


| Basic Information | |
|---|---|
| Family ID | F053156 |
| Family Type | Metagenome |
| Number of Sequences | 141 |
| Average Sequence Length | 45 residues |
| Representative Sequence | AIAVIAGSAFFIFARMPKDAGAELARRSPAPAAGPTEATDQKLS |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.29 % |
| % of genes from short scaffolds (< 2000 bps) | 90.78 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.064 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.241 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.787 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.589 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF01728 | FtsJ | 68.09 |
| PF02541 | Ppx-GppA | 12.06 |
| PF00456 | Transketolase_N | 1.42 |
| PF01315 | Ald_Xan_dh_C | 1.42 |
| PF09084 | NMT1 | 0.71 |
| PF13586 | DDE_Tnp_1_2 | 0.71 |
| PF01594 | AI-2E_transport | 0.71 |
| PF13458 | Peripla_BP_6 | 0.71 |
| PF00561 | Abhydrolase_1 | 0.71 |
| PF13193 | AMP-binding_C | 0.71 |
| PF00528 | BPD_transp_1 | 0.71 |
| PF10026 | DUF2268 | 0.71 |
| PF02738 | MoCoBD_1 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 68.09 |
| COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 68.09 |
| COG0248 | Exopolyphosphatase/pppGpp-phosphohydrolase | Signal transduction mechanisms [T] | 24.11 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 1.42 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 1.42 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.71 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.71 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.06 % |
| Unclassified | root | N/A | 48.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZN2CUW02HKB0Z | Not Available | 516 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1035530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 783 | Open in IMG/M |
| 3300001978|JGI24747J21853_1040496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Salinarimonadaceae → Salinarimonas → Salinarimonas rosea | 552 | Open in IMG/M |
| 3300004156|Ga0062589_101295518 | Not Available | 704 | Open in IMG/M |
| 3300004463|Ga0063356_104112832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 626 | Open in IMG/M |
| 3300004633|Ga0066395_10164138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1136 | Open in IMG/M |
| 3300005186|Ga0066676_11060530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 536 | Open in IMG/M |
| 3300005327|Ga0070658_11635651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 558 | Open in IMG/M |
| 3300005328|Ga0070676_10177652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1382 | Open in IMG/M |
| 3300005330|Ga0070690_100812944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 726 | Open in IMG/M |
| 3300005332|Ga0066388_100025620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5358 | Open in IMG/M |
| 3300005344|Ga0070661_100063326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2716 | Open in IMG/M |
| 3300005446|Ga0066686_10236435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1231 | Open in IMG/M |
| 3300005467|Ga0070706_101356152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 651 | Open in IMG/M |
| 3300005468|Ga0070707_101455388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300005543|Ga0070672_101574350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 589 | Open in IMG/M |
| 3300005546|Ga0070696_100190070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1528 | Open in IMG/M |
| 3300005548|Ga0070665_102065843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300005549|Ga0070704_102012714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 536 | Open in IMG/M |
| 3300005764|Ga0066903_100670349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1819 | Open in IMG/M |
| 3300006038|Ga0075365_10383542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 991 | Open in IMG/M |
| 3300006797|Ga0066659_10814289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 774 | Open in IMG/M |
| 3300006797|Ga0066659_10830464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 767 | Open in IMG/M |
| 3300006797|Ga0066659_11619647 | Not Available | 544 | Open in IMG/M |
| 3300006844|Ga0075428_102371358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 545 | Open in IMG/M |
| 3300006845|Ga0075421_102246040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300006852|Ga0075433_10763211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 846 | Open in IMG/M |
| 3300006854|Ga0075425_100661611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1200 | Open in IMG/M |
| 3300009012|Ga0066710_100152712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3214 | Open in IMG/M |
| 3300009174|Ga0105241_12421008 | Not Available | 524 | Open in IMG/M |
| 3300009792|Ga0126374_10414443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 946 | Open in IMG/M |
| 3300010044|Ga0126310_10437561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 941 | Open in IMG/M |
| 3300010159|Ga0099796_10217463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300010303|Ga0134082_10056411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1513 | Open in IMG/M |
| 3300010366|Ga0126379_13430355 | Not Available | 531 | Open in IMG/M |
| 3300010400|Ga0134122_12025510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 615 | Open in IMG/M |
| 3300010401|Ga0134121_13095648 | Not Available | 513 | Open in IMG/M |
| 3300011271|Ga0137393_11108804 | Not Available | 673 | Open in IMG/M |
| 3300012096|Ga0137389_10354890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1248 | Open in IMG/M |
| 3300012199|Ga0137383_10326682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1123 | Open in IMG/M |
| 3300012358|Ga0137368_10868381 | Not Available | 552 | Open in IMG/M |
| 3300012892|Ga0157294_10127111 | Not Available | 685 | Open in IMG/M |
| 3300012930|Ga0137407_11656701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 609 | Open in IMG/M |
| 3300012948|Ga0126375_10000850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 9133 | Open in IMG/M |
| 3300012955|Ga0164298_10028376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2485 | Open in IMG/M |
| 3300012960|Ga0164301_10043098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2264 | Open in IMG/M |
| 3300012971|Ga0126369_11114024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 878 | Open in IMG/M |
| 3300012971|Ga0126369_13513763 | Not Available | 513 | Open in IMG/M |
| 3300012985|Ga0164308_10317345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1245 | Open in IMG/M |
| 3300014968|Ga0157379_11965064 | Not Available | 577 | Open in IMG/M |
| 3300015077|Ga0173483_10354966 | Not Available | 737 | Open in IMG/M |
| 3300015371|Ga0132258_13345801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1102 | Open in IMG/M |
| 3300015373|Ga0132257_102667863 | Not Available | 650 | Open in IMG/M |
| 3300015374|Ga0132255_105227928 | Not Available | 549 | Open in IMG/M |
| 3300016387|Ga0182040_10719311 | Not Available | 817 | Open in IMG/M |
| 3300016404|Ga0182037_10268770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1357 | Open in IMG/M |
| 3300016422|Ga0182039_11784402 | Not Available | 564 | Open in IMG/M |
| 3300016445|Ga0182038_11625374 | Not Available | 581 | Open in IMG/M |
| 3300018074|Ga0184640_10347618 | Not Available | 672 | Open in IMG/M |
| 3300018076|Ga0184609_10120542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1192 | Open in IMG/M |
| 3300018082|Ga0184639_10582061 | Not Available | 551 | Open in IMG/M |
| 3300018476|Ga0190274_11376575 | Not Available | 794 | Open in IMG/M |
| 3300018920|Ga0190273_12057347 | Not Available | 531 | Open in IMG/M |
| 3300019996|Ga0193693_1050535 | Not Available | 667 | Open in IMG/M |
| 3300021086|Ga0179596_10207808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 955 | Open in IMG/M |
| 3300021178|Ga0210408_10042976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3541 | Open in IMG/M |
| 3300021478|Ga0210402_10789333 | Not Available | 875 | Open in IMG/M |
| 3300021559|Ga0210409_10915849 | Not Available | 751 | Open in IMG/M |
| 3300025910|Ga0207684_11445418 | Not Available | 561 | Open in IMG/M |
| 3300025921|Ga0207652_10573197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1013 | Open in IMG/M |
| 3300025923|Ga0207681_11173045 | Not Available | 645 | Open in IMG/M |
| 3300025926|Ga0207659_11059320 | Not Available | 698 | Open in IMG/M |
| 3300025928|Ga0207700_11797695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300025931|Ga0207644_11682223 | Not Available | 532 | Open in IMG/M |
| 3300025932|Ga0207690_11021603 | Not Available | 688 | Open in IMG/M |
| 3300026330|Ga0209473_1100599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1207 | Open in IMG/M |
| 3300026498|Ga0257156_1025466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1187 | Open in IMG/M |
| 3300026528|Ga0209378_1043183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2254 | Open in IMG/M |
| 3300026557|Ga0179587_10172467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1358 | Open in IMG/M |
| 3300026869|Ga0207821_1005379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1407 | Open in IMG/M |
| 3300027874|Ga0209465_10639007 | Not Available | 525 | Open in IMG/M |
| 3300027909|Ga0209382_11641484 | Not Available | 634 | Open in IMG/M |
| 3300027909|Ga0209382_12338940 | Not Available | 501 | Open in IMG/M |
| 3300028708|Ga0307295_10050833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1070 | Open in IMG/M |
| 3300028714|Ga0307309_10046659 | Not Available | 932 | Open in IMG/M |
| 3300028717|Ga0307298_10158765 | Not Available | 658 | Open in IMG/M |
| 3300028722|Ga0307319_10316469 | Not Available | 517 | Open in IMG/M |
| 3300028744|Ga0307318_10281598 | Not Available | 581 | Open in IMG/M |
| 3300028793|Ga0307299_10114322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1011 | Open in IMG/M |
| 3300028793|Ga0307299_10285291 | Not Available | 620 | Open in IMG/M |
| 3300028814|Ga0307302_10149858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1129 | Open in IMG/M |
| 3300028885|Ga0307304_10017568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2368 | Open in IMG/M |
| 3300028889|Ga0247827_10507860 | Not Available | 755 | Open in IMG/M |
| 3300031200|Ga0307496_10016114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1030 | Open in IMG/M |
| 3300031226|Ga0307497_10003395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4141 | Open in IMG/M |
| 3300031232|Ga0302323_103112176 | Not Available | 529 | Open in IMG/M |
| 3300031446|Ga0170820_10978695 | Not Available | 582 | Open in IMG/M |
| 3300031455|Ga0307505_10526531 | Not Available | 571 | Open in IMG/M |
| 3300031543|Ga0318516_10510368 | Not Available | 689 | Open in IMG/M |
| 3300031640|Ga0318555_10804895 | Not Available | 507 | Open in IMG/M |
| 3300031681|Ga0318572_10548213 | Not Available | 689 | Open in IMG/M |
| 3300031681|Ga0318572_10800518 | Not Available | 560 | Open in IMG/M |
| 3300031719|Ga0306917_10653749 | Not Available | 826 | Open in IMG/M |
| 3300031719|Ga0306917_10995671 | Not Available | 654 | Open in IMG/M |
| 3300031747|Ga0318502_10288361 | Not Available | 963 | Open in IMG/M |
| 3300031751|Ga0318494_10347866 | Not Available | 857 | Open in IMG/M |
| 3300031763|Ga0318537_10192700 | Not Available | 758 | Open in IMG/M |
| 3300031768|Ga0318509_10709931 | Not Available | 558 | Open in IMG/M |
| 3300031770|Ga0318521_10526910 | Not Available | 711 | Open in IMG/M |
| 3300031771|Ga0318546_10260667 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300031778|Ga0318498_10205164 | Not Available | 893 | Open in IMG/M |
| 3300031781|Ga0318547_10116643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1543 | Open in IMG/M |
| 3300031782|Ga0318552_10027536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2579 | Open in IMG/M |
| 3300031819|Ga0318568_10771748 | Not Available | 597 | Open in IMG/M |
| 3300031820|Ga0307473_11495209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300031821|Ga0318567_10399607 | Not Available | 779 | Open in IMG/M |
| 3300031835|Ga0318517_10117537 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300031846|Ga0318512_10065406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1651 | Open in IMG/M |
| 3300031846|Ga0318512_10270651 | Not Available | 841 | Open in IMG/M |
| 3300031854|Ga0310904_10095366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1620 | Open in IMG/M |
| 3300031893|Ga0318536_10090570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1524 | Open in IMG/M |
| 3300031893|Ga0318536_10596470 | Not Available | 552 | Open in IMG/M |
| 3300031894|Ga0318522_10244919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 679 | Open in IMG/M |
| 3300031910|Ga0306923_12153865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 561 | Open in IMG/M |
| 3300031941|Ga0310912_10471289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 979 | Open in IMG/M |
| 3300031945|Ga0310913_10406906 | Not Available | 965 | Open in IMG/M |
| 3300031981|Ga0318531_10012617 | All Organisms → cellular organisms → Bacteria | 3216 | Open in IMG/M |
| 3300031981|Ga0318531_10512019 | Not Available | 543 | Open in IMG/M |
| 3300032001|Ga0306922_10916118 | Not Available | 909 | Open in IMG/M |
| 3300032010|Ga0318569_10227061 | Not Available | 866 | Open in IMG/M |
| 3300032010|Ga0318569_10550075 | Not Available | 537 | Open in IMG/M |
| 3300032039|Ga0318559_10487011 | Not Available | 575 | Open in IMG/M |
| 3300032043|Ga0318556_10721981 | Not Available | 518 | Open in IMG/M |
| 3300032052|Ga0318506_10237280 | Not Available | 807 | Open in IMG/M |
| 3300032065|Ga0318513_10212690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 933 | Open in IMG/M |
| 3300032180|Ga0307471_101869825 | Not Available | 750 | Open in IMG/M |
| 3300032261|Ga0306920_103992231 | Not Available | 536 | Open in IMG/M |
| 3300033289|Ga0310914_10008867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 7359 | Open in IMG/M |
| 3300033290|Ga0318519_10730811 | Not Available | 606 | Open in IMG/M |
| 3300033433|Ga0326726_11325929 | Not Available | 700 | Open in IMG/M |
| 3300033551|Ga0247830_10476040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 980 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.26% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.13% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.13% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.13% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.13% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.42% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.71% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.71% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.71% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.71% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.71% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_05619540 | 2170459003 | Grass Soil | AACACFVFARMPADAGAELARRSAAPAAGPTEATDQRMG |
| AP72_2010_repI_A001DRAFT_10355302 | 3300000893 | Forest Soil | PAYLTIAVIAGSACFVFARMPADAGAELARRSTAPSAGATEATDQRMG* |
| JGI24747J21853_10404962 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | GQSTITAAADFQPAFIAIAVIAGSAFFIFARMPKDAGAELARRSPAPAAGPTEATDQKLS |
| Ga0062589_1012955181 | 3300004156 | Soil | AIAVIAGSAFVVFARMPADAGAELARRAPAPPAAGPTEATDQKLS* |
| Ga0063356_1041128322 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PAFIAIALISACAFFVFVRLPADAGAELARRHPGPTPSPTEATDQKLGV* |
| Ga0066395_101641381 | 3300004633 | Tropical Forest Soil | IAVIAGCASFIFARMPADAGAELARRSTAPAAGATEATDQRMG* |
| Ga0066676_110605301 | 3300005186 | Soil | VITAADFQPAYIAIAVIAGCSFFVFMQMPADAGADLARRTPAPVVGPTEAADQKLG* |
| Ga0070658_116356512 | 3300005327 | Corn Rhizosphere | FIAIAVIAGSAFFVFVRMPSDAGAELARRSPAPAAGPTESTDQKLS* |
| Ga0070676_101776521 | 3300005328 | Miscanthus Rhizosphere | ITAAADFQPAFIAIAVIAGSAFFIFVRMPKDAGAELARRSPAPAAGPTEASDQKLS* |
| Ga0070690_1008129441 | 3300005330 | Switchgrass Rhizosphere | AAADFQPAFIAIAVIAGSAFFIFVRMPKDAGAELARRSPAPAAGPTEATDQKLS* |
| Ga0066388_1000256208 | 3300005332 | Tropical Forest Soil | AVDFQPAYLAIAVIAGSASLIFARMPAEAGAELARRTTAPAAGPTEATDQRMG* |
| Ga0070661_1000633264 | 3300005344 | Corn Rhizosphere | ITAAADFQPAFIAIAVIAGSAFFIFARMPKDAGAELARRSPAPAAGPTEATDQKLS* |
| Ga0066686_102364353 | 3300005446 | Soil | TVAVIAGCAFFVFARLPADAGAELARRTTAPAAGPTEASDQRMG* |
| Ga0070706_1013561522 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AGCACFVFARMPADAGAELARRSAAPAASPTEATDQRMG* |
| Ga0070707_1014553882 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | IAGSAFFIFARMPKDAGAELARRSPAPAAGPTEATDQKLS* |
| Ga0070672_1015743501 | 3300005543 | Miscanthus Rhizosphere | FQPAFVAIAVIAGSAFIVFARMPADAGAELARRAPAPPAAGPTEATDQKLS* |
| Ga0070696_1001900701 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | AAIAGSASLVFARLPADAGAELARRTTAPAAGPTEASDQRMG* |
| Ga0070665_1020658431 | 3300005548 | Switchgrass Rhizosphere | VARGQSAITAAADFQPAFIAIAVIAGSAFFVFVRMPSDAGAELARRSPAPAAGPTESTDQKLS* |
| Ga0070704_1020127142 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | IAVIAGCACFVFARMPADAGAELARRSAAPAASPTEATDQRMG* |
| Ga0066903_1006703493 | 3300005764 | Tropical Forest Soil | IAACSFFVFARLPADAGAELARRTPAPTAGPTEATDQRMG* |
| Ga0075365_103835421 | 3300006038 | Populus Endosphere | AFLTVAAIAGSAFFVFLRMPSDAGAELARRKTAPSAGATEATDQRMG* |
| Ga0066659_108142892 | 3300006797 | Soil | LTIAMIAACATIFFYWMPPDAGAELARRSPTPPAGPTEATDQKLG* |
| Ga0066659_108304641 | 3300006797 | Soil | IAVIAGCAFFVFAQMPQDAGAELARRTPAPVAGPTEATDQKLG* |
| Ga0066659_116196471 | 3300006797 | Soil | VIAACAAFVFARLPADAGAEIARQTPGPTPGPTEATDQKLG* |
| Ga0075428_1023713582 | 3300006844 | Populus Rhizosphere | AFIAIAVIAGSAFFIFARMPKDAGAELARRSPAPAAGSTEATDQKLS* |
| Ga0075421_1022460401 | 3300006845 | Populus Rhizosphere | AFLTVAAIAGSAFFVFRRMPANAGAELARRTTTAPSAGATEATDQRMG* |
| Ga0075433_107632112 | 3300006852 | Populus Rhizosphere | CACFVFARMPADAGAELARRSAAPAAGPTEATDQRMG* |
| Ga0075425_1006616111 | 3300006854 | Populus Rhizosphere | GSASLIFARLPADAGAELARRTTAPAAGPTEASDQRMG* |
| Ga0066710_1001527121 | 3300009012 | Grasslands Soil | VAIGVIAACAAFVFARLPADAGAEISRRTPGPTPGPSEATDQKPG |
| Ga0105241_124210081 | 3300009174 | Corn Rhizosphere | GSAFFIFARMPKDAGAELARRSPAPAAGPTEATDQKLS* |
| Ga0126374_104144433 | 3300009792 | Tropical Forest Soil | CLLFARLPVDAGAELSRRTTAPAAAPTEASDQRMG* |
| Ga0126310_104375612 | 3300010044 | Serpentine Soil | SAITAAADFQPAFIAIAVIAGSAFFIFARMPKDAGAELARRSPAPAAGPTEATDQKQG* |
| Ga0099796_102174632 | 3300010159 | Vadose Zone Soil | FVFWRMPGDAGAELARRTPGPKPGPTDGTDQKLS* |
| Ga0134082_100564111 | 3300010303 | Grasslands Soil | IAACGFFIFARLPADAGAELARRTTAPAAGPTEATDQRMG* |
| Ga0126379_134303552 | 3300010366 | Tropical Forest Soil | DFQPAYLAIAVIAGCASLIFARMPAEAGAELARRTTAPAAGPTEATDQRMG* |
| Ga0134122_120255101 | 3300010400 | Terrestrial Soil | KIASAADFQPAFIAIALIAALASIAFYRMPPEAGADLARRSPTPPAGPTEAADQKLG* |
| Ga0134121_130956482 | 3300010401 | Terrestrial Soil | AFFIFVRMPKDAGAELARRSPAPAAGPTEASDQKLS* |
| Ga0137393_111088041 | 3300011271 | Vadose Zone Soil | FQPAFVTIGVIAATVTIVFARLPPDAGAELARRTPGPVPGPTEAADQKLG* |
| Ga0137389_103548903 | 3300012096 | Vadose Zone Soil | AYIVIAVISGCAFFFFVRMPADAGAELARRAPAPGPTEATDQKLG* |
| Ga0137383_103266823 | 3300012199 | Vadose Zone Soil | FFIFARLPADAGAALARRTTAPAAGPTEATDQRLG* |
| Ga0137368_108683812 | 3300012358 | Vadose Zone Soil | VAVIAGCAFFVFARLPADAGAELARRTPAPAAGPTEATDQRMG* |
| Ga0157294_101271111 | 3300012892 | Soil | IAVIAGSAVFIFARMPKDAGAELARRSPAPAAGPTEATDQKLS* |
| Ga0137407_116567011 | 3300012930 | Vadose Zone Soil | PAYIVIAVISACAFFFFVQLPVDAGAELARRAPPPGPGSTEATDQKLS* |
| Ga0126375_100008501 | 3300012948 | Tropical Forest Soil | AFFFFVQMPIDAGAELARRTPPAGPTEATDQKLG* |
| Ga0164298_100283764 | 3300012955 | Soil | ACSALFIFARMPKEAGAELARRSPAPAAGPTEATDQKLS* |
| Ga0164301_100430984 | 3300012960 | Soil | ADFQPAFLAIAVIAGSAFVVFARMPADAGAELARRAPAPPAAGPTEATDQKLS* |
| Ga0126369_111140241 | 3300012971 | Tropical Forest Soil | IAVIAGCACFVFARMPADAGAELARRSTAPAAGPTEATDQRMG* |
| Ga0126369_135137631 | 3300012971 | Tropical Forest Soil | AIALISACAFFVFVRMPPEAGAELARRTPTPTPGPTEATDQKLS* |
| Ga0164308_103173453 | 3300012985 | Soil | FVVFARMPADAGAELARRAPAPPAAGPTEATDQKLS* |
| Ga0157379_119650642 | 3300014968 | Switchgrass Rhizosphere | FVFVRMPSDAGAELARRSPAPAAGPTESTDQKLS* |
| Ga0173483_103549661 | 3300015077 | Soil | ADFQPAFIAIAVIAGSAFFVFVRMPSDAGAELARRSPAPAAGPTESTDQKLS* |
| Ga0132258_133458011 | 3300015371 | Arabidopsis Rhizosphere | ADFQPAFIAIAVIAGSAFFIFARMPKDAGAELARRSPAPAAGPTEATDQKLS* |
| Ga0132257_1026678631 | 3300015373 | Arabidopsis Rhizosphere | GSAFFVFARMPADAGAELARRAPAPTAGPTEAADQKLS* |
| Ga0132255_1052279282 | 3300015374 | Arabidopsis Rhizosphere | GSAFFVFLRMPADAGAELARRTTAPSAGATEATDQRMG* |
| Ga0182040_107193111 | 3300016387 | Soil | IAVIAGCACFVFARMPADAGAELARRSVAPAAGPTEATDQRMG |
| Ga0182037_102687702 | 3300016404 | Soil | ADFQPAYLTIAVIAGCASLLFARLPADAGAELAQRTPLPAPSPTEASDQKLG |
| Ga0182039_117844022 | 3300016422 | Soil | AIAVIAGSASLIFARMPAEAGAELARRTTAPAAGPTEATDQRMG |
| Ga0182038_116253742 | 3300016445 | Soil | AASACFVFARMPDDVGEELARRTPGPIPSATEEAADHKLG |
| Ga0184640_103476182 | 3300018074 | Groundwater Sediment | AFFIFARMPKDAGAELARRSPAPAAGPTEATDQKLS |
| Ga0184609_101205421 | 3300018076 | Groundwater Sediment | ITDAADFQPAFLAIAVIAGSAFFVFARMPADAGAELARRTPAPTAGPTEAADQKLS |
| Ga0184639_105820612 | 3300018082 | Groundwater Sediment | VIAGSAFFVFARMPADAGAELARRTPAPTAGPTEAADQKLS |
| Ga0190274_113765752 | 3300018476 | Soil | FFIFARMPKDAGAELARRSPTPAAGPTEATDQKLS |
| Ga0190273_120573472 | 3300018920 | Soil | GQSAITAAADFQPAFIAIAVIAGSAFFIFARMPKDAGAELARRSPAPGAGPTEATDQKLS |
| Ga0193693_10505351 | 3300019996 | Soil | SVITDAADFQPAFLAIAVIAGSAFVVFARMPADAGAELARRTPAPTAGPTEAADQKLS |
| Ga0179596_102078083 | 3300021086 | Vadose Zone Soil | GCAFLVFARLPADAGAELARRTPATGAGATEATDQRMG |
| Ga0210408_100429761 | 3300021178 | Soil | SVITAVDFQPAFLTVAVIAACAGLAFAQLPPEAGAELARRAPAPGTGPTDATDQKLG |
| Ga0210402_107893332 | 3300021478 | Soil | ISASAFFVFARMPVDAGAELARRSPGPKPGPTEATDQKLS |
| Ga0210409_109158491 | 3300021559 | Soil | QPAYLTIAVIAACACLIFARMPADAGAELARRSTAPSAGATEASDQRMG |
| Ga0207684_114454181 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | CFVFARMPADAGAELARRSAAPAASPTEATDQRMG |
| Ga0207652_105731971 | 3300025921 | Corn Rhizosphere | AAADFQPAFIAIAVIAGSAFFSFARRPKDAGAELARRSPAPAAGPTEATDQKLS |
| Ga0207681_111730452 | 3300025923 | Switchgrass Rhizosphere | AFVAIAVIAGSAFVVFARMPADAGAELARRAPAPPAAGPTEATDQKLS |
| Ga0207659_110593201 | 3300025926 | Miscanthus Rhizosphere | GSAFVVFARMPADAGAELARRAPAPPAAGPTEATDQKLS |
| Ga0207700_117976951 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVIAACAGLAFAQLPPEAGAELARRAPAPGTGPTDATDQKLG |
| Ga0207644_116822232 | 3300025931 | Switchgrass Rhizosphere | FQPAFVAIAVIAGSAFIVFARMPADAGAELARRAPAPPAAGPTEATDQKLS |
| Ga0207690_110216031 | 3300025932 | Corn Rhizosphere | DFQPAFIAIAVIAGSAFFIFARMPKDAGAELARRSPAPAAGPTEATDQKLS |
| Ga0209473_11005991 | 3300026330 | Soil | YLTIAVIAACGFFVFARLPADAGAELARRTTAPAAGPTEATDQRMG |
| Ga0257156_10254663 | 3300026498 | Soil | AVIAGCAFLVFARLPADAGAELARRTPATGAGATEATDQRMG |
| Ga0209378_10431835 | 3300026528 | Soil | FFIFARLPADAGAELARRTTAPAAGPTEATDQRMG |
| Ga0179587_101724673 | 3300026557 | Vadose Zone Soil | GCAFFVFARLPADAGAELARRTPATGAGATEATDQRMG |
| Ga0207821_10053794 | 3300026869 | Tropical Forest Soil | PAFVTIAVIAASACFVFARMPEDVGEEIARRTPVPSPTEAAD |
| Ga0209465_106390071 | 3300027874 | Tropical Forest Soil | FFVFVQMPRDAGAELARHAPTPAVGPTEATDQKLS |
| Ga0209382_116414842 | 3300027909 | Populus Rhizosphere | AFLTVAAIAGSAFFVFRRMPANAGAELARRTTTAPSAGATEATDQRMG |
| Ga0209382_123389402 | 3300027909 | Populus Rhizosphere | AFIAIALISACAFFVFVRLPADAGAELARRQPGPTPSPTEATDQKLGV |
| Ga0307295_100508333 | 3300028708 | Soil | PAFLAIAVIAGSAFFVFARMPADAGAELARRTPAPTAGPTEAADQKLS |
| Ga0307309_100466592 | 3300028714 | Soil | AFLAIAVIAGSAFFVFARMPADAGAELARRTPAPTAGPTEAADQKLS |
| Ga0307298_101587652 | 3300028717 | Soil | DFQPAFLAIAVIAGSAFFVFARMPADAGAELARRTPAPTAGPTEAADQKLS |
| Ga0307319_103164692 | 3300028722 | Soil | ALPISFIAIAVIAGSAFFIFARMPKDAGAELARRSPTPAAGPTEATDQKLS |
| Ga0307318_102815981 | 3300028744 | Soil | GQSIITDAADFQPAFLAIAVIAGSAFFVFARMPADAGAELARRTPAPTAGPTEAADQKLS |
| Ga0307299_101143223 | 3300028793 | Soil | SAFFVFARMPADAGAELARRTPAPTAGPTEAADQKLS |
| Ga0307299_102852912 | 3300028793 | Soil | IGVIAACAFFVFMRMPPEAGAELARRTPIPAPGPSEAADQKLS |
| Ga0307302_101498583 | 3300028814 | Soil | AADFQPAFLAIAVIAGSAFFVFARMPADAGAELARRTPAPTAGPTEAADQKLS |
| Ga0307304_100175681 | 3300028885 | Soil | ARGQSIITDAADFQPAFLAIAVIAGSAFFVFARMPADAGAELARRTPAPTAGPTEAADQKLS |
| Ga0247827_105078601 | 3300028889 | Soil | AVIAGSAFVVFARMPADAGAELARRAPAPPAAGPTEATDQKLS |
| Ga0307496_100161143 | 3300031200 | Soil | VITDAADFQPAFLAIAVIAGSAFVVFARMPADAGAELARRTPAPTAGPTEAADQKLS |
| Ga0307497_100033951 | 3300031226 | Soil | FFVFARMPHDAGAELARRRPGPPPPGPTEGTDQKLS |
| Ga0302323_1031121761 | 3300031232 | Fen | TDAHDFQPAFIAIALIAATASIIFYRMPPDAGEELARRSPTPPAGPTEAADQKLS |
| Ga0170820_109786952 | 3300031446 | Forest Soil | AIAVIAGSAFFIFARMPKDAGAELARRSPAPAAGPTEATDQKLS |
| Ga0307505_105265311 | 3300031455 | Soil | AVDLTLVARGQTAITAAADFQPAFIAIAVIAGSAFFIFARMPKDAGAELARRSPAPAAGPTEATDQKLS |
| Ga0318516_105103682 | 3300031543 | Soil | ACFVFARMPADAGAELARRSTAPAAGPTEATDQRMG |
| Ga0318555_108048951 | 3300031640 | Soil | YLIIAVIAGCACFVFARMPADAGAELARRSTAPAAGATEASDQRMG |
| Ga0318572_105482132 | 3300031681 | Soil | ITAVDFQPAYLAIAVIAGSASLIFARMPAEAGAELARRTTAPAAGPTEATDQRMG |
| Ga0318572_108005182 | 3300031681 | Soil | YLTIAVIAGCACFVFARMPADAGAELARRSGAPAAGPTEATDQRMG |
| Ga0306917_106537491 | 3300031719 | Soil | CASFIFARMPADAGAELARRSTAPAAGATEATDQRMG |
| Ga0306917_109956711 | 3300031719 | Soil | VIAGCACFVFARMPADAGAELARRSGAPAAGPTEATDQRMG |
| Ga0318502_102883612 | 3300031747 | Soil | IAGCASFIFARMPADAGAELARRSTAPAAGATEATDQRMG |
| Ga0318494_103478661 | 3300031751 | Soil | IAVIAGCASFIFARMPADAGAELARRSTAPAAGATEATDQRMG |
| Ga0318537_101927001 | 3300031763 | Soil | FFVFMQMPADAGAELARRTPTPIAGPTEAADQKLG |
| Ga0318509_107099311 | 3300031768 | Soil | LAIAVIAGSASLIFARMPAEAGAELARRTTAPAAGPTEATDQRMG |
| Ga0318521_105269101 | 3300031770 | Soil | AYIAIAVISGCAFFVFMQMPADAGAELARRTPTPIAGPTEAADQKLG |
| Ga0318546_102606672 | 3300031771 | Soil | AADFRPAFVIIAVIAASACFVFARMPDDVGEELARRTPGPIPSPVEEAADQKLG |
| Ga0318498_102051642 | 3300031778 | Soil | TAADFQPAYLTIAVIAGCACFVFARMPADAGAELARRSTAPSAGATEATDQRMG |
| Ga0318547_101166433 | 3300031781 | Soil | PVSCACFVFAHMPQDTGEELARRTPIPAPSPTEAADQKLG |
| Ga0318552_100275361 | 3300031782 | Soil | VIAGCASFIFARMPADAGAELARRSTAPTAGATEATDQRMG |
| Ga0318568_107717481 | 3300031819 | Soil | IAGSASLIFARMPAEAGAELARRTTAPAAGPTEATDQRMG |
| Ga0307473_114952091 | 3300031820 | Hardwood Forest Soil | ACAFFFFVRLPVDAGAELARRTPAPGPTEATDQKLS |
| Ga0318567_103996072 | 3300031821 | Soil | IIAVIAASACFVFARMPDDVGEELARRTPGPIPSPVEEAADQKLG |
| Ga0318517_101175372 | 3300031835 | Soil | FVFARMPDDVGEELARRTPGPIPSPVEEAADQKLG |
| Ga0318512_100654061 | 3300031846 | Soil | AVIAGCASFIFARMPADAGAELARRSTAPTAGATEATDQRMG |
| Ga0318512_102706511 | 3300031846 | Soil | QPAYIAIAVISGCAFFVFMQMPADAGAELARRTPTPIAGPTEAADQKLG |
| Ga0310904_100953661 | 3300031854 | Soil | AADFQPAFIAIAVIAGSAFFIFARMPKDAGAELARRSPAPAAGPTEATDQKLS |
| Ga0318536_100905701 | 3300031893 | Soil | ASFIFARMPADAGAELARRSTAPTAGATEATDQRMG |
| Ga0318536_105964702 | 3300031893 | Soil | PAYLTIAVIAGCACFVFARMPADAGAELARRSGAPAAGPTEATDQRMG |
| Ga0318522_102449192 | 3300031894 | Soil | VIAGCACFVFARMPADAGAELARRSTAPSAGATEATDQRMG |
| Ga0306923_121538651 | 3300031910 | Soil | YIVIALISASAFFVFARMPADAGAELARRAPGPKPGPTEGTDQKLS |
| Ga0310912_104712892 | 3300031941 | Soil | DFQPAYLTIAVIAGCASLLFARLPVDAGAELARRTPLPAPSPTEASDQKLG |
| Ga0310913_104069061 | 3300031945 | Soil | VIAGCASFIFARMPADAGAELARRSTAPAAGATEATDQRMG |
| Ga0318531_100126173 | 3300031981 | Soil | SACFVFARMPDDVGEELARRTPGPIPSPVEEAADQKLG |
| Ga0318531_105120192 | 3300031981 | Soil | LQPAYLTIAVIAGCACFVFARMPADAGAELARRSGAPAAGPTEATDQRMG |
| Ga0306922_109161182 | 3300032001 | Soil | PAYLTIAVIAGCACFVFARMPADAGAELARRSTAPAAGPTEATDQRMG |
| Ga0318569_102270611 | 3300032010 | Soil | FQPAYLIIAVIAGCASFIFARMPADAGAELARRSTAPTAGATEATDQRMG |
| Ga0318569_105500752 | 3300032010 | Soil | AYLTIAVIAGCASFIFARMPADAGAELARRSTGPSAGATEATDQRMG |
| Ga0318559_104870111 | 3300032039 | Soil | YLIIAVIAGCASFIFARMPADAGAELARRSTAPAAGATEATDQRMG |
| Ga0318556_107219811 | 3300032043 | Soil | VMAGCACFVFARMPADAGAELARRSTAPAAGATEASDQRMG |
| Ga0318506_102372801 | 3300032052 | Soil | RDTITAVDFQPAYLAIAVIAGSASLIFARMPAEAGAELARRTTAPAAGPTEATDQRMG |
| Ga0318513_102126903 | 3300032065 | Soil | IAVISGCAFFVFMQMPADAGAELARRTPTPIAGPTEAADQKLG |
| Ga0307471_1018698252 | 3300032180 | Hardwood Forest Soil | VAAIAGSAFFVFLRMPSDAGAELARRTAAPSAGATEATDQRMG |
| Ga0306920_1039922311 | 3300032261 | Soil | AVDFQPAFITIAIIAGCACFVFARMPLEAGAELARRSPSPAPSPTETADQRLG |
| Ga0310914_100088674 | 3300033289 | Soil | ASACFVFARMPDDVGEELARRTPGPIPSPVEEAADQKLG |
| Ga0318519_107308112 | 3300033290 | Soil | PAYLAIAVIAGCACFVFARMPADAGAELARRSTAPAAGPTEATDQRMG |
| Ga0326726_113259291 | 3300033433 | Peat Soil | SASAFFVFARMPVDAGAELARRTPGPKPGPTEDTDQKL |
| Ga0247830_104760401 | 3300033551 | Soil | AFIAIAVIAGSAFFIFARMPKDAGAELARRSPAPAAGPTEATDQKLS |
| ⦗Top⦘ |