


| Basic Information | |
|---|---|
| Family ID | F053272 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 48 residues |
| Representative Sequence | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMS |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.42 % |
| % of genes near scaffold ends (potentially truncated) | 98.58 % |
| % of genes from short scaffolds (< 2000 bps) | 92.20 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.582 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.149 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.660 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.298 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF09650 | PHA_gran_rgn | 48.23 |
| PF12071 | DUF3551 | 26.95 |
| PF01609 | DDE_Tnp_1 | 1.42 |
| PF14659 | Phage_int_SAM_3 | 0.71 |
| PF00072 | Response_reg | 0.71 |
| PF13620 | CarboxypepD_reg | 0.71 |
| PF02545 | Maf | 0.71 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.42 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.42 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.42 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.42 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.42 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.42 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.58 % |
| Unclassified | root | N/A | 1.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZN2CUW02FZ1TH | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300000443|F12B_10502517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300000955|JGI1027J12803_108804935 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300003911|JGI25405J52794_10063579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 800 | Open in IMG/M |
| 3300004479|Ga0062595_102112441 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005148|Ga0066819_1027923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 505 | Open in IMG/M |
| 3300005181|Ga0066678_10116412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1636 | Open in IMG/M |
| 3300005181|Ga0066678_10855948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 597 | Open in IMG/M |
| 3300005187|Ga0066675_11319552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 531 | Open in IMG/M |
| 3300005332|Ga0066388_100351891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2119 | Open in IMG/M |
| 3300005332|Ga0066388_101169136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1311 | Open in IMG/M |
| 3300005332|Ga0066388_105968498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300005337|Ga0070682_101721959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300005363|Ga0008090_10180835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300005455|Ga0070663_100340562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1211 | Open in IMG/M |
| 3300005456|Ga0070678_101628088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300005467|Ga0070706_101013614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300005471|Ga0070698_102070654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300005555|Ga0066692_10945499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 528 | Open in IMG/M |
| 3300005713|Ga0066905_100345028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1187 | Open in IMG/M |
| 3300005713|Ga0066905_101802577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 564 | Open in IMG/M |
| 3300005764|Ga0066903_103187120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 887 | Open in IMG/M |
| 3300005764|Ga0066903_103599601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 834 | Open in IMG/M |
| 3300005842|Ga0068858_102308074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 532 | Open in IMG/M |
| 3300005937|Ga0081455_10176561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1621 | Open in IMG/M |
| 3300006028|Ga0070717_10533232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1062 | Open in IMG/M |
| 3300006028|Ga0070717_11175045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
| 3300006028|Ga0070717_12069313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 512 | Open in IMG/M |
| 3300006034|Ga0066656_10469153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 820 | Open in IMG/M |
| 3300006042|Ga0075368_10311579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 680 | Open in IMG/M |
| 3300006603|Ga0074064_11716220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 673 | Open in IMG/M |
| 3300006800|Ga0066660_11314754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300006953|Ga0074063_10038842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 645 | Open in IMG/M |
| 3300007255|Ga0099791_10377615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300009137|Ga0066709_104163360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 527 | Open in IMG/M |
| 3300009143|Ga0099792_10344031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 898 | Open in IMG/M |
| 3300009156|Ga0111538_12001790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 728 | Open in IMG/M |
| 3300009156|Ga0111538_13936739 | Not Available | 513 | Open in IMG/M |
| 3300009553|Ga0105249_13100581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300010046|Ga0126384_11566970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300010047|Ga0126382_10629869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 888 | Open in IMG/M |
| 3300010047|Ga0126382_10637580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 883 | Open in IMG/M |
| 3300010047|Ga0126382_12181555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300010359|Ga0126376_11305558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 746 | Open in IMG/M |
| 3300010359|Ga0126376_11885706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300010360|Ga0126372_12331264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 585 | Open in IMG/M |
| 3300010360|Ga0126372_12714984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 547 | Open in IMG/M |
| 3300010361|Ga0126378_10200404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2072 | Open in IMG/M |
| 3300010375|Ga0105239_10982701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 970 | Open in IMG/M |
| 3300010375|Ga0105239_12137585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300010376|Ga0126381_104929297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300010868|Ga0124844_1096343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1121 | Open in IMG/M |
| 3300011271|Ga0137393_10274641 | Not Available | 1433 | Open in IMG/M |
| 3300012202|Ga0137363_11239441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300012207|Ga0137381_11544092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300012212|Ga0150985_102350586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 555 | Open in IMG/M |
| 3300012350|Ga0137372_10298464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1250 | Open in IMG/M |
| 3300012353|Ga0137367_10062893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2769 | Open in IMG/M |
| 3300012358|Ga0137368_10289733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1112 | Open in IMG/M |
| 3300012362|Ga0137361_10258536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1587 | Open in IMG/M |
| 3300012362|Ga0137361_10597065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1012 | Open in IMG/M |
| 3300012582|Ga0137358_11118939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300012685|Ga0137397_10865539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300012918|Ga0137396_10224147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1385 | Open in IMG/M |
| 3300012929|Ga0137404_10102593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2311 | Open in IMG/M |
| 3300012930|Ga0137407_11832575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300012958|Ga0164299_10974625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300012987|Ga0164307_10323124 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300012987|Ga0164307_10385279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1028 | Open in IMG/M |
| 3300013306|Ga0163162_11293927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 828 | Open in IMG/M |
| 3300013308|Ga0157375_13819516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300014969|Ga0157376_11950654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 624 | Open in IMG/M |
| 3300015242|Ga0137412_10504476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 926 | Open in IMG/M |
| 3300015264|Ga0137403_10655751 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 912 | Open in IMG/M |
| 3300015373|Ga0132257_101951012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 756 | Open in IMG/M |
| 3300016341|Ga0182035_10424348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1122 | Open in IMG/M |
| 3300016387|Ga0182040_10529145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 946 | Open in IMG/M |
| 3300017965|Ga0190266_10407681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 757 | Open in IMG/M |
| 3300018072|Ga0184635_10344884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 573 | Open in IMG/M |
| 3300018076|Ga0184609_10352788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 686 | Open in IMG/M |
| 3300018082|Ga0184639_10212412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1026 | Open in IMG/M |
| 3300018429|Ga0190272_11426789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 698 | Open in IMG/M |
| 3300018433|Ga0066667_10197676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1474 | Open in IMG/M |
| 3300018469|Ga0190270_10906076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 900 | Open in IMG/M |
| 3300018476|Ga0190274_10694485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1061 | Open in IMG/M |
| 3300021478|Ga0210402_11568067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300021560|Ga0126371_12221759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300022694|Ga0222623_10024514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2269 | Open in IMG/M |
| 3300025922|Ga0207646_10670809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 928 | Open in IMG/M |
| 3300025925|Ga0207650_10412748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1119 | Open in IMG/M |
| 3300025931|Ga0207644_10196400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1589 | Open in IMG/M |
| 3300025960|Ga0207651_12032560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300025961|Ga0207712_10118815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1997 | Open in IMG/M |
| 3300026121|Ga0207683_10136625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2207 | Open in IMG/M |
| 3300027671|Ga0209588_1047544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1387 | Open in IMG/M |
| 3300027846|Ga0209180_10099838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1653 | Open in IMG/M |
| 3300027903|Ga0209488_10407988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1005 | Open in IMG/M |
| 3300028379|Ga0268266_10897529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 857 | Open in IMG/M |
| 3300028707|Ga0307291_1036556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1162 | Open in IMG/M |
| 3300028719|Ga0307301_10092170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 956 | Open in IMG/M |
| 3300028719|Ga0307301_10200107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 648 | Open in IMG/M |
| 3300028768|Ga0307280_10184864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 731 | Open in IMG/M |
| 3300028784|Ga0307282_10387239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300028796|Ga0307287_10202050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 754 | Open in IMG/M |
| 3300028824|Ga0307310_10351698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 724 | Open in IMG/M |
| 3300029636|Ga0222749_10367097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300031091|Ga0308201_10258174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 603 | Open in IMG/M |
| 3300031184|Ga0307499_10168439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 654 | Open in IMG/M |
| 3300031421|Ga0308194_10288730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 564 | Open in IMG/M |
| 3300031543|Ga0318516_10138168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1396 | Open in IMG/M |
| 3300031561|Ga0318528_10030115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2664 | Open in IMG/M |
| 3300031573|Ga0310915_10412243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 959 | Open in IMG/M |
| 3300031719|Ga0306917_10297686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1245 | Open in IMG/M |
| 3300031724|Ga0318500_10195220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 968 | Open in IMG/M |
| 3300031744|Ga0306918_10141316 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300031751|Ga0318494_10372302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 827 | Open in IMG/M |
| 3300031764|Ga0318535_10025806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2311 | Open in IMG/M |
| 3300031764|Ga0318535_10116805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1176 | Open in IMG/M |
| 3300031778|Ga0318498_10143704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1085 | Open in IMG/M |
| 3300031798|Ga0318523_10102408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1405 | Open in IMG/M |
| 3300031819|Ga0318568_10466530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300031833|Ga0310917_11082352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300031859|Ga0318527_10169612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 919 | Open in IMG/M |
| 3300031859|Ga0318527_10340040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300031893|Ga0318536_10083882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1582 | Open in IMG/M |
| 3300031912|Ga0306921_10918919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 992 | Open in IMG/M |
| 3300031912|Ga0306921_12118043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300031946|Ga0310910_10111749 | All Organisms → cellular organisms → Bacteria | 2044 | Open in IMG/M |
| 3300031947|Ga0310909_10183200 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300032035|Ga0310911_10289742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 941 | Open in IMG/M |
| 3300032035|Ga0310911_10505109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300032051|Ga0318532_10013188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2576 | Open in IMG/M |
| 3300032055|Ga0318575_10037788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2157 | Open in IMG/M |
| 3300032060|Ga0318505_10122831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1190 | Open in IMG/M |
| 3300032060|Ga0318505_10482089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300032063|Ga0318504_10234348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 862 | Open in IMG/M |
| 3300032091|Ga0318577_10109085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1300 | Open in IMG/M |
| 3300032180|Ga0307471_101170245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 934 | Open in IMG/M |
| 3300032261|Ga0306920_103028484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300033290|Ga0318519_10205275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1125 | Open in IMG/M |
| 3300033551|Ga0247830_10348998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1143 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.13% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.42% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.71% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.71% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005148 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_08493270 | 2170459003 | Grass Soil | VNKPSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRAVIGLA |
| F12B_105025172 | 3300000443 | Soil | VTKLSTPHSGPAQIGPAVLGASSFACADVLSKVVLLD |
| JGI1027J12803_1088049352 | 3300000955 | Soil | RLPQIGPALLGAFSFACADILTRVTFKAGADALTMSSARCVLGLAMLY |
| JGI25405J52794_100635791 | 3300003911 | Tabebuia Heterophylla Rhizosphere | VTKPSTSHSGPAQIGPAVLGASSFSCADVLGKVVLVQGADVLTMCAVRAVLGVAFLFGWL |
| Ga0062595_1021124411 | 3300004479 | Soil | VTQLDTQTAGSRLAMIGPALLGASSFACADVLAKITLKDGADVLTAATVRGFVGLALL |
| Ga0066819_10279231 | 3300005148 | Soil | VTSLTTSRAGSRLAQIGPALLGASSFACADVLGKVVLNDGADVLTMSAIRG |
| Ga0066678_101164124 | 3300005181 | Soil | VTKPSNSQAGSRLAQIGPALLGASSFACADVLSKVALNDGADALTISAVRAVL |
| Ga0066678_108559481 | 3300005181 | Soil | VTKPSTSQAGSRLTQIGPALLGASSFACADVLSKVALNDGADALTISAVRAVL |
| Ga0066675_113195521 | 3300005187 | Soil | VTKPSNSQAGSRLAQIGPALLGASSFACADVLSKVALNDGADALTISAVRAVLGLAMLFAWLRL |
| Ga0066388_1003518914 | 3300005332 | Tropical Forest Soil | VISPSTPPAGSRLAQIGPALLGASSFACADVLAKVPLRDGADVLTV |
| Ga0066388_1011691361 | 3300005332 | Tropical Forest Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMS |
| Ga0066388_1059684981 | 3300005332 | Tropical Forest Soil | VSKSSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADV |
| Ga0070682_1017219591 | 3300005337 | Corn Rhizosphere | VTSSPTPRAGSHLVQTGPALLGAASFACADVLAKVVLNDGADVLTLSAIRG |
| Ga0008090_101808352 | 3300005363 | Tropical Rainforest Soil | VTKLSIPQTGSGPAQIGPAVLGASSFACADVLSKVVLIEG |
| Ga0070663_1003405621 | 3300005455 | Corn Rhizosphere | VTSLTTPRAGSRLAQIGPALLGASSFACADVLGKVVLNDGADVLTMSAIRGALSIAILY |
| Ga0070678_1016280882 | 3300005456 | Miscanthus Rhizosphere | VTSLTTPRAGSRLAQIGPALLGASSFACADVLGKVVLNDGADVLTMSAI |
| Ga0070706_1010136142 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VNKLSPPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLT |
| Ga0070698_1020706541 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VNKLSPPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRA |
| Ga0066692_109454991 | 3300005555 | Soil | VTKPSNSQAGSRLAQIGPALLGACSFACADVLSKVALNDGADALTISVVR |
| Ga0066905_1003450281 | 3300005713 | Tropical Forest Soil | VTKSSTPQAGSRLAQIGPALLGASSFACADVLSKVALNAGADALTISVVRAV |
| Ga0066905_1018025771 | 3300005713 | Tropical Forest Soil | VNKLSTPHAGSRLAQIGPALLGASSFACADVSSKVVLIAGADVLTMSVVRAVLGVAMLFVWLRLAPPATA |
| Ga0066903_1031871201 | 3300005764 | Tropical Forest Soil | VNKLSPPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDG |
| Ga0066903_1035996011 | 3300005764 | Tropical Forest Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRAVLGLALLLG |
| Ga0068858_1023080741 | 3300005842 | Switchgrass Rhizosphere | VTSSPTPRAGSHLVQTGPALLGAASFACADVLAKVVLNDG |
| Ga0081455_101765611 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VNKPSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIEGADVLTMSAVRAVLGVAILL |
| Ga0070717_105332323 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VNKLSTPHVGSGPTQIGPAVLGASSFACADVLSKVVL |
| Ga0070717_111750451 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTKPSTPQAGSRLAQIGPALLGASSFACADVLSKVALNAGADALTISVVRAVLGLGM |
| Ga0070717_120693131 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VNKPSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRAVIGLAIL |
| Ga0066656_104691533 | 3300006034 | Soil | VTKPSTSQAGSRLTQIGPALLGASSFACADVLSKVALNDGADALTISAVRAVLGLAMLFAWLRL |
| Ga0075368_103115792 | 3300006042 | Populus Endosphere | VTSLTTPRAGSRLAQIGPALLGASSFACADVLGKVVL |
| Ga0074064_117162202 | 3300006603 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIEGADVLTMSAVRAVIG |
| Ga0066660_113147541 | 3300006800 | Soil | VTPLPTSHAGSRLVPIAPALLGASSFSAADVLSKITLNAGADALTVSAVRG |
| Ga0074063_100388421 | 3300006953 | Soil | VNKLSTPHVGKGPAQIGPAVLGASSFACADVLSKVVLIEGADVLTMSAVRAVIGLAILL |
| Ga0099791_103776151 | 3300007255 | Vadose Zone Soil | VTELSAPQAGSRLAQIGPALLGASSFACADVLAKVVLNAGTDVLTLSAIRGVLGLAI |
| Ga0066709_1041633601 | 3300009137 | Grasslands Soil | VTKPSNSQAGSRLAQIGPALLGASSFACADVLSKVALNDGADALTISAVRAVLGLAMLFAWLR |
| Ga0099792_103440313 | 3300009143 | Vadose Zone Soil | VISPTTPRAGLAQIGPALLGASSFACADVLAKVVLN |
| Ga0111538_120017902 | 3300009156 | Populus Rhizosphere | VTSLTTPRAGSRLAQIGPALLGASSFACADVLGKVVLNDGADVL |
| Ga0111538_139367391 | 3300009156 | Populus Rhizosphere | VTSPTTPRAGSRLAQIGPALLGASSFACADVLGKVVLNDGADVL |
| Ga0105249_131005811 | 3300009553 | Switchgrass Rhizosphere | VTKLSTPEAEFRLAQVGPAVLGASSFACADVLVKVVLIAGAGVLTMSAVRAVVGVAMLFVWLKLAPAAA |
| Ga0126384_115669701 | 3300010046 | Tropical Forest Soil | VSKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSA |
| Ga0126382_106298691 | 3300010047 | Tropical Forest Soil | VNKLSTPPAGSRLAQIGPALLGASSFACADVSSKVVLIAGADVLTMSVVRA |
| Ga0126382_106375801 | 3300010047 | Tropical Forest Soil | VNKLSTPHAGSRLAQIGPALLGASSFACADVSSKVVLIAGADVLTMSVVRAV |
| Ga0126382_121815551 | 3300010047 | Tropical Forest Soil | VNQLSTPHAGSRLAQIGPALLGASSFACADVSSKVVLIAGADVLTMSVV |
| Ga0126376_113055583 | 3300010359 | Tropical Forest Soil | VISPSTPQAGSRLAQIGPALLGASSFDCADVLSKVVLIDGADVLTMS |
| Ga0126376_118857062 | 3300010359 | Tropical Forest Soil | VNKLSTPHAGSRLAQIGPALLGASSFACADVSSKIVLIAGADVLTMSVV |
| Ga0126372_123312641 | 3300010360 | Tropical Forest Soil | VTQQPIPPAGLAPLGPVLLGASSFACADVLGKVVLNAGADVLTMSVARGGLGLAL |
| Ga0126372_127149842 | 3300010360 | Tropical Forest Soil | VSQLSTQHAASRLAMIGPVLLGATSFACADVLSKAVLKAGADVLTMSAV |
| Ga0126378_102004045 | 3300010361 | Tropical Forest Soil | VSKLSTPHAGSRLAQIGPALLGASSFACADVSSKVVLIAGADVLTMSVVRAVVGLAMLFAWLRL |
| Ga0105239_109827011 | 3300010375 | Corn Rhizosphere | VTKLSTPEADFRLAQVGPAVLGASSFACADVLVKVVLIAGAGVL |
| Ga0105239_121375851 | 3300010375 | Corn Rhizosphere | VTSLTTPRAGSRLAQIGPALLGASSFACADVLGKVVLNDGADVLTMSAIRG |
| Ga0126381_1049292971 | 3300010376 | Tropical Forest Soil | LTQLSTPHAGSRLAQIGPALLGASSFACADVLSKVVLIDGADVLTMS |
| Ga0124844_10963433 | 3300010868 | Tropical Forest Soil | VSKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLVDG |
| Ga0137393_102746412 | 3300011271 | Vadose Zone Soil | VRLLRTLRFNVTQLDTQTAGSRLAMIGPALLGASSFACADVLAKITLKDGADVLTVATVR |
| Ga0137363_112394411 | 3300012202 | Vadose Zone Soil | VNKLSPPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTM |
| Ga0137381_115440922 | 3300012207 | Vadose Zone Soil | VNKPSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLI |
| Ga0150985_1023505861 | 3300012212 | Avena Fatua Rhizosphere | VTSLTTPRAGSRLAQIGPALLGASSFACADVLGKVVLNDGADVLTMSAIRGVLSIA |
| Ga0137372_102984642 | 3300012350 | Vadose Zone Soil | VNKHSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRAVLGVA |
| Ga0137367_100628931 | 3300012353 | Vadose Zone Soil | VNKHSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRAV |
| Ga0137368_102897331 | 3300012358 | Vadose Zone Soil | VNKHSTPHVDSGPAQIGPAVLGASSFACADVLSKVVLIDGADVL |
| Ga0137361_102585364 | 3300012362 | Vadose Zone Soil | VNKLSPPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRAV |
| Ga0137361_105970651 | 3300012362 | Vadose Zone Soil | VTHPNSPHAGSRLAQIGPALLGASSFACADVSSKVVLIAGADVLTMS |
| Ga0137358_111189391 | 3300012582 | Vadose Zone Soil | VTKLSTSEADFRLAQIGPALLGASSFACADVLVKVVLIAGAGVLTMSAIRAVVGVA |
| Ga0137397_108655392 | 3300012685 | Vadose Zone Soil | VTQLSTPQAGSRLPQIGPALLGASSFACADVVSKVA |
| Ga0137396_102241471 | 3300012918 | Vadose Zone Soil | VNKLSPPHVGSGPAQIGPAVLGASSFACADVLSKVVL |
| Ga0137404_101025935 | 3300012929 | Vadose Zone Soil | VTKLSTSHDGPAQIGPAVLGASSFACADVLSKVVLI |
| Ga0137407_118325751 | 3300012930 | Vadose Zone Soil | VTQLSTPQAGSRLPQIGPALLGASSFACADVVSKVALTDGADVLTISTVRAVIG |
| Ga0164299_109746251 | 3300012958 | Soil | VTKLSTPEAEFRLAQVGPAVLCASSFACADVLVKVVLIAGAGVLTMSAV |
| Ga0164307_103231243 | 3300012987 | Soil | VTSPPTPRAGSHLVQTGPALLGAASFACADVLAKVVLNDGADVLTLSA |
| Ga0164307_103852791 | 3300012987 | Soil | VTKLSTSEADFRLAQIGPALLGASSFACADVLVKVVLIAGAGVLTMSSI |
| Ga0163162_112939271 | 3300013306 | Switchgrass Rhizosphere | VTKLSTPEADFRLAQVGPAVLGASSFACADVLVNVVLIAGAGVLTMSAVRAVVGVAMLF |
| Ga0157375_138195161 | 3300013308 | Miscanthus Rhizosphere | VTSLTPPRAGSRLAQIGPALLGASSFACADVLGKVVLNDGADVLTMSAI |
| Ga0157376_119506542 | 3300014969 | Miscanthus Rhizosphere | VTSSPTPRAGSHLVQTGPALLGAASFACADVLAKVVLND |
| Ga0137412_105044761 | 3300015242 | Vadose Zone Soil | VISPTTPRAGLAQIGPALLGASSFACADVLAKVVLNAGADVLTLSAIRGV |
| Ga0137403_106557511 | 3300015264 | Vadose Zone Soil | VNKPSTPHVGSGPAQIGPAVLGASSFACADVLSKVALIDGADVLT |
| Ga0132257_1019510122 | 3300015373 | Arabidopsis Rhizosphere | VTSLTPPRAGSRLAQIGPALLGASSFACADVPGKVVLNDGADVLTM* |
| Ga0182035_104243481 | 3300016341 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTM |
| Ga0182040_105291451 | 3300016387 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLVDGADVLTMSAVRAVLGLAI |
| Ga0190266_104076813 | 3300017965 | Soil | VTSLTTSRAGSRLAQIGPALLGASSFACADVLAKVVLNAGADVLTLSAIR |
| Ga0184635_103448841 | 3300018072 | Groundwater Sediment | VTSLTSPRAGSRLAQIGPALLGATSFACADVVGKVV |
| Ga0184609_103527881 | 3300018076 | Groundwater Sediment | VISPTTPRAGLAQIGPALLGASSFACADVLAKVVLNAGADVLTLSAIRGVLGLAIL |
| Ga0184639_102124121 | 3300018082 | Groundwater Sediment | VTSPTTPRAGLAQIGPALLGASSFACADVLAKVVLNAGADVLTLSAIRGVL |
| Ga0190272_114267892 | 3300018429 | Soil | VTSLTTPRAGSRLVQIGPALLGASSFACADVLGKVVLNDG |
| Ga0066667_101976761 | 3300018433 | Grasslands Soil | VNKLSPPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRAVIGLAILLG |
| Ga0190270_109060762 | 3300018469 | Soil | VTSLTTSRAGSRLAQIGPALLGASSFACADVLGKVVLND |
| Ga0190274_106944851 | 3300018476 | Soil | VTSLTTPRAGSRLAQIGPALLGASSFACADVLGKVVLND |
| Ga0210402_115680671 | 3300021478 | Soil | VTKLSTPEAEFRLAQVGPAVLGASSFACADVLVKVVLIAGAGVLTMSAVRAVVGVAMLF |
| Ga0126371_122217591 | 3300021560 | Tropical Forest Soil | VTKLSIPQTGSGPAQIGPAVLGASSFACADVLSKVVLIEGADVLTM |
| Ga0222623_100245141 | 3300022694 | Groundwater Sediment | VISPTTPRAGLAQIGPALLGASSFACADVLAKVVLNAGADVLTLSAIRGMLGLAI |
| Ga0207646_106708093 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VNKLSPPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMS |
| Ga0207650_104127481 | 3300025925 | Switchgrass Rhizosphere | VTSLTTPRAGSRLAQIGPALLGASSFACADVLGKVVLNDGADVLTMSAIRGALSIV |
| Ga0207644_101964003 | 3300025931 | Switchgrass Rhizosphere | VTSLTTPRAGSRLAQIGPALLGASSFACADVLGKV |
| Ga0207651_120325602 | 3300025960 | Switchgrass Rhizosphere | VTSPPTPRAGSHLVQTGPALLGAASFACADVLAKVVLNDGADVLT |
| Ga0207712_101188153 | 3300025961 | Switchgrass Rhizosphere | VTSLTTPRAGSRLAQIGPALLGASSFACADVLGKVVLNDGADVLTMSAIRGVLSIAIL |
| Ga0207683_101366251 | 3300026121 | Miscanthus Rhizosphere | VTSLTTPRAGSRLAQIGPALLGASSFACADVLGKVVLNDGADVLTMSAIR |
| Ga0209588_10475441 | 3300027671 | Vadose Zone Soil | VNKLSPPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSA |
| Ga0209180_100998381 | 3300027846 | Vadose Zone Soil | VNKLSPPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDTSAQANEE |
| Ga0209488_104079881 | 3300027903 | Vadose Zone Soil | VISPTTPRAGLAQIGPALLGASSFACADVLAKVVLNAGADVLTLS |
| Ga0268266_108975291 | 3300028379 | Switchgrass Rhizosphere | VTSLTTPRAGSRLAQIGPALLGAYSFACADVLGKVVLND |
| Ga0307291_10365561 | 3300028707 | Soil | VISPTTPRAGLAQIGPALLGASSFACADVLAKVVLNAGADV |
| Ga0307301_100921703 | 3300028719 | Soil | VTSPTTPRAGLAQIGPALLGASSFACADVLAKVVLNAGADVLTLSAI |
| Ga0307301_102001071 | 3300028719 | Soil | VISPTTPRAGLAQIGPALLGASSFACADVLAKVVLNA |
| Ga0307280_101848641 | 3300028768 | Soil | VTSPTTPRAGLAQIGPALLGASSFACADVLAKVVLNAGA |
| Ga0307282_103872391 | 3300028784 | Soil | VTKLSTSEADFRLAQIGPALLGASSFACADVLVKVVLIA |
| Ga0307287_102020501 | 3300028796 | Soil | VTSPTTPRAGLAQIGPALLGASSFACADVLAKVVLNAGADVLTLSA |
| Ga0307310_103516982 | 3300028824 | Soil | VISPTTPRAGLAQIGPALLGASSFACADVLAKVVLNAGADVLTLSAIRGVLGLA |
| Ga0222749_103670971 | 3300029636 | Soil | VNKLSTPHVGKGPAQIGPAVLGASSFACADVLSKVVLIEGADV |
| Ga0308201_102581742 | 3300031091 | Soil | VTSLTTPRAGSRLAQIGPALLGASSFACADVLGKVVLNDGADVLTMSAIRGALSI |
| Ga0307499_101684391 | 3300031184 | Soil | VTSLTTPRAGSRLAQIGPALLGATSFACADVVGKVVLNDGAD |
| Ga0308194_102887302 | 3300031421 | Soil | VISRTTPGAGLAQIGPALLGASSFACADVLAKVVLNAGADAL |
| Ga0318516_101381681 | 3300031543 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVL |
| Ga0318528_100301151 | 3300031561 | Soil | VSKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMS |
| Ga0310915_104122431 | 3300031573 | Soil | VSKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVL |
| Ga0306917_102976861 | 3300031719 | Soil | VSKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRAVLGLAI |
| Ga0318500_101952202 | 3300031724 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRAVIGLAI |
| Ga0306918_101413164 | 3300031744 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRAVIGLAILF |
| Ga0318494_103723021 | 3300031751 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVV |
| Ga0318535_100258065 | 3300031764 | Soil | VSKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVR |
| Ga0318535_101168053 | 3300031764 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLVDGADVLTMSAVRAVLGLAILLG |
| Ga0318498_101437043 | 3300031778 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLVDGADVLTMS |
| Ga0318523_101024083 | 3300031798 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLLDGADVLTMSAVRAV |
| Ga0318568_104665301 | 3300031819 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRAVIGLAILFG |
| Ga0310917_110823521 | 3300031833 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRAVIG |
| Ga0318527_101696123 | 3300031859 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKV |
| Ga0318527_103400401 | 3300031859 | Soil | VSKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLT |
| Ga0318536_100838822 | 3300031893 | Soil | VSKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAV |
| Ga0306921_109189193 | 3300031912 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLI |
| Ga0306921_121180432 | 3300031912 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRAVI |
| Ga0310910_101117491 | 3300031946 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLT |
| Ga0310909_101832001 | 3300031947 | Soil | VSKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLSMS |
| Ga0310911_102897421 | 3300032035 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLVDGADVLTMSAVRAVLGLAIL |
| Ga0310911_105051092 | 3300032035 | Soil | VTKRSIPQTGSGPAQIGPAVLGASSFACADVLSKVV |
| Ga0318532_100131886 | 3300032051 | Soil | VSKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVL |
| Ga0318575_100377886 | 3300032055 | Soil | MLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAVRAVIGLAILFG |
| Ga0318505_101228312 | 3300032060 | Soil | VSKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLI |
| Ga0318505_104820892 | 3300032060 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLVDGADVLTM |
| Ga0318504_102343481 | 3300032063 | Soil | VTKRSIPQTGSGPAQIGPAVLGASSFACADVLSKVVLIEGADVLTMSAVRAVLG |
| Ga0318577_101090852 | 3300032091 | Soil | VSKLSTPHVGSGPAQIGPAVLGASSFACADVLSKV |
| Ga0307471_1011702451 | 3300032180 | Hardwood Forest Soil | VNKLSPPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGADVLTMSAV |
| Ga0306920_1030284841 | 3300032261 | Soil | VSKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLIDGAD |
| Ga0318519_102052751 | 3300033290 | Soil | VNKLSTPHVGSGPAQIGPAVLGASSFACADVLSKVVLVDGADVLTMSAVRAV |
| Ga0247830_103489981 | 3300033551 | Soil | VTSLTTSRAGSRLAQIGPALLGASSFACADVLGKVVLNDGADVLTMSA |
| ⦗Top⦘ |