAWTLASSLKFRF |
| Ga0308187_102328251 | 3300031114 | Soil | NSNKELNLAHANLIWSPVAFVDLGIEGAWGHRVTVGNQKGDAWTMQSSMKFRF |
| Ga0170824_1238686872 | 3300031231 | Forest Soil | PVAFVDLGVEGAWGHRVTVSNLRGDAWTLQTSMKFRF |
| Ga0308194_102778591 | 3300031421 | Soil | LSLTHINLIWSPVAFVDIGIEGAWGHRQVVSNARGDAYTLQSSMKVRF |
| Ga0308194_102914871 | 3300031421 | Soil | NKELNLAHANLIWSPVAFVDLGIEGAWGHRVTVGNQKGDAWTLQSSMKFRF |
| Ga0308194_103420002 | 3300031421 | Soil | ELTLVHLNLIWSPVAFVDIGIEGAWGHRQVASDARGDAYTVQSSMKVRF |
| Ga0170820_173039072 | 3300031446 | Forest Soil | WSPVAFVDLGVEGAWGHRVVVNNNRGNAYTLATAMKVRF |
| Ga0170819_148917131 | 3300031469 | Forest Soil | ELDLTHINLIWSPVAFVDLGIEGAWGHRQVASNARGDAYTVQSSLKVRF |
| Ga0170818_1016356533 | 3300031474 | Forest Soil | VAFVDLGVEGAWGHRVTVGNQKGDAWTLQTSMKFRF |
| Ga0307469_118067981 | 3300031720 | Hardwood Forest Soil | VAFVDLGIEGAWGHRVTVGNQKGDAWTMQSSMKFRF |
| Ga0307475_113398831 | 3300031754 | Hardwood Forest Soil | NKELTITHLNLIWSPAAFLDLGIEGAWGHREVVSNVKGDAYTVQTSMKFRF |
| Ga0310917_101527212 | 3300031833 | Soil | NLIWSPVAFVDLGIEYAWGHRVITTNFKGDAYSLQGSMRVRF |
| Ga0307479_121891831 | 3300031962 | Hardwood Forest Soil | DLTHINLIWSPVAFVDVGLEGAWGHRVVVSNQRGDAYTVQSSMKVRF |
| Ga0307471_1031340892 | 3300032180 | Hardwood Forest Soil | NLAHANLIWSPVAFVDLGIEGAWGHRVTVGNQRGDAWTMQSSMKFRF |
| ⦗Top⦘ |