


| Basic Information | |
|---|---|
| Family ID | F053399 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MGLEPSDVLFIAIVIWLAIEIINGGGGGHRSRVPAR |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 60.28 % |
| % of genes near scaffold ends (potentially truncated) | 7.80 % |
| % of genes from short scaffolds (< 2000 bps) | 72.34 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.199 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil (13.475 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.730 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.610 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.12% β-sheet: 0.00% Coil/Unstructured: 71.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF01593 | Amino_oxidase | 25.53 |
| PF13450 | NAD_binding_8 | 19.86 |
| PF00117 | GATase | 13.48 |
| PF00425 | Chorismate_bind | 7.09 |
| PF00990 | GGDEF | 2.13 |
| PF13620 | CarboxypepD_reg | 1.42 |
| PF01180 | DHO_dh | 1.42 |
| PF08282 | Hydrolase_3 | 1.42 |
| PF06480 | FtsH_ext | 0.71 |
| PF00155 | Aminotran_1_2 | 0.71 |
| PF01042 | Ribonuc_L-PSP | 0.71 |
| PF00156 | Pribosyltran | 0.71 |
| PF00486 | Trans_reg_C | 0.71 |
| PF09586 | YfhO | 0.71 |
| PF05050 | Methyltransf_21 | 0.71 |
| PF00890 | FAD_binding_2 | 0.71 |
| PF01502 | PRA-CH | 0.71 |
| PF04964 | Flp_Fap | 0.71 |
| PF01212 | Beta_elim_lyase | 0.71 |
| PF07589 | PEP-CTERM | 0.71 |
| PF07676 | PD40 | 0.71 |
| PF01799 | Fer2_2 | 0.71 |
| PF04715 | Anth_synt_I_N | 0.71 |
| PF01255 | Prenyltransf | 0.71 |
| PF09997 | DUF2238 | 0.71 |
| PF00743 | FMO-like | 0.71 |
| PF02148 | zf-UBP | 0.71 |
| PF02913 | FAD-oxidase_C | 0.71 |
| PF00326 | Peptidase_S9 | 0.71 |
| PF00710 | Asparaginase | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 1.42 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 1.42 |
| COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 1.42 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 1.42 |
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 1.42 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 1.42 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 1.42 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.42 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 1.42 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 1.42 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 1.42 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 1.42 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 1.42 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.71 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.71 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.71 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.71 |
| COG0139 | Phosphoribosyl-AMP cyclohydrolase | Amino acid transport and metabolism [E] | 0.71 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.71 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.71 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.71 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.71 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.71 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.71 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.71 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.71 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.71 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.71 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.71 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.71 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.71 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.71 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.71 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.20 % |
| Unclassified | root | N/A | 7.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908009|FWIRA_GRAM18401DV5QC | Not Available | 516 | Open in IMG/M |
| 3300000567|JGI12270J11330_10067630 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → unclassified Candidatus Brocadiae → Candidatus Brocadiae bacterium | 1802 | Open in IMG/M |
| 3300005524|Ga0070737_10000031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 357283 | Open in IMG/M |
| 3300005524|Ga0070737_10156337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 978 | Open in IMG/M |
| 3300005531|Ga0070738_10000208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 184752 | Open in IMG/M |
| 3300005533|Ga0070734_10627527 | Not Available | 611 | Open in IMG/M |
| 3300005534|Ga0070735_10015075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5737 | Open in IMG/M |
| 3300005537|Ga0070730_10087683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2171 | Open in IMG/M |
| 3300005541|Ga0070733_10013075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5210 | Open in IMG/M |
| 3300005541|Ga0070733_10510837 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005541|Ga0070733_11075357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 540 | Open in IMG/M |
| 3300005591|Ga0070761_10288789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300005607|Ga0070740_10070335 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300005719|Ga0068861_101101462 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300006050|Ga0075028_100315635 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300006052|Ga0075029_100000308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 27630 | Open in IMG/M |
| 3300006052|Ga0075029_101106087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300006176|Ga0070765_101697786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300006354|Ga0075021_10012654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4616 | Open in IMG/M |
| 3300007819|Ga0104322_104247 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300009038|Ga0099829_10588053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300009088|Ga0099830_10654460 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300009089|Ga0099828_10290647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1469 | Open in IMG/M |
| 3300009090|Ga0099827_10686414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300009177|Ga0105248_12791449 | Not Available | 557 | Open in IMG/M |
| 3300009633|Ga0116129_1000293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 34322 | Open in IMG/M |
| 3300010048|Ga0126373_10496418 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300010376|Ga0126381_100017697 | All Organisms → cellular organisms → Bacteria | 8251 | Open in IMG/M |
| 3300010379|Ga0136449_100740998 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300010379|Ga0136449_104123533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300010396|Ga0134126_11477749 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300010401|Ga0134121_10255080 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300010403|Ga0134123_10899208 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300010880|Ga0126350_12311156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300011120|Ga0150983_14479860 | Not Available | 532 | Open in IMG/M |
| 3300011271|Ga0137393_10681195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300012361|Ga0137360_10206120 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300012362|Ga0137361_11372359 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300012363|Ga0137390_10888354 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300012923|Ga0137359_10049312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3659 | Open in IMG/M |
| 3300012929|Ga0137404_12203047 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300014162|Ga0181538_10117812 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300014162|Ga0181538_10406375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 725 | Open in IMG/M |
| 3300014326|Ga0157380_11397685 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300014489|Ga0182018_10415162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 719 | Open in IMG/M |
| 3300014495|Ga0182015_10164226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1502 | Open in IMG/M |
| 3300014499|Ga0182012_10108304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2072 | Open in IMG/M |
| 3300014501|Ga0182024_10009383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 20248 | Open in IMG/M |
| 3300014501|Ga0182024_10043007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 7359 | Open in IMG/M |
| 3300014501|Ga0182024_11166582 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300014501|Ga0182024_11782650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300014838|Ga0182030_10001883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 44005 | Open in IMG/M |
| 3300014838|Ga0182030_10050566 | All Organisms → cellular organisms → Bacteria | 6632 | Open in IMG/M |
| 3300014968|Ga0157379_10665340 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300016750|Ga0181505_10736552 | Not Available | 519 | Open in IMG/M |
| 3300017943|Ga0187819_10151857 | Not Available | 1379 | Open in IMG/M |
| 3300017948|Ga0187847_10619802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300017970|Ga0187783_10636705 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300017972|Ga0187781_10582267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300017972|Ga0187781_10771901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300017975|Ga0187782_10122206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1926 | Open in IMG/M |
| 3300018007|Ga0187805_10129006 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300018014|Ga0187860_1023935 | All Organisms → cellular organisms → Bacteria | 3456 | Open in IMG/M |
| 3300018086|Ga0187769_10394774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
| 3300018088|Ga0187771_11739891 | Not Available | 529 | Open in IMG/M |
| 3300020579|Ga0210407_10059728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2854 | Open in IMG/M |
| 3300020580|Ga0210403_10000366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 48987 | Open in IMG/M |
| 3300021168|Ga0210406_10529495 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300021171|Ga0210405_10266474 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300021171|Ga0210405_10922713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300021181|Ga0210388_10000008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 446328 | Open in IMG/M |
| 3300021403|Ga0210397_11548029 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300021405|Ga0210387_10622176 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300021420|Ga0210394_10499665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1070 | Open in IMG/M |
| 3300021432|Ga0210384_10609554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 980 | Open in IMG/M |
| 3300021432|Ga0210384_11499091 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300021475|Ga0210392_11439899 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300025463|Ga0208193_1000716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 15962 | Open in IMG/M |
| 3300026075|Ga0207708_10626675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
| 3300026320|Ga0209131_1083186 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300027706|Ga0209581_1000006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993998 | Open in IMG/M |
| 3300027706|Ga0209581_1012131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5266 | Open in IMG/M |
| 3300027706|Ga0209581_1114460 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300027795|Ga0209139_10162541 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300027842|Ga0209580_10309207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 787 | Open in IMG/M |
| 3300027867|Ga0209167_10117794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1372 | Open in IMG/M |
| 3300027867|Ga0209167_10581810 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300027869|Ga0209579_10005484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8607 | Open in IMG/M |
| 3300027875|Ga0209283_10296057 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300027905|Ga0209415_10151731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2327 | Open in IMG/M |
| 3300027910|Ga0209583_10268995 | Not Available | 760 | Open in IMG/M |
| 3300027911|Ga0209698_10001649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 25715 | Open in IMG/M |
| 3300027911|Ga0209698_10106760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2338 | Open in IMG/M |
| 3300027965|Ga0209062_1000021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718977 | Open in IMG/M |
| 3300027986|Ga0209168_10144559 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300028780|Ga0302225_10503036 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300028792|Ga0307504_10424723 | Not Available | 528 | Open in IMG/M |
| 3300029911|Ga0311361_10244231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2115 | Open in IMG/M |
| 3300029911|Ga0311361_10299129 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300029999|Ga0311339_10125837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3079 | Open in IMG/M |
| 3300030991|Ga0073994_11623134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300031122|Ga0170822_16823232 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300031231|Ga0170824_101503152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031231|Ga0170824_102896048 | Not Available | 703 | Open in IMG/M |
| 3300031234|Ga0302325_10464803 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
| 3300031234|Ga0302325_10625343 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300031234|Ga0302325_11907876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300031234|Ga0302325_12242197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300031236|Ga0302324_102807785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300031250|Ga0265331_10528827 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031525|Ga0302326_10169646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3711 | Open in IMG/M |
| 3300031525|Ga0302326_10681570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1508 | Open in IMG/M |
| 3300031525|Ga0302326_12931377 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031708|Ga0310686_100088885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1388 | Open in IMG/M |
| 3300031708|Ga0310686_104066854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 19587 | Open in IMG/M |
| 3300031708|Ga0310686_105134641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300031708|Ga0310686_108246245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2960 | Open in IMG/M |
| 3300031708|Ga0310686_112518371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1677 | Open in IMG/M |
| 3300031708|Ga0310686_113784878 | Not Available | 515 | Open in IMG/M |
| 3300031708|Ga0310686_115674183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 12794 | Open in IMG/M |
| 3300031708|Ga0310686_116499428 | All Organisms → cellular organisms → Bacteria | 7192 | Open in IMG/M |
| 3300031715|Ga0307476_10301341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300031715|Ga0307476_11139695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300031718|Ga0307474_10262752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1324 | Open in IMG/M |
| 3300031718|Ga0307474_10427491 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300031718|Ga0307474_10753126 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300032160|Ga0311301_10002162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 74546 | Open in IMG/M |
| 3300032160|Ga0311301_10472763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1875 | Open in IMG/M |
| 3300032160|Ga0311301_12631580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300032205|Ga0307472_100457298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1087 | Open in IMG/M |
| 3300032515|Ga0348332_14736253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
| 3300032770|Ga0335085_10622493 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300032783|Ga0335079_11210604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300032805|Ga0335078_10379970 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
| 3300032829|Ga0335070_10000011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 339217 | Open in IMG/M |
| 3300032892|Ga0335081_10379491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1828 | Open in IMG/M |
| 3300032895|Ga0335074_10052344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5614 | Open in IMG/M |
| 3300032897|Ga0335071_10180834 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
| 3300032954|Ga0335083_10747639 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300033405|Ga0326727_10908433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300033887|Ga0334790_030022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2267 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 13.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.22% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.26% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.26% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.84% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.13% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.13% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.13% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.13% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.42% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.42% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.71% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.71% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.71% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRA_01886560 | 2124908009 | Soil | MGLEPSDVLFIVIVIWIALEIINGDWGGGHRGRVPVQ |
| JGI12270J11330_100676302 | 3300000567 | Peatlands Soil | MQLEPSDVVFIAIVIWLAIEIINGDWGGGFRSRVPVR* |
| Ga0070737_10000031242 | 3300005524 | Surface Soil | MGVEPSDVLFIAIVVWIILEIINGDWGGGHRARVPARS* |
| Ga0070737_101563372 | 3300005524 | Surface Soil | MGVEPSDVLFIAIIIWIVLEIINGDWGGGHRARVPARS* |
| Ga0070738_1000020835 | 3300005531 | Surface Soil | MGLEPSDVLFIAIILWIILEIINGDWGGGHRARVPATTR* |
| Ga0070734_106275272 | 3300005533 | Surface Soil | MGLEPSDVLFIAIVLWLIFEIINGDWGGGRRARVPVF* |
| Ga0070735_100150755 | 3300005534 | Surface Soil | MGLEPSDVLFIAIIIWIVLEIIDDDWGGGHRARVPAH* |
| Ga0070730_100876832 | 3300005537 | Surface Soil | MPLDPSDAVFLAIVIWLALEIMDGGGGGRRSRVPAAS* |
| Ga0070733_100130755 | 3300005541 | Surface Soil | MPLDPSDVVFLAIVIWLALEIMNGGGGGHRARLPLSS* |
| Ga0070733_105108372 | 3300005541 | Surface Soil | MGLEPSDVLFISIVLWLIFEIINGDSGGGRRARVPVR* |
| Ga0070733_110753572 | 3300005541 | Surface Soil | MPLDPSDAVFLAIVIWLALEIMNGGGGGRRSRVPAAS* |
| Ga0070761_102887891 | 3300005591 | Soil | MVLEPSDVLFIAMVIWLAIEIINGGGGGRRSRLPAQVRA* |
| Ga0070740_100703352 | 3300005607 | Surface Soil | MGIEPSDVLFIAIIIWIVLEIINGDWGGGHRARVPEPAPAPTR* |
| Ga0068861_1011014621 | 3300005719 | Switchgrass Rhizosphere | MGLQPTDVLFIAIVVWIAIQIIDGDWGGGRRARQSAR* |
| Ga0075028_1003156352 | 3300006050 | Watersheds | MALEPGDVVFLAIVIWIAVQITSGGDGGRRRRVPVAL* |
| Ga0075029_10000030820 | 3300006052 | Watersheds | MGLQPSDVLFIAIVIWLAIEILNGGGGGRRRRLRVGAQ* |
| Ga0075029_1011060871 | 3300006052 | Watersheds | MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRLPLRAHS* |
| Ga0070765_1016977862 | 3300006176 | Soil | MFVLMALEPSDVLFIVMVIWLALEIIKGDGGGGHRKRIPVMG* |
| Ga0075021_100126545 | 3300006354 | Watersheds | MILEPSDVVFLALVIWLAVQITNGGDGGRRARLPVAI* |
| Ga0104322_1042472 | 3300007819 | Permafrost Soil | MALEPSDILFIAIVIWLAVEILSGGGGGRRSRLPAFAR* |
| Ga0099829_105880532 | 3300009038 | Vadose Zone Soil | MPLDPSDVVFLAIVIWLALEIMNGGGGGRRARLPVSS* |
| Ga0099830_106544601 | 3300009088 | Vadose Zone Soil | MGIEPSDVLFLIIILWIVVEIINNGDWGGGHRARVPAA* |
| Ga0099828_102906472 | 3300009089 | Vadose Zone Soil | MGIEPSDIVFIAIVIWLAFEIINGDSGGGRRARVPAK* |
| Ga0099827_106864142 | 3300009090 | Vadose Zone Soil | MGIEPSDIVFVAIVIWLAFEIINGDSGGGRRARVPAK* |
| Ga0105248_127914491 | 3300009177 | Switchgrass Rhizosphere | MGLQPSDVLFIAIVVWIAIQVIDGDWGGGRRARQSAR* |
| Ga0116129_100029314 | 3300009633 | Peatland | MGLQPSDVLFIAIVIWLAIQIIDGGGGGRRSRLPVRI* |
| Ga0126373_104964182 | 3300010048 | Tropical Forest Soil | MAIEPSDVLFIAIILWIILEIINGDWGGGHRARVPVR* |
| Ga0126381_1000176978 | 3300010376 | Tropical Forest Soil | MGLEPSDVLFIAIVIWLAIEIINGDWGGGKRSRVPAL* |
| Ga0136449_1007409982 | 3300010379 | Peatlands Soil | MELEPSDLLFIAIVIWLAIEIINGGGGGRRSRLPLRAHS* |
| Ga0136449_1041235332 | 3300010379 | Peatlands Soil | MGLEPSDVLFIAIVIWLAFEIINGGGGGHRSRVPAK* |
| Ga0134126_114777492 | 3300010396 | Terrestrial Soil | MGLDPSDVLFIAIVIWLILEIINGDWGGGHHARVPVR* |
| Ga0134121_102550802 | 3300010401 | Terrestrial Soil | MGLQPSDVLFIAIVVWIAIQINGDWGGGRRARQPIR* |
| Ga0134123_108992081 | 3300010403 | Terrestrial Soil | MGLQPSDVLFIAIVVWIVIQIINGDWGGGRRTRQPVR* |
| Ga0126350_123111561 | 3300010880 | Boreal Forest Soil | MVLEPSDVLFIAIVIWLAIQIINGDSGGGRRKRVPV |
| Ga0150983_144798601 | 3300011120 | Forest Soil | LEPSDVLFISIVLWLIFEIINGDSGGGRRARVPVR* |
| Ga0137393_106811953 | 3300011271 | Vadose Zone Soil | MGLDMVLNPGDVLFVAIVIWIAIQIIDGDSGGGRRARQPVRY* |
| Ga0137360_102061203 | 3300012361 | Vadose Zone Soil | MALEPSDFLFIAVVIWLAFEIINSDWGGGKRSRVPAQ* |
| Ga0137361_113723591 | 3300012362 | Vadose Zone Soil | MALEPSDFLFIAVVIWLAFEIINLDWGGGKRSRVPAQ* |
| Ga0137390_108883542 | 3300012363 | Vadose Zone Soil | YMGIEPSDVLFLIIILWIVVEIINNGDWGGGHRARVPAA* |
| Ga0137359_100493124 | 3300012923 | Vadose Zone Soil | MGLEPSDVLFIIILLWIVLEIINNGDWGGGHRARVPVT* |
| Ga0137404_122030472 | 3300012929 | Vadose Zone Soil | MRIEPSDVLFIAIVIWIAVQLINGDWGGGRRARQPIR* |
| Ga0181538_101178122 | 3300014162 | Bog | MGLEPSDVLFIAIVIWLAIEIINGGGGGHRSRVPAR* |
| Ga0181538_104063752 | 3300014162 | Bog | MGLEPSDVLFILIVIWLALEIINGDWGGGHTARVPAA* |
| Ga0157380_113976852 | 3300014326 | Switchgrass Rhizosphere | MGLQPSDVLFIAIVVWIAIQIINGDWGGGRRTRQPVR* |
| Ga0182018_104151622 | 3300014489 | Palsa | MGLEPSDVLFILIVIWLALEIINGDWGGGHRARVPAA* |
| Ga0182015_101642262 | 3300014495 | Palsa | MGLQPSDVLFIAIVIWLAIEIINGGGGGRRSRLPIRIH* |
| Ga0182012_101083042 | 3300014499 | Bog | MGLQPSDVLFIAIVIWLAIEILNGGGGGRRRRLRAGAL* |
| Ga0182024_100093836 | 3300014501 | Permafrost | MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRVPIRAQ* |
| Ga0182024_100430072 | 3300014501 | Permafrost | MVLEPSDVLFIAIVIWLAIEILNGGGGGRRSRLPLRTI* |
| Ga0182024_111665821 | 3300014501 | Permafrost | MGLEPSDVLFIVIVIWIALEIINGDWGGGHRGRVPV* |
| Ga0182024_117826501 | 3300014501 | Permafrost | MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRLRVPA* |
| Ga0182030_1000188330 | 3300014838 | Bog | MGIEPSDVLFIAIVIWLAIEIINGGGGGRRSRLPLRANS* |
| Ga0182030_100505666 | 3300014838 | Bog | MQMGLEPSDVLFIVIVIWLAIQITDGGSGGGRRRARVPAQ* |
| Ga0157379_106653401 | 3300014968 | Switchgrass Rhizosphere | MGLQPSDVLFIAIVVWIAIQIINGDWGGGRRTRQPIR* |
| Ga0181505_107365522 | 3300016750 | Peatland | MGLEPSDVLFILIVIWLALEIINGDWGGGHTARVPAA |
| Ga0187819_101518571 | 3300017943 | Freshwater Sediment | MGLEPSDILFIAIILWIILEIINGDWGGGHRSRVPAR |
| Ga0187847_106198021 | 3300017948 | Peatland | MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRLRVPA |
| Ga0187783_106367052 | 3300017970 | Tropical Peatland | KFRMTIQPSDVLLIAIVIWLVIEIISGGGGGRRSRLRIPA |
| Ga0187781_105822673 | 3300017972 | Tropical Peatland | MGPSDILFIAIILWLIVEIINGEGGGGHRARVPSR |
| Ga0187781_107719011 | 3300017972 | Tropical Peatland | MNLQPSDVVFIAIVIWMLLEIINGDGGGGRRARVPA |
| Ga0187782_101222062 | 3300017975 | Tropical Peatland | MGLQPSDVVFIAIVIWIAIEIINGDGGGGWRDRVPVH |
| Ga0187805_101290062 | 3300018007 | Freshwater Sediment | MGLQPSDILFIAIILWIILEIINGDWGGGHRSRVPAR |
| Ga0187860_10239356 | 3300018014 | Peatland | MGLEPSDVLFIAIVIWLAIEIINGGGGGHRSRVPAR |
| Ga0187769_103947742 | 3300018086 | Tropical Peatland | MGLQPSDVVFIAIVIWIAIEIINGDGGGGRRDRVPVH |
| Ga0187771_117398912 | 3300018088 | Tropical Peatland | MGLEPSDVVFIAIVIWLALEIINGDWGGGHRARVPAR |
| Ga0210407_100597284 | 3300020579 | Soil | MGLEPTDVLFIAIVIWLALEIINGDWGGWHRVRGPER |
| Ga0210403_100003663 | 3300020580 | Soil | MGLEPTDVLFIAIVIWLALEIINGDWGGGHRVRVPAR |
| Ga0210406_105294952 | 3300021168 | Soil | MGLEPSDIIFIAIVLWIVLEIINNDDWGSGHRARVPARS |
| Ga0210405_102664743 | 3300021171 | Soil | MGLEPSDVLFISIVLWLIFEIINGDSGGGRRARVPVR |
| Ga0210405_109227132 | 3300021171 | Soil | MPLDPSDVVFLAIVIWLALEIMNGGGGGRRARAPLSS |
| Ga0210388_1000000866 | 3300021181 | Soil | MGLEPSDVLFIAVVIWLAIEIINGGGGGRRSRLPILGH |
| Ga0210397_115480291 | 3300021403 | Soil | CCPAGISAILELHMGLEPSDVLFIAIVIWLAIEIINSGGGGRRSRLPLRAH |
| Ga0210387_106221761 | 3300021405 | Soil | MVLEPSDILFIAIVLWLALEILNGGGGGRRRSRLPLLSN |
| Ga0210394_104996652 | 3300021420 | Soil | MSIEPSDVLFIAIVIWLAIEIINGDWGGGKRSRVPAN |
| Ga0210384_106095542 | 3300021432 | Soil | MPIDPSDVVFLAIVIWLALEIMNGGGGGRRARVPASS |
| Ga0210384_114990912 | 3300021432 | Soil | MGLEPSDVLFIAVVIWIAVKIIDGDSGGGRRSRQPV |
| Ga0210392_114398991 | 3300021475 | Soil | YWKDLTMDLQPSDVLFIAIVIWIAVTLMNSDGGGGFRKRIPVPVR |
| Ga0208193_10007164 | 3300025463 | Peatland | MGLQPSDVLFIAIVIWLAIQIIDGGGGGRRSRLPVRI |
| Ga0207708_106266751 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLQPSDVLFIAIVVWIAIQIINGDWGGGRRTRQPIR |
| Ga0209131_10831862 | 3300026320 | Grasslands Soil | MQFDPSDVLFIAIVIWIAVQIINGDWGGGRRARQPIR |
| Ga0209581_1000006216 | 3300027706 | Surface Soil | MGVEPSDVLFIAIVVWIILEIINGDWGGGHRARVPARS |
| Ga0209581_10121313 | 3300027706 | Surface Soil | MGVEPSDVLFIAIIIWIVLEIINGDWGGGHRARVPARS |
| Ga0209581_11144601 | 3300027706 | Surface Soil | MGIEPSDVLFIAIIIWIVLEIINGDWGGGHRARVPEPAPAPTR |
| Ga0209139_101625412 | 3300027795 | Bog Forest Soil | MGLEPTDVLFIGIILWLIFEIINGDSGGGRRAPVPVR |
| Ga0209580_103092072 | 3300027842 | Surface Soil | MPLDPSDAVFLAIVIWLALEIMDGGGGGRRSRVPAAS |
| Ga0209167_101177942 | 3300027867 | Surface Soil | MPLDPSDVVFLAIVIWLALEIMNGGGGGHRARLPLSS |
| Ga0209167_105818102 | 3300027867 | Surface Soil | MQFDPSDILFIAIILWLILEIINGDWGGGHRARVPTN |
| Ga0209579_100054847 | 3300027869 | Surface Soil | MGLEPSDVLFIAIVLWLIFEIINGDWGGGRRARVPVF |
| Ga0209283_102960572 | 3300027875 | Vadose Zone Soil | MGIEPSDIVFIAIVIWLAFEIINGDSGGGRRARVPAK |
| Ga0209415_101517311 | 3300027905 | Peatlands Soil | MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRLPLRAHS |
| Ga0209583_102689952 | 3300027910 | Watersheds | MGLEPSDFVFIAIVIWLAFEIINGDSGGGRRARVPAQ |
| Ga0209698_1000164911 | 3300027911 | Watersheds | MGLQPSDVLFIAIVIWLAIEILNGGGGGRRRRLRVGAQ |
| Ga0209698_101067602 | 3300027911 | Watersheds | MGLEPSDVVFIAIVIWLAIEILNGNSGGGKRSRVPA |
| Ga0209062_1000021124 | 3300027965 | Surface Soil | MGLEPSDVLFIAIILWIILEIINGDWGGGHRARVPATTR |
| Ga0209168_101445591 | 3300027986 | Surface Soil | MGLEPSDVLFIAIIIWIVLEIIDDDWGGGHRARVPAH |
| Ga0302225_105030362 | 3300028780 | Palsa | MALEPTDVLFIGIVLWLIFEIINGDSGGGRRAPVPAR |
| Ga0307504_104247232 | 3300028792 | Soil | MPLDPSDAIFLAIVIWLALEIMDGGGGGRRARLPVSS |
| Ga0311361_102442313 | 3300029911 | Bog | MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRLPLRAH |
| Ga0311361_102991292 | 3300029911 | Bog | MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRLPIHAN |
| Ga0311339_101258373 | 3300029999 | Palsa | MGLEPSDVLFIAIVVWLAIEIINGGGGGRRSRLPLRVS |
| Ga0073994_116231342 | 3300030991 | Soil | MAIEPSDVLFITIVIWLAIEIINGGGGGRRSRVPLRAL |
| Ga0170822_168232322 | 3300031122 | Forest Soil | MPIDPSDVVFLAIVIWLALEIMNGGGGGRRARLPASS |
| Ga0170824_1015031522 | 3300031231 | Forest Soil | MGLQPSDVLFIAIVIWLAIEIINGGGGGRRSRIPLRAN |
| Ga0170824_1028960481 | 3300031231 | Forest Soil | AILEVPMGLQPSDILFIAIVIWLAIEILNGGGGGRRSRLPLRAYS |
| Ga0302325_104648033 | 3300031234 | Palsa | MALEPTDVLFIAIVIWLALEIINGGGGGRRSRLPVRA |
| Ga0302325_106253432 | 3300031234 | Palsa | MGLEPSDVLFILIVIWIALEIINGDWGGGHTARIPSA |
| Ga0302325_119078762 | 3300031234 | Palsa | MGLEPSDVVFIAIVIWLAIEIINGGGGGRRSRLRVPA |
| Ga0302325_122421972 | 3300031234 | Palsa | MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRARVHAH |
| Ga0302324_1028077851 | 3300031236 | Palsa | MVLEPSDVLFIAIVIWLAIEIINGGGGGRRSRARVHAH |
| Ga0265331_105288271 | 3300031250 | Rhizosphere | MGLEPSDVLFILIVIWIALDIINGDWGGGHRARVPAA |
| Ga0302326_101696461 | 3300031525 | Palsa | MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRLPLRALS |
| Ga0302326_106815702 | 3300031525 | Palsa | MQLEPSDVLFIAIVIWIAIVIINGDWGGGHRSRVPARI |
| Ga0302326_129313772 | 3300031525 | Palsa | ELGILDMGLEPSDVVFIAIVIWLAIEIINGGGGGRRSRLRVPA |
| Ga0310686_1000888851 | 3300031708 | Soil | MVLEPSDVLFIAMVIWLAIEIINGGGGGRRSRLPAQVYS |
| Ga0310686_10406685412 | 3300031708 | Soil | MGLEPSDILFIAIVLWLIIEIINGDWGGGHRSRVPAR |
| Ga0310686_1051346412 | 3300031708 | Soil | MSLEPSDVIFIAIVIWLAIEIINGGGGGRRSRVPVRA |
| Ga0310686_1082462452 | 3300031708 | Soil | MVLEPSDVLFIAIVIWLALEIINGGGGGRRSRLPVRAH |
| Ga0310686_1125183711 | 3300031708 | Soil | MGLQPSDVLFIAIVVWLAIEIINGGGGGRRSRLPIRIH |
| Ga0310686_1137848782 | 3300031708 | Soil | MALEPSDVLFLAIVIWLAIEITNGGSGGRRKRIPVPI |
| Ga0310686_1156741837 | 3300031708 | Soil | MALEPSDILFIAIVIWLILEIINSDGGGGHRARVPVR |
| Ga0310686_1164994288 | 3300031708 | Soil | MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRNRLPVGAH |
| Ga0307476_103013413 | 3300031715 | Hardwood Forest Soil | MGLEPSDVLFIAIVLWIIMEIINGDWGGGHRARVP |
| Ga0307476_111396952 | 3300031715 | Hardwood Forest Soil | MGLEPSDILFIAIVLWLILEIINSDGGGGHRARVPAR |
| Ga0307474_102627522 | 3300031718 | Hardwood Forest Soil | MGLEPSDVLFIAIVIWLAIEIINSGGGGRRSRLPIRVT |
| Ga0307474_104274912 | 3300031718 | Hardwood Forest Soil | MDLQPSDILFIAIVIWIAILLINGDPGGGHRSRVPAH |
| Ga0307474_107531262 | 3300031718 | Hardwood Forest Soil | MGLEPNDVLFIAMVIWIAVKIIDGDSGGGRRSRQPV |
| Ga0311301_1000216217 | 3300032160 | Peatlands Soil | MQLEPSDVVFIAIVIWLAIEIINGDWGGGFRSRVPVR |
| Ga0311301_104727632 | 3300032160 | Peatlands Soil | MELQPSDVLFIAFVIWLAFEAIGGSGGGGRRSRVPAAL |
| Ga0311301_126315802 | 3300032160 | Peatlands Soil | MELEPSDLLFIAIVIWLAIEIINGGGGGRRSRLPLRAHS |
| Ga0307472_1004572982 | 3300032205 | Hardwood Forest Soil | MPLDPSDVVFLAIVIWLALEIMDGGGGGRRSRVPASS |
| Ga0348332_147362532 | 3300032515 | Plant Litter | MVLEPSDVLFIAMVIWLAIEIINGGGGGRRSRLRIPAN |
| Ga0335085_106224932 | 3300032770 | Soil | MGLEPSDIVFIAIVIWLILEIINGDWGGGHRARVPAR |
| Ga0335079_112106043 | 3300032783 | Soil | MGLEPSDVLFIAIVLWLIFEIINGDWGGGRRARVPAF |
| Ga0335078_103799703 | 3300032805 | Soil | MGLDPSDILFIAIILWLIIEIINGDWGGGHRARVPAR |
| Ga0335070_10000011316 | 3300032829 | Soil | MLLEPSDVLFIAIVIWLAIEIINGGGGGRRRSRLPVQI |
| Ga0335081_103794912 | 3300032892 | Soil | MGLEPSDVLFIGIVLWLIFEIINGDSGGGRRARVPVR |
| Ga0335074_100523446 | 3300032895 | Soil | MGIDPTDILFIAIILWLILEIINGDWGGGHRARVPTR |
| Ga0335071_101808342 | 3300032897 | Soil | MGLEPSDVLFIAIVIWLAIEIISGGGGGRRSRLPLRANS |
| Ga0335083_107476392 | 3300032954 | Soil | MGLQPSDVLFIAIVLWLIFEIINGDWGGGRRARVPAF |
| Ga0326727_109084331 | 3300033405 | Peat Soil | MGLQPSDVLFIAIVIWLAIEILNGGGGGRRRRLRAGAQ |
| Ga0334790_030022_1941_2057 | 3300033887 | Soil | MGFEPSDVLFIAIVIWLAIEIINGGGGGRRSRLPLRAY |
| ⦗Top⦘ |