


| Basic Information | |
|---|---|
| Family ID | F053413 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MLLSPLGERLGEGVMQETVFGLTPSPNLSPKGERNMRG |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 36.88 % |
| % of genes near scaffold ends (potentially truncated) | 41.84 % |
| % of genes from short scaffolds (< 2000 bps) | 83.69 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.397 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.113 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.624 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.482 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.58% β-sheet: 3.03% Coil/Unstructured: 89.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF00496 | SBP_bac_5 | 4.96 |
| PF03401 | TctC | 2.84 |
| PF01557 | FAA_hydrolase | 2.84 |
| PF02515 | CoA_transf_3 | 2.84 |
| PF01979 | Amidohydro_1 | 2.13 |
| PF00005 | ABC_tran | 2.13 |
| PF02911 | Formyl_trans_C | 2.13 |
| PF02779 | Transket_pyr | 2.13 |
| PF12172 | DUF35_N | 2.13 |
| PF00106 | adh_short | 1.42 |
| PF01642 | MM_CoA_mutase | 1.42 |
| PF13561 | adh_short_C2 | 1.42 |
| PF00108 | Thiolase_N | 1.42 |
| PF00528 | BPD_transp_1 | 1.42 |
| PF13416 | SBP_bac_8 | 1.42 |
| PF01268 | FTHFS | 1.42 |
| PF07690 | MFS_1 | 1.42 |
| PF00126 | HTH_1 | 1.42 |
| PF00550 | PP-binding | 0.71 |
| PF00425 | Chorismate_bind | 0.71 |
| PF00120 | Gln-synt_C | 0.71 |
| PF01796 | OB_aCoA_assoc | 0.71 |
| PF13458 | Peripla_BP_6 | 0.71 |
| PF05995 | CDO_I | 0.71 |
| PF12399 | BCA_ABC_TP_C | 0.71 |
| PF00850 | Hist_deacetyl | 0.71 |
| PF01019 | G_glu_transpept | 0.71 |
| PF00903 | Glyoxalase | 0.71 |
| PF01546 | Peptidase_M20 | 0.71 |
| PF13298 | LigD_N | 0.71 |
| PF16658 | RF3_C | 0.71 |
| PF16576 | HlyD_D23 | 0.71 |
| PF01451 | LMWPc | 0.71 |
| PF00042 | Globin | 0.71 |
| PF16868 | NMT1_3 | 0.71 |
| PF16363 | GDP_Man_Dehyd | 0.71 |
| PF03729 | DUF308 | 0.71 |
| PF00596 | Aldolase_II | 0.71 |
| PF07264 | EI24 | 0.71 |
| PF07978 | NIPSNAP | 0.71 |
| PF01008 | IF-2B | 0.71 |
| PF08327 | AHSA1 | 0.71 |
| PF00378 | ECH_1 | 0.71 |
| PF02780 | Transketolase_C | 0.71 |
| PF07969 | Amidohydro_3 | 0.71 |
| PF00109 | ketoacyl-synt | 0.71 |
| PF00004 | AAA | 0.71 |
| PF02653 | BPD_transp_2 | 0.71 |
| PF00296 | Bac_luciferase | 0.71 |
| PF13452 | MaoC_dehydrat_N | 0.71 |
| PF08402 | TOBE_2 | 0.71 |
| PF03200 | Glyco_hydro_63 | 0.71 |
| PF07475 | Hpr_kinase_C | 0.71 |
| PF00694 | Aconitase_C | 0.71 |
| PF01613 | Flavin_Reduct | 0.71 |
| PF13404 | HTH_AsnC-type | 0.71 |
| PF04014 | MazE_antitoxin | 0.71 |
| PF04397 | LytTR | 0.71 |
| PF01425 | Amidase | 0.71 |
| PF00587 | tRNA-synt_2b | 0.71 |
| PF02774 | Semialdhyde_dhC | 0.71 |
| PF13772 | AIG2_2 | 0.71 |
| PF06850 | PHB_depo_C | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 2.84 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.84 |
| COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 2.13 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.42 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 1.42 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 1.42 |
| COG2759 | Formyltetrahydrofolate synthetase | Nucleotide transport and metabolism [F] | 1.42 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.71 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.71 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG0182 | 5-methylthioribose/5-deoxyribulose 1-phosphate isomerase (methionine salvage pathway), a paralog of eIF-2B alpha subunit | Amino acid transport and metabolism [E] | 0.71 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.71 |
| COG1017 | Hemoglobin-like flavoprotein | Energy production and conversion [C] | 0.71 |
| COG1184 | Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG1493 | Serine kinase of the HPr protein, regulates carbohydrate metabolism | Signal transduction mechanisms [T] | 0.71 |
| COG1545 | Uncharacterized OB-fold protein, contains Zn-ribbon domain | General function prediction only [R] | 0.71 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.71 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.71 |
| COG3243 | Poly-beta-hydroxybutyrate synthase | Lipid transport and metabolism [I] | 0.71 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.71 |
| COG4553 | Poly-beta-hydroxyalkanoate depolymerase | Lipid transport and metabolism [I] | 0.71 |
| COG5553 | Predicted metal-dependent enzyme of the double-stranded beta helix superfamily | General function prediction only [R] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.52 % |
| Unclassified | root | N/A | 13.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004093|Ga0065178_101013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 14490 | Open in IMG/M |
| 3300005163|Ga0066823_10048416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
| 3300005343|Ga0070687_101118700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 577 | Open in IMG/M |
| 3300005445|Ga0070708_100054881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3541 | Open in IMG/M |
| 3300005467|Ga0070706_100012640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 7813 | Open in IMG/M |
| 3300005467|Ga0070706_100243996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1677 | Open in IMG/M |
| 3300005467|Ga0070706_101233104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 687 | Open in IMG/M |
| 3300005468|Ga0070707_100409768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1316 | Open in IMG/M |
| 3300005515|Ga0077122_10094083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis | 2867 | Open in IMG/M |
| 3300005548|Ga0070665_100787482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 964 | Open in IMG/M |
| 3300005549|Ga0070704_101551263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 610 | Open in IMG/M |
| 3300005602|Ga0070762_10246843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1109 | Open in IMG/M |
| 3300005610|Ga0070763_10022787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2785 | Open in IMG/M |
| 3300005616|Ga0068852_102071422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 591 | Open in IMG/M |
| 3300005616|Ga0068852_102859155 | Not Available | 501 | Open in IMG/M |
| 3300005617|Ga0068859_101688075 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 700 | Open in IMG/M |
| 3300005981|Ga0081538_10061731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2143 | Open in IMG/M |
| 3300005995|Ga0066790_10213957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 823 | Open in IMG/M |
| 3300006038|Ga0075365_10751706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300006038|Ga0075365_10767445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 681 | Open in IMG/M |
| 3300006038|Ga0075365_11057621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 572 | Open in IMG/M |
| 3300006041|Ga0075023_100139416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 882 | Open in IMG/M |
| 3300006042|Ga0075368_10444485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Chenggangzhangella → Chenggangzhangella methanolivorans | 574 | Open in IMG/M |
| 3300006047|Ga0075024_100602463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 591 | Open in IMG/M |
| 3300006048|Ga0075363_100203249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1132 | Open in IMG/M |
| 3300006051|Ga0075364_11199040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300006176|Ga0070765_100079910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2770 | Open in IMG/M |
| 3300006176|Ga0070765_100986222 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300006176|Ga0070765_101436435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300006176|Ga0070765_101653782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300006178|Ga0075367_10478109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 790 | Open in IMG/M |
| 3300006178|Ga0075367_10904234 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 563 | Open in IMG/M |
| 3300006603|Ga0074064_11453510 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300006642|Ga0075521_10295016 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 780 | Open in IMG/M |
| 3300006954|Ga0079219_11253416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 648 | Open in IMG/M |
| 3300007076|Ga0075435_100668749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 902 | Open in IMG/M |
| 3300007255|Ga0099791_10648744 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300007265|Ga0099794_10133437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1255 | Open in IMG/M |
| 3300007265|Ga0099794_10782617 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300009012|Ga0066710_104914772 | Not Available | 500 | Open in IMG/M |
| 3300009038|Ga0099829_10467749 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300009094|Ga0111539_10536734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1363 | Open in IMG/M |
| 3300009148|Ga0105243_12553492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 550 | Open in IMG/M |
| 3300009649|Ga0105855_1155715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 666 | Open in IMG/M |
| 3300009870|Ga0131092_10485702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis | 1116 | Open in IMG/M |
| 3300010159|Ga0099796_10148277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 922 | Open in IMG/M |
| 3300010159|Ga0099796_10166415 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 877 | Open in IMG/M |
| 3300010359|Ga0126376_11873971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300010398|Ga0126383_12620627 | Not Available | 588 | Open in IMG/M |
| 3300010399|Ga0134127_12770844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300010880|Ga0126350_11393036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300011269|Ga0137392_10224101 | Not Available | 1543 | Open in IMG/M |
| 3300011269|Ga0137392_10282136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1371 | Open in IMG/M |
| 3300011270|Ga0137391_10043197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3824 | Open in IMG/M |
| 3300011270|Ga0137391_10047391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3659 | Open in IMG/M |
| 3300011270|Ga0137391_10075805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2894 | Open in IMG/M |
| 3300011270|Ga0137391_10504742 | Not Available | 1024 | Open in IMG/M |
| 3300011270|Ga0137391_10748332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 809 | Open in IMG/M |
| 3300011270|Ga0137391_10985232 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300011271|Ga0137393_11127316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300011271|Ga0137393_11262230 | Not Available | 626 | Open in IMG/M |
| 3300012096|Ga0137389_10751247 | Not Available | 838 | Open in IMG/M |
| 3300012118|Ga0136594_1025332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 661 | Open in IMG/M |
| 3300012189|Ga0137388_10341212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 1380 | Open in IMG/M |
| 3300012189|Ga0137388_10987412 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300012189|Ga0137388_11987491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 510 | Open in IMG/M |
| 3300012205|Ga0137362_11157584 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300012363|Ga0137390_10102502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2830 | Open in IMG/M |
| 3300012683|Ga0137398_11066719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 558 | Open in IMG/M |
| 3300012907|Ga0157283_10276651 | Not Available | 571 | Open in IMG/M |
| 3300012910|Ga0157308_10352379 | Not Available | 557 | Open in IMG/M |
| 3300012917|Ga0137395_10236851 | Not Available | 1279 | Open in IMG/M |
| 3300012917|Ga0137395_10703280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 731 | Open in IMG/M |
| 3300012922|Ga0137394_11020363 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300012923|Ga0137359_11212909 | Not Available | 642 | Open in IMG/M |
| 3300012924|Ga0137413_10069802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2101 | Open in IMG/M |
| 3300012927|Ga0137416_12199362 | Not Available | 507 | Open in IMG/M |
| 3300013306|Ga0163162_12215808 | Not Available | 631 | Open in IMG/M |
| 3300013308|Ga0157375_13616665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 514 | Open in IMG/M |
| 3300014498|Ga0182019_10703653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 716 | Open in IMG/M |
| 3300014498|Ga0182019_11147290 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 569 | Open in IMG/M |
| 3300014498|Ga0182019_11418053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300015089|Ga0167643_1007730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1528 | Open in IMG/M |
| 3300015200|Ga0173480_10745419 | Not Available | 619 | Open in IMG/M |
| 3300015245|Ga0137409_11019276 | Not Available | 665 | Open in IMG/M |
| 3300015373|Ga0132257_103126223 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300018432|Ga0190275_10163632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2065 | Open in IMG/M |
| 3300018466|Ga0190268_10491616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 829 | Open in IMG/M |
| 3300018476|Ga0190274_10085019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2452 | Open in IMG/M |
| 3300018476|Ga0190274_12434090 | Not Available | 621 | Open in IMG/M |
| 3300019877|Ga0193722_1012790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2142 | Open in IMG/M |
| 3300019999|Ga0193718_1039877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1033 | Open in IMG/M |
| 3300020012|Ga0193732_1027721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 979 | Open in IMG/M |
| 3300020027|Ga0193752_1101023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1180 | Open in IMG/M |
| 3300020170|Ga0179594_10427995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300021168|Ga0210406_10376271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1142 | Open in IMG/M |
| 3300021181|Ga0210388_10474094 | Not Available | 1099 | Open in IMG/M |
| 3300021401|Ga0210393_11191117 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300021401|Ga0210393_11535041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Vineibacter → Vineibacter terrae | 529 | Open in IMG/M |
| 3300021403|Ga0210397_10284519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1210 | Open in IMG/M |
| 3300021403|Ga0210397_10706663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 775 | Open in IMG/M |
| 3300021403|Ga0210397_10850258 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300021403|Ga0210397_11062208 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300021404|Ga0210389_10148478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1818 | Open in IMG/M |
| 3300021404|Ga0210389_10947295 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300021405|Ga0210387_10079444 | All Organisms → cellular organisms → Bacteria | 2703 | Open in IMG/M |
| 3300021475|Ga0210392_10730466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 738 | Open in IMG/M |
| 3300022530|Ga0242658_1009104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1556 | Open in IMG/M |
| 3300022756|Ga0222622_11169680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300024250|Ga0228677_1077087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 647 | Open in IMG/M |
| 3300025302|Ga0207426_1013480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3028 | Open in IMG/M |
| 3300025494|Ga0207928_1068366 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300025907|Ga0207645_10489014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
| 3300025910|Ga0207684_10088928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2632 | Open in IMG/M |
| 3300025910|Ga0207684_10268775 | Not Available | 1471 | Open in IMG/M |
| 3300025922|Ga0207646_10104125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2545 | Open in IMG/M |
| 3300025922|Ga0207646_10809582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 834 | Open in IMG/M |
| 3300025922|Ga0207646_11210922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 662 | Open in IMG/M |
| 3300025926|Ga0207659_11736318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300026294|Ga0209839_10258804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300026551|Ga0209648_10329992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1067 | Open in IMG/M |
| 3300026551|Ga0209648_10656658 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300026825|Ga0209909_100296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 47544 | Open in IMG/M |
| 3300026825|Ga0209909_100399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 30300 | Open in IMG/M |
| 3300027496|Ga0208987_1040040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 833 | Open in IMG/M |
| 3300027663|Ga0208990_1063954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1073 | Open in IMG/M |
| 3300027671|Ga0209588_1102411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 921 | Open in IMG/M |
| 3300027882|Ga0209590_10320838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas | 996 | Open in IMG/M |
| 3300027889|Ga0209380_10021184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3677 | Open in IMG/M |
| 3300027903|Ga0209488_10105684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2113 | Open in IMG/M |
| 3300027907|Ga0207428_11279665 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300029636|Ga0222749_10084192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1468 | Open in IMG/M |
| 3300029984|Ga0311332_11273477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300029990|Ga0311336_10963296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 740 | Open in IMG/M |
| 3300031231|Ga0170824_117882697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300031250|Ga0265331_10142883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1088 | Open in IMG/M |
| (restricted) 3300031825|Ga0255338_1072841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1242 | Open in IMG/M |
| 3300031908|Ga0310900_10488285 | Not Available | 955 | Open in IMG/M |
| 3300032075|Ga0310890_11207457 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300033475|Ga0310811_10781444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 897 | Open in IMG/M |
| 3300034384|Ga0372946_0428148 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.80% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 5.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.13% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.13% |
| Cyanobacterial | Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial | 2.13% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.13% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.42% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.42% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.42% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.71% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.71% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.71% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.71% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.71% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.71% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Arabidopsis Root | Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root | 0.71% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.71% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004093 | Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-22 (version 2) | Host-Associated | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005515 | Combined assembly of arab plate scrape MF_Cvi (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012118 | Saline lake microbial communities from Deep Lake, Antarctica - Metagenome TFF #472 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024250 | Seawater microbial communities from Monterey Bay, California, United States - 58D_r | Environmental | Open in IMG/M |
| 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026825 | Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-22 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031825 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T4_195 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0065178_10101314 | 3300004093 | Cyanobacterial | MFLSPLRERLGEGVNADVSSCITPSPSLSPKGERSMNSLR* |
| Ga0066823_100484162 | 3300005163 | Soil | MLLSPLGERLGEGVMQEMIFVLTPSPNLSPKGERNMILGAPPS* |
| Ga0070687_1011187003 | 3300005343 | Switchgrass Rhizosphere | ALMLLSPLGERLGEGVMQEATFVLTPSPSLSPKGERNMTVE* |
| Ga0070708_1000548813 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLSPLGERLGEGVPKTVSCITPSPNLSPKGERRKREGLRV* |
| Ga0070706_1000126402 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLSPLGERLGEGVMQETVFELTPSPNLSPKGERNMKGN* |
| Ga0070706_1002439961 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLSPLGERLGEWVARAFKTPSPNLSPKGERNMSGGEED* |
| Ga0070706_1012331041 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLSPLGERLGEGVMQERVFGTPSPNLSPKGERNMRGEEHEGRGT* |
| Ga0070707_1004097682 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLSPLGERLGEGVMQETTFELTPSPNLSPKGERNLTLGALIS* |
| Ga0077122_100940834 | 3300005515 | Arabidopsis Root | MFLSPLGERLGEGAATDGARGTPSPNLSPKGERSKRRGRSC* |
| Ga0070665_1007874821 | 3300005548 | Switchgrass Rhizosphere | MLLSPLGERLGEGVMQEATFVLTPSPSLSPKGERNMS |
| Ga0070704_1015512632 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLSPLGERLGEGVMQEATFELTLSPSLSPEGERSMIVE* |
| Ga0070762_102468432 | 3300005602 | Soil | MLLSPLGERLGEGAARAFKTPSPNLSPKGERNMSGGEED* |
| Ga0070763_100227871 | 3300005610 | Soil | MLLSPLGERLGEGVLQEVAFALTPSPNLSPKGERNM |
| Ga0068852_1020714221 | 3300005616 | Corn Rhizosphere | MLLSPLGERLGEGVMQEATFVLTPSPSLSPKGERN |
| Ga0068852_1028591552 | 3300005616 | Corn Rhizosphere | LLSPLGERLGEGVTREKAFGLTPSPNLSPKGERNMRAW* |
| Ga0068859_1016880751 | 3300005617 | Switchgrass Rhizosphere | LMLLSPLGERLGEGVTREKAFGLTPSPNLSPKGERNMRAW* |
| Ga0081538_100617313 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MFLSPLGERLGEGVMQETVFGLTPSPNLSPKGERSMRTG* |
| Ga0066790_102139572 | 3300005995 | Soil | MLLSPLGERLGEGVMQGTVFGLTPSPNLSPKGERNMR* |
| Ga0075365_107517062 | 3300006038 | Populus Endosphere | MIHVPLPLGGERLGEGVNPKVFSCITPSPNLSPKGERSMRR |
| Ga0075365_107674452 | 3300006038 | Populus Endosphere | MLLSSWERLGEGAMQETLFGLTPSPNLSPRGERT* |
| Ga0075365_110576212 | 3300006038 | Populus Endosphere | MLLSPLGERLGEGVMKEIIFASHPSPNLSPKGGEEHDAQ* |
| Ga0075023_1001394162 | 3300006041 | Watersheds | MLLSPLGERLGEGVMQETVFGLTPSPNLSPKGERNMNA* |
| Ga0075368_104444852 | 3300006042 | Populus Endosphere | LGERLGEGYNTKIASCITPSPNLSPKGERRKREERDRWARF* |
| Ga0075024_1006024632 | 3300006047 | Watersheds | MLLSPLGERLGEGVMQETVFGTPSPNPSPKGERNMRA* |
| Ga0075363_1002032492 | 3300006048 | Populus Endosphere | MFLSPLGERLGEGVMQEITFGAPSPNLSPKGGEEYEEKKNMRRI* |
| Ga0075364_111990402 | 3300006051 | Populus Endosphere | MFLSPLGERLGEGATRKIASRITPSPNLSAKGERSKSMSGPE |
| Ga0070765_1000799104 | 3300006176 | Soil | MPLSPLGERLGEGAMQETTFGLTPSPNLSPKGERNMKTE* |
| Ga0070765_1009862222 | 3300006176 | Soil | MLLSPLGERLGEGVMQETVFELTPSPNLSPKGERNLKKMRE* |
| Ga0070765_1014364352 | 3300006176 | Soil | MLLSPLGERLGEGVMQETIFALTPSPNLSPKGERNPRGVRF* |
| Ga0070765_1016537822 | 3300006176 | Soil | MFLSPLGERLGEGVNSKVVSCITPSPSLSPKGERSM |
| Ga0075367_104781092 | 3300006178 | Populus Endosphere | MLLSPLGERLGEGVMKEIIFASHPSPNLSPKGGEELDAQ* |
| Ga0075367_109042341 | 3300006178 | Populus Endosphere | PLGERLGEGVMQETIFALPPHLASPQGDRNLSGEFGSASKL* |
| Ga0074064_114535102 | 3300006603 | Soil | IFLSPLGERLGEGVNPETVSCITPSPSLSPKGERSLRGEE* |
| Ga0075521_102950162 | 3300006642 | Arctic Peat Soil | MFLSPLGERLGEGVNPEIVSCITPSPSLSPKGERSMRKTA* |
| Ga0079219_112534162 | 3300006954 | Agricultural Soil | MLLSPLGERLGEGVMQEIAFGLTPSPNLSLKGERNMRANGDC* |
| Ga0075435_1006687491 | 3300007076 | Populus Rhizosphere | MLLSPLGERLGEGVMQETVFESTPSPNLSPKGERNMKGN* |
| Ga0099791_106487442 | 3300007255 | Vadose Zone Soil | MFLSPLGERLGEGVNPKIVSCITPSPSLSPQGGEEHETR |
| Ga0099794_101334373 | 3300007265 | Vadose Zone Soil | MLLSPLGERLGEGVMQEEAFGLTPSPNLSPKGERNMKA* |
| Ga0099794_107826172 | 3300007265 | Vadose Zone Soil | LMLLSPLGERLGEGVRTAFEALSPSLSPKGERNLREEY* |
| Ga0066710_1049147721 | 3300009012 | Grasslands Soil | MFLSPLGERLGEGVNSKIFSCITPSPSLSPKGERTLKRGR |
| Ga0099829_104677491 | 3300009038 | Vadose Zone Soil | MFLSPLGERLGEGVSKARGTPSPSLSPKGERSMRE* |
| Ga0111539_105367342 | 3300009094 | Populus Rhizosphere | LGERLGEGVMQETIYAVHPLTYLSPKGERNMRRAG* |
| Ga0105243_125534922 | 3300009148 | Miscanthus Rhizosphere | MLLSPLGKRLGEGVMQETVFVLHPSPNLSPKGRGI* |
| Ga0105855_11557152 | 3300009649 | Permafrost Soil | MLLSPLGERLGEGVMQGTVFGLTPSPNLSPKGGEVR* |
| Ga0131092_104857022 | 3300009870 | Activated Sludge | MFLSPNLLGERLGEGEMGLVWHTPSPNLSPKGERNMRLR* |
| Ga0099796_101482772 | 3300010159 | Vadose Zone Soil | MLARVFMFLSPLGERLGEGVNPKISSCITPSPSLSPKGER |
| Ga0099796_101664151 | 3300010159 | Vadose Zone Soil | MLLSPLGERLGERVQEQPLVTPSPSLSPKRERNMNGSRHYSADAP |
| Ga0126376_118739711 | 3300010359 | Tropical Forest Soil | HHQPLMLLSPLGERLGEGVMEETIFESPSPNLSP* |
| Ga0126383_126206272 | 3300010398 | Tropical Forest Soil | MLLSPLGERLGEGVMRETIFALPPHLTSPPKGERNMRGD* |
| Ga0134127_127708442 | 3300010399 | Terrestrial Soil | MLLSPLGERLGEGVMQEAIFALTPSPNLSPKGERNM |
| Ga0126350_113930362 | 3300010880 | Boreal Forest Soil | MLLCPLGERLGEVVMQEIVFALTPSPNLSPKGERNMKGVASRMA |
| Ga0137392_102241012 | 3300011269 | Vadose Zone Soil | MFLSPLGERLGEGVIEVVAYITPSPSLSPKGERSMRE* |
| Ga0137392_102821362 | 3300011269 | Vadose Zone Soil | LGERLGEGVMQEKAFGLTPSPSLSPKGERNMKTKKI* |
| Ga0137391_100431975 | 3300011270 | Vadose Zone Soil | MFLSPLGERLGEGVMQEETFALTPSPSLSPKGERSAMA* |
| Ga0137391_100473913 | 3300011270 | Vadose Zone Soil | MLLSPLGERLGEGVMQEAIFELTPSPDLSPKEGEELEV* |
| Ga0137391_100758053 | 3300011270 | Vadose Zone Soil | MFLSPLGERLGEGVNPKAVSCITPSPSLSPKGERSMTKM* |
| Ga0137391_105047422 | 3300011270 | Vadose Zone Soil | MFLSPLGERLGEGVPEARGTPSPSLSPKGERSMRE* |
| Ga0137391_107483321 | 3300011270 | Vadose Zone Soil | MLLSPLGERLGEGVMQEIVFGTPSPNLSPKGERNMRTRSWAVT |
| Ga0137391_109852321 | 3300011270 | Vadose Zone Soil | MFLSPLGERLGEGVNPETVSCITPSPSLSPKGERSMKGKETRVE |
| Ga0137393_111273162 | 3300011271 | Vadose Zone Soil | MLLSPLGERLGEGVIQEIVSGLTPSPNLSPKGERNMK |
| Ga0137393_112622301 | 3300011271 | Vadose Zone Soil | MRWLEVMFLSPLGERLGEGAWKARATPSPSLSPKGERSMKIK |
| Ga0137389_107512471 | 3300012096 | Vadose Zone Soil | MFLSPLGERLGEGVPKTVSCITPSPNLSPKGERRKREGSRVF* |
| Ga0136594_10253322 | 3300012118 | Saline Lake | MLLSPLGERLGEGVMQETIFALTPSPSLSPKGERNMSDEA* |
| Ga0137388_103412122 | 3300012189 | Vadose Zone Soil | LLFLLSPLGERLGEGVTPVASPSPNLSPKGERNMRGEASERRYC |
| Ga0137388_109874121 | 3300012189 | Vadose Zone Soil | MFLSPLGERLGEGASKAVRKPLTQPLPQGERSMREMRDAPRS |
| Ga0137388_119874912 | 3300012189 | Vadose Zone Soil | MLLSPLGERLGEGVTPVASPSPNLSPKGERNMRGEASERRYC |
| Ga0137362_111575842 | 3300012205 | Vadose Zone Soil | SCSSPPWGERLGEGVMQETIFGLTPSPNLSPKGERNMSLRH* |
| Ga0137390_101025024 | 3300012363 | Vadose Zone Soil | SCSSPPWGERLGEGVMQETIFGLTPSPNLSPKGERNRSLRH* |
| Ga0137398_110667192 | 3300012683 | Vadose Zone Soil | MLLSPLGERLGEGVMREAIFVLTPSPNRSPKGERNMKAWGGVF* |
| Ga0157283_102766512 | 3300012907 | Soil | VFIVPLMLLSPLGERLGEGVMQEAIFALTPSPNLSPKGERNMR* |
| Ga0157308_103523792 | 3300012910 | Soil | MLLSPLGERLGEGVMQEATFVLTPSPSLSPKGERNMTVE* |
| Ga0137395_102368511 | 3300012917 | Vadose Zone Soil | MLLSPLGERLGEGVMKETVSGLTPSPNLSPKGERNMR |
| Ga0137395_107032801 | 3300012917 | Vadose Zone Soil | MFLSPLGERLGEGVNAKAASCITPSPSLSPKGERSLKEERV |
| Ga0137394_110203632 | 3300012922 | Vadose Zone Soil | LSLMLLSPLGERLGEGVRTAFEAPSPSLSPKGERNLREEY* |
| Ga0137359_112129091 | 3300012923 | Vadose Zone Soil | MLLSPLGERLGEGVMQETAFDTPSPNLSPKGEGSMKGRGA* |
| Ga0137413_100698021 | 3300012924 | Vadose Zone Soil | VLLSPLGERLGEGAMQEVVFGLTPSPNLSPKGERNMN |
| Ga0137416_121993621 | 3300012927 | Vadose Zone Soil | MFLSPLGERLGEGVPKTVSCITPSPNLSPKGERRKREGPRVL* |
| Ga0163162_122158082 | 3300013306 | Switchgrass Rhizosphere | PLGERLGEGVMKEIIFASHPSPNLSPKGGKEHDAQ* |
| Ga0157375_136166652 | 3300013308 | Miscanthus Rhizosphere | MLLSPLGERLGEGVMRETVFVLTPSPNLSPKGERNMRLTHAA* |
| Ga0182019_107036532 | 3300014498 | Fen | MLLSPLGERLGEGMMQAAVFALTPSPNLSPKGERNMIFPLGERH* |
| Ga0182019_111472902 | 3300014498 | Fen | MLLSPLGERLGEGVMQETIFGLTPSPSLSPKGERNMR |
| Ga0182019_114180532 | 3300014498 | Fen | MLLSPLGERLGEGVMQETTFESTPSPNLSPKGERNMN* |
| Ga0167643_10077302 | 3300015089 | Glacier Forefield Soil | MLLSPLGERLGEGVMQETVFGLTPSPNLSPKGERNMRG* |
| Ga0173480_107454192 | 3300015200 | Soil | MLLSPLGERLGEGVMQEATFELTLSPSLSPEGERSMTVE* |
| Ga0137409_110192761 | 3300015245 | Vadose Zone Soil | MLLSPARGRGGERGLQTAFEAPSPNLSPLAGERNLT* |
| Ga0132257_1031262232 | 3300015373 | Arabidopsis Rhizosphere | MTLLMLLSPLGERLGEGVMHEMIFVLTPSPNLSPKGERNMILGAPPS* |
| Ga0190275_101636323 | 3300018432 | Soil | MFLPPLGERLGEGDNTKAVSCITPSPNLSPNGERSMTGGPEEFSL |
| Ga0190268_104916162 | 3300018466 | Soil | LVRDVALMLLCPLGERLGEGVMQKEIFEAPSPSLSP |
| Ga0190274_100850193 | 3300018476 | Soil | MLLSPLGERLGEGVMQETAFVLSPSPSLSPKGERNMREDGHQTI |
| Ga0190274_124340901 | 3300018476 | Soil | MLLSPAGERLGEGAIRDAAFELTPSRDLSPKGERNMKCEHDARA |
| Ga0193722_10127903 | 3300019877 | Soil | MLLSPLGERLGEGVMQETVFELTPSPNLSPKGERNMRG |
| Ga0193718_10398773 | 3300019999 | Soil | MLLSPLGERLGEGVMQETIFGLTPSPNLSPKGERNMKREEHEGRGI |
| Ga0193732_10277211 | 3300020012 | Soil | MFLSPLGERLGEGVNAKIASCITPSPSLSPKGERSMKAGGVI |
| Ga0193752_11010231 | 3300020027 | Soil | MLLSPLGERLGEGVMQEAIFGLTPSPNLSPKGERKMNAV |
| Ga0179594_104279952 | 3300020170 | Vadose Zone Soil | QPSAFVLLSPLGERLGEGAMQEVVFGLTPSPNLSPKGERNMTH |
| Ga0210406_103762712 | 3300021168 | Soil | MFLSPLGERLGEGVTPKTVSRITPSPSLSPKEGEERKRRA |
| Ga0210388_104740941 | 3300021181 | Soil | MLLSPLGERLGEGVPKTVSCITPSPSLSPKGERSMRESPALFQS |
| Ga0210393_111911172 | 3300021401 | Soil | MLLSPLGERLGEGVMQEAVFGLTPSPNLSPKGERNMHA |
| Ga0210393_115350411 | 3300021401 | Soil | MLLSPLGERLGEGVMQETVFGTPSPNLSTKGEGSM |
| Ga0210397_102845192 | 3300021403 | Soil | MLLSPLGERLGEGVMQKTIFALTPSPNLSPKGERNPRGVRF |
| Ga0210397_107066632 | 3300021403 | Soil | MLLSPLGERLGEGVMQETIFVLTPSSNLSPKGERNMTLGAPLT |
| Ga0210397_108502582 | 3300021403 | Soil | MTHIPLPPLGERLGEGVNAKAASCITPSPSLSPKGERS |
| Ga0210397_110622081 | 3300021403 | Soil | MLLSPLGERLGEGVMQETVSGLTPSPNLSPKGGGD |
| Ga0210389_101484782 | 3300021404 | Soil | MFLSPLGERLGEGVAQDCLLHHPLTNLSPKGERSMS |
| Ga0210389_109472952 | 3300021404 | Soil | MFLSPLGERLGEGVNAKIVSCITPSPSLSPKGERSMKKG |
| Ga0210387_100794442 | 3300021405 | Soil | MLLSPLGERLGEGVMQEAIFGLTPSPNLSPKGERNMSLSL |
| Ga0210392_107304662 | 3300021475 | Soil | MFLSPLGERLGEGVKQETVFELTPSPNLSPKGERNPKKMRE |
| Ga0242658_10091042 | 3300022530 | Soil | MLLSPLGERLGEGVMQEAVSGLTPSPNLSPKGERNMRG |
| Ga0222622_111696802 | 3300022756 | Groundwater Sediment | MLLSPLGERLGEGVMQEATFELTPSPSLSPKGERNMTVE |
| Ga0228677_10770872 | 3300024250 | Seawater | MLLSPLGERLGEGVMQETIFALTPSPSLSPKGERNMSDEA |
| Ga0207426_10134804 | 3300025302 | Arabidopsis Rhizosphere | MFLSPLGERLGEGAATDGARGTPSPNLSPKGERSKRRGRSC |
| Ga0207928_10683662 | 3300025494 | Arctic Peat Soil | MFLSPLGERLGEGVNPEIVSCITPSPSLSPKGERSMRKTA |
| Ga0207645_104890141 | 3300025907 | Miscanthus Rhizosphere | MLLSPLGERLGEGVMQETIFALHPPHLTSPPKGERNMKESNAAGR |
| Ga0207684_100889282 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLSPLGERLGEGVMQETVFELTPSPNLSPKGERNMKGN |
| Ga0207684_102687751 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLSPLGERLGEGVPKTVSCITPSPNLSPKGERRKREGLRV |
| Ga0207646_101041253 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLSPLGERLGEGVMQETTFELTPSPNLSPKGERNLTLGALIS |
| Ga0207646_108095822 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLSPLGERLGEWVARAFKTPSPNLSPKGERNMSGGEED |
| Ga0207646_112109222 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLSPLGERLGEGVMQERVFGTPSPNLSPKGERNMRGEEHEGRGT |
| Ga0207659_117363182 | 3300025926 | Miscanthus Rhizosphere | MLLSPLGERLGEGVMQEATFVLTPSPSLSPKGERNMTVE |
| Ga0209839_102588042 | 3300026294 | Soil | CSSPLMLLSPLGERLGEGVMQGTVFGLTPSPNLSPKGERNMR |
| Ga0209648_103299922 | 3300026551 | Grasslands Soil | MLLSPLGERLGEGVMQEIVFGTPSPNLSPKGERNMK |
| Ga0209648_106566582 | 3300026551 | Grasslands Soil | MFLSPLGERLGEGVMQEETFALTPSPSLSPKGERSMMA |
| Ga0209909_1002964 | 3300026825 | Cyanobacterial | MFLSPLRERLGEGVNADVSSCITPSPSLSPKGERSMNSLR |
| Ga0209909_1003995 | 3300026825 | Cyanobacterial | MLLSPLGERLGEGVMQETVFALTPSPNLSPKGERNMRG |
| Ga0208987_10400402 | 3300027496 | Forest Soil | PPNAPLPLGERLDEGVMQETVFGTPSPNLSPKGERNMRA |
| Ga0208990_10639543 | 3300027663 | Forest Soil | MLVSPLGERLGEGVMQEAIFALTPSPNLSPKGGEEH |
| Ga0209588_11024113 | 3300027671 | Vadose Zone Soil | MLLSPLGERLGEGVMQEEAFGLTPSPNLSPKGERNMKA |
| Ga0209590_103208381 | 3300027882 | Vadose Zone Soil | MFLLVLVLMLLSPLGERLGEGVARAVEAPSPSLSPKGERNMRGRGV |
| Ga0209380_100211841 | 3300027889 | Soil | MLLSPLGERLGEGAARAFKTPSPNLSPKGERNMSGGEED |
| Ga0209488_101056842 | 3300027903 | Vadose Zone Soil | MFLSPLGERLGEGVNPKAACCITPSPNLSPKGERSLIGDLSTP |
| Ga0207428_112796651 | 3300027907 | Populus Rhizosphere | LIQRIILLSPLGERLGEGVMQETIYAVHPLTYLSPKGERNMRRAG |
| Ga0222749_100841921 | 3300029636 | Soil | LMFLSPSGERLGEGVNPGTISCITPSPSLSPKGERSKRPCNEEGHR |
| Ga0311332_112734772 | 3300029984 | Fen | MLLSPLGERLGEGAMREKAFGLTPSPSLSPKGERNLRRIKGIRP |
| Ga0311336_109632962 | 3300029990 | Fen | MLLSPLGERLGEGVMQEGASVLAPSPNLSPEGERNMTS |
| Ga0170824_1178826972 | 3300031231 | Forest Soil | FLRLFSFGERLGGGVMHEEVFAGTPSPNLSPKGGRNMRES |
| Ga0265331_101428833 | 3300031250 | Rhizosphere | MRLDISRFLLLSPLGERLGEGVMQETVVALTPSPNLSPKGERNLN |
| (restricted) Ga0255338_10728412 | 3300031825 | Sandy Soil | MLLSPLGERLGEGVMQETVFALTPSPNLSPKGERNLRVPAH |
| Ga0310900_104882851 | 3300031908 | Soil | MLLSPLGERLGEGVMKEIIFASHPSPNLSPKGGEEHDAQ |
| Ga0310890_112074572 | 3300032075 | Soil | ILLSPLGERLGEGVMQETIYAVHPLTYLSPKGERNMRRAG |
| Ga0310811_107814442 | 3300033475 | Soil | MFLSPLGERLGEGVIKTASCITPSPSLSPKGERSMNGNDAMK |
| Ga0372946_0428148_3_119 | 3300034384 | Soil | MFLSPLGERLGEGVNANGVSCNTPAPTHTPKGGRSMKGK |
| ⦗Top⦘ |