


| Basic Information | |
|---|---|
| Family ID | F053146 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Number of Associated Samples | 67 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.71 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.62 % |
| Associated GOLD sequencing projects | 51 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.305 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (56.028 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.702 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.652 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.52% β-sheet: 16.67% Coil/Unstructured: 73.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF13395 | HNH_4 | 1.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.30 % |
| All Organisms | root | All Organisms | 22.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001828|ACM3_1014015 | Not Available | 1601 | Open in IMG/M |
| 3300006026|Ga0075478_10047230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1414 | Open in IMG/M |
| 3300006026|Ga0075478_10061922 | Not Available | 1217 | Open in IMG/M |
| 3300006802|Ga0070749_10046626 | All Organisms → Viruses → Predicted Viral | 2649 | Open in IMG/M |
| 3300006802|Ga0070749_10081237 | Not Available | 1935 | Open in IMG/M |
| 3300006802|Ga0070749_10137001 | Not Available | 1430 | Open in IMG/M |
| 3300006802|Ga0070749_10171671 | Not Available | 1252 | Open in IMG/M |
| 3300006802|Ga0070749_10179816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 1219 | Open in IMG/M |
| 3300006802|Ga0070749_10774858 | Not Available | 510 | Open in IMG/M |
| 3300006810|Ga0070754_10053821 | Not Available | 2114 | Open in IMG/M |
| 3300006810|Ga0070754_10059814 | Not Available | 1978 | Open in IMG/M |
| 3300006810|Ga0070754_10070463 | Not Available | 1787 | Open in IMG/M |
| 3300006810|Ga0070754_10145107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 1139 | Open in IMG/M |
| 3300006810|Ga0070754_10211327 | Not Available | 900 | Open in IMG/M |
| 3300006810|Ga0070754_10216105 | Not Available | 887 | Open in IMG/M |
| 3300006810|Ga0070754_10237577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 836 | Open in IMG/M |
| 3300006867|Ga0075476_10085570 | Not Available | 1226 | Open in IMG/M |
| 3300006867|Ga0075476_10170797 | Not Available | 803 | Open in IMG/M |
| 3300006868|Ga0075481_10081652 | Not Available | 1212 | Open in IMG/M |
| 3300006868|Ga0075481_10297887 | Not Available | 562 | Open in IMG/M |
| 3300006869|Ga0075477_10127616 | Not Available | 1073 | Open in IMG/M |
| 3300006919|Ga0070746_10142870 | Not Available | 1169 | Open in IMG/M |
| 3300006919|Ga0070746_10151326 | Not Available | 1130 | Open in IMG/M |
| 3300006919|Ga0070746_10163106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 1079 | Open in IMG/M |
| 3300006919|Ga0070746_10207443 | Not Available | 930 | Open in IMG/M |
| 3300007234|Ga0075460_10044190 | Not Available | 1690 | Open in IMG/M |
| 3300007344|Ga0070745_1074331 | Not Available | 1359 | Open in IMG/M |
| 3300007344|Ga0070745_1092995 | Not Available | 1186 | Open in IMG/M |
| 3300007344|Ga0070745_1106050 | Not Available | 1095 | Open in IMG/M |
| 3300007344|Ga0070745_1137016 | Not Available | 935 | Open in IMG/M |
| 3300007345|Ga0070752_1073935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1503 | Open in IMG/M |
| 3300007345|Ga0070752_1145016 | Not Available | 980 | Open in IMG/M |
| 3300007345|Ga0070752_1147125 | Not Available | 971 | Open in IMG/M |
| 3300007345|Ga0070752_1258334 | Not Available | 675 | Open in IMG/M |
| 3300007346|Ga0070753_1080579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1290 | Open in IMG/M |
| 3300007346|Ga0070753_1095728 | Not Available | 1163 | Open in IMG/M |
| 3300007346|Ga0070753_1137567 | Not Available | 932 | Open in IMG/M |
| 3300007539|Ga0099849_1030209 | Not Available | 2320 | Open in IMG/M |
| 3300007539|Ga0099849_1054135 | Not Available | 1663 | Open in IMG/M |
| 3300007539|Ga0099849_1072658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1401 | Open in IMG/M |
| 3300007539|Ga0099849_1254817 | Not Available | 644 | Open in IMG/M |
| 3300007541|Ga0099848_1048573 | Not Available | 1715 | Open in IMG/M |
| 3300007541|Ga0099848_1069670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1386 | Open in IMG/M |
| 3300007541|Ga0099848_1237946 | Not Available | 641 | Open in IMG/M |
| 3300007542|Ga0099846_1035981 | Not Available | 1898 | Open in IMG/M |
| 3300007640|Ga0070751_1100222 | Not Available | 1198 | Open in IMG/M |
| 3300007640|Ga0070751_1333307 | Not Available | 559 | Open in IMG/M |
| 3300007960|Ga0099850_1124740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 1049 | Open in IMG/M |
| 3300009000|Ga0102960_1243526 | Not Available | 637 | Open in IMG/M |
| 3300009001|Ga0102963_1104408 | Not Available | 1155 | Open in IMG/M |
| 3300009001|Ga0102963_1129440 | Not Available | 1022 | Open in IMG/M |
| 3300009001|Ga0102963_1355160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 575 | Open in IMG/M |
| 3300009027|Ga0102957_1064532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1259 | Open in IMG/M |
| 3300009327|Ga0103843_100583 | Not Available | 1671 | Open in IMG/M |
| 3300009327|Ga0103843_101089 | Not Available | 1310 | Open in IMG/M |
| 3300009327|Ga0103843_101905 | Not Available | 1025 | Open in IMG/M |
| 3300009338|Ga0103826_103643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1118 | Open in IMG/M |
| 3300010296|Ga0129348_1058240 | Not Available | 1388 | Open in IMG/M |
| 3300010296|Ga0129348_1061988 | Not Available | 1339 | Open in IMG/M |
| 3300010296|Ga0129348_1071431 | Not Available | 1238 | Open in IMG/M |
| 3300010296|Ga0129348_1088606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 1097 | Open in IMG/M |
| 3300010296|Ga0129348_1150173 | Not Available | 806 | Open in IMG/M |
| 3300010297|Ga0129345_1039415 | Not Available | 1827 | Open in IMG/M |
| 3300010297|Ga0129345_1099946 | Not Available | 1075 | Open in IMG/M |
| 3300010297|Ga0129345_1121024 | Not Available | 959 | Open in IMG/M |
| 3300010297|Ga0129345_1326395 | Not Available | 529 | Open in IMG/M |
| 3300010299|Ga0129342_1079292 | Not Available | 1251 | Open in IMG/M |
| 3300010299|Ga0129342_1115503 | Not Available | 998 | Open in IMG/M |
| 3300010300|Ga0129351_1127240 | Not Available | 1013 | Open in IMG/M |
| 3300010318|Ga0136656_1100041 | Not Available | 1017 | Open in IMG/M |
| 3300010370|Ga0129336_10092559 | Not Available | 1776 | Open in IMG/M |
| 3300010370|Ga0129336_10171015 | Not Available | 1248 | Open in IMG/M |
| 3300010389|Ga0136549_10171020 | Not Available | 963 | Open in IMG/M |
| 3300010389|Ga0136549_10190763 | Not Available | 897 | Open in IMG/M |
| 3300012504|Ga0129347_1217736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 500 | Open in IMG/M |
| 3300012518|Ga0129349_1127976 | Not Available | 863 | Open in IMG/M |
| 3300012520|Ga0129344_1013986 | Not Available | 718 | Open in IMG/M |
| 3300012523|Ga0129350_1037451 | Not Available | 1312 | Open in IMG/M |
| 3300012523|Ga0129350_1040017 | Not Available | 776 | Open in IMG/M |
| 3300012966|Ga0129341_1117787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 1219 | Open in IMG/M |
| 3300012967|Ga0129343_1393119 | Not Available | 994 | Open in IMG/M |
| 3300017951|Ga0181577_10160687 | Not Available | 1523 | Open in IMG/M |
| 3300017967|Ga0181590_10178205 | Not Available | 1610 | Open in IMG/M |
| 3300017967|Ga0181590_10193791 | Not Available | 1530 | Open in IMG/M |
| 3300017969|Ga0181585_10795497 | Not Available | 613 | Open in IMG/M |
| 3300018421|Ga0181592_10212923 | Not Available | 1438 | Open in IMG/M |
| 3300018421|Ga0181592_10242970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1325 | Open in IMG/M |
| 3300018421|Ga0181592_10266547 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
| 3300018421|Ga0181592_10375291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 1010 | Open in IMG/M |
| 3300018421|Ga0181592_10385904 | Not Available | 992 | Open in IMG/M |
| 3300018421|Ga0181592_10562148 | Not Available | 779 | Open in IMG/M |
| 3300018421|Ga0181592_10725941 | Not Available | 661 | Open in IMG/M |
| 3300018424|Ga0181591_10168237 | Not Available | 1745 | Open in IMG/M |
| 3300018424|Ga0181591_10308425 | All Organisms → Viruses → Predicted Viral | 1204 | Open in IMG/M |
| 3300018424|Ga0181591_10339244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 1135 | Open in IMG/M |
| 3300018424|Ga0181591_10340350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1133 | Open in IMG/M |
| 3300018424|Ga0181591_10389054 | Not Available | 1041 | Open in IMG/M |
| 3300018424|Ga0181591_10842564 | Not Available | 633 | Open in IMG/M |
| 3300018424|Ga0181591_10926454 | Not Available | 596 | Open in IMG/M |
| 3300021364|Ga0213859_10195615 | Not Available | 939 | Open in IMG/M |
| 3300021958|Ga0222718_10059499 | Not Available | 2385 | Open in IMG/M |
| 3300021958|Ga0222718_10091829 | All Organisms → Viruses | 1807 | Open in IMG/M |
| 3300021959|Ga0222716_10219041 | Not Available | 1193 | Open in IMG/M |
| 3300021959|Ga0222716_10495944 | Not Available | 688 | Open in IMG/M |
| 3300021960|Ga0222715_10081871 | Not Available | 2127 | Open in IMG/M |
| 3300021960|Ga0222715_10269918 | Not Available | 980 | Open in IMG/M |
| 3300021964|Ga0222719_10413829 | Not Available | 835 | Open in IMG/M |
| 3300022069|Ga0212026_1046040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 655 | Open in IMG/M |
| 3300022187|Ga0196899_1019415 | Not Available | 2519 | Open in IMG/M |
| 3300022187|Ga0196899_1022976 | Not Available | 2267 | Open in IMG/M |
| 3300022187|Ga0196899_1058642 | Not Available | 1235 | Open in IMG/M |
| 3300022200|Ga0196901_1100619 | Not Available | 1008 | Open in IMG/M |
| 3300023116|Ga0255751_10205807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1098 | Open in IMG/M |
| 3300023116|Ga0255751_10323746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 794 | Open in IMG/M |
| 3300025646|Ga0208161_1048397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1376 | Open in IMG/M |
| 3300025647|Ga0208160_1115704 | Not Available | 681 | Open in IMG/M |
| 3300025653|Ga0208428_1026835 | Not Available | 1862 | Open in IMG/M |
| 3300025653|Ga0208428_1041832 | Not Available | 1420 | Open in IMG/M |
| 3300025653|Ga0208428_1063725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 1092 | Open in IMG/M |
| 3300025671|Ga0208898_1038736 | Not Available | 1850 | Open in IMG/M |
| 3300025674|Ga0208162_1077820 | Not Available | 1033 | Open in IMG/M |
| 3300025674|Ga0208162_1088208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 946 | Open in IMG/M |
| 3300025674|Ga0208162_1191092 | Not Available | 527 | Open in IMG/M |
| 3300025751|Ga0208150_1035432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Ashivirus → unclassified Ashivirus → Synechococcus phage S-SBP1 | 1733 | Open in IMG/M |
| 3300025769|Ga0208767_1063219 | Not Available | 1650 | Open in IMG/M |
| 3300025818|Ga0208542_1060044 | Not Available | 1161 | Open in IMG/M |
| 3300025828|Ga0208547_1043476 | Not Available | 1602 | Open in IMG/M |
| 3300025853|Ga0208645_1039305 | Not Available | 2357 | Open in IMG/M |
| 3300025853|Ga0208645_1060726 | Not Available | 1745 | Open in IMG/M |
| 3300025853|Ga0208645_1065996 | Not Available | 1642 | Open in IMG/M |
| 3300025889|Ga0208644_1045654 | Not Available | 2473 | Open in IMG/M |
| 3300025889|Ga0208644_1145292 | Not Available | 1096 | Open in IMG/M |
| 3300027917|Ga0209536_101291111 | Not Available | 893 | Open in IMG/M |
| 3300027917|Ga0209536_101617355 | Not Available | 786 | Open in IMG/M |
| 3300031565|Ga0307379_10448221 | Not Available | 1222 | Open in IMG/M |
| 3300031566|Ga0307378_10655437 | Not Available | 910 | Open in IMG/M |
| 3300031578|Ga0307376_10435391 | Not Available | 857 | Open in IMG/M |
| 3300032136|Ga0316201_10314687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1354 | Open in IMG/M |
| 3300032136|Ga0316201_11792241 | Not Available | 505 | Open in IMG/M |
| 3300034374|Ga0348335_096116 | Not Available | 948 | Open in IMG/M |
| 3300034418|Ga0348337_044563 | Not Available | 1858 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 56.03% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 14.18% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 10.64% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.96% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.55% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 2.84% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.13% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.42% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 1.42% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 1.42% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.71% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001828 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM3, ROCA_DNA076_2.0um_10f | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009327 | Microbial communities of water from the North Atlantic ocean - ACM30 | Environmental | Open in IMG/M |
| 3300009338 | Microbial communities of water from the North Atlantic ocean - ACM29 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300012504 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012518 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012523 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012966 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ACM3_10140153 | 3300001828 | Marine Plankton | LCLAILGDKQLREIWFHPAGNVIKKRGLATGYPGCELRLAAIRVENN* |
| Ga0075478_100472303 | 3300006026 | Aqueous | WITLCLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCEPRLVPIRVENN* |
| Ga0075478_100619221 | 3300006026 | Aqueous | WITLCLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0070749_100466263 | 3300006802 | Aqueous | LWITLCLVILGDKQSRETWFHPAGNVIKKRGQATGYLGCELRLAAIRVENN* |
| Ga0070749_100812371 | 3300006802 | Aqueous | GDKRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN* |
| Ga0070749_101370013 | 3300006802 | Aqueous | ITLCLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0070749_101716713 | 3300006802 | Aqueous | TLCLVILGDKQSRETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0070749_101798163 | 3300006802 | Aqueous | LCLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN* |
| Ga0070749_107748581 | 3300006802 | Aqueous | DKQSRETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN* |
| Ga0070754_100538211 | 3300006810 | Aqueous | TWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0070754_100598143 | 3300006810 | Aqueous | LWITLCLVILGDKQSRETWFHPAGNVIKKRGQATGYPGCEPRLAVIRIENN* |
| Ga0070754_100704633 | 3300006810 | Aqueous | DKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0070754_101451073 | 3300006810 | Aqueous | GDRQSRETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0070754_102113271 | 3300006810 | Aqueous | ETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN* |
| Ga0070754_102161051 | 3300006810 | Aqueous | TLCLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAPIRVENK* |
| Ga0070754_102375771 | 3300006810 | Aqueous | TLCLVILGDKQSRETWFHPAGNVIKKRGQATGYPGCELRLAPIRVENN* |
| Ga0075476_100855703 | 3300006867 | Aqueous | LCLVILGDKQSRETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0075476_101707971 | 3300006867 | Aqueous | LCLVILGDKQSRETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENK* |
| Ga0075481_100816523 | 3300006868 | Aqueous | DKQSRETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENK* |
| Ga0075481_102978872 | 3300006868 | Aqueous | VPRFVGGQTLQETWFHPAGNVIKKRGQATGYPGCEPRLVPIRVENN* |
| Ga0075477_101276162 | 3300006869 | Aqueous | LCLVILGDKQSRETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN* |
| Ga0070746_101428702 | 3300006919 | Aqueous | LQETWFHPAGNVIKKRGQATGYLGCELRLAAIRVENN* |
| Ga0070746_101513261 | 3300006919 | Aqueous | MNLLWITLCLALLGDRQSREIWFHPAGNVIKKRGQATGYPGCELRLAPIRVENN* |
| Ga0070746_101631061 | 3300006919 | Aqueous | EIWFHPAGNVIKKRGLATGYLGCELRLAAIQIENN* |
| Ga0070746_102074432 | 3300006919 | Aqueous | GDKQSRETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN* |
| Ga0075460_100441903 | 3300007234 | Aqueous | LVILGDKQSRETWFHPAGNVIKKRGQATGYLGCELRLAAIRVENN* |
| Ga0070745_10743313 | 3300007344 | Aqueous | ITLCLALLGDRQSRETWFHPAGNVIKKRGRATGYPGCELRLAAIRVENN* |
| Ga0070745_10929951 | 3300007344 | Aqueous | ETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0070745_11060502 | 3300007344 | Aqueous | GDKQSRETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0070745_11370162 | 3300007344 | Aqueous | ALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLATIRVENN* |
| Ga0070752_10739353 | 3300007345 | Aqueous | CLVLLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0070752_11450162 | 3300007345 | Aqueous | GDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENK* |
| Ga0070752_11471252 | 3300007345 | Aqueous | LWITLCLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCEPRLVPIRVENN* |
| Ga0070752_12583342 | 3300007345 | Aqueous | GDKRLQETWFHPAGNVIKKRGQATGYPGCELRLATIRVENN* |
| Ga0070753_10805793 | 3300007346 | Aqueous | GDKQSRETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENK* |
| Ga0070753_10957283 | 3300007346 | Aqueous | LGDRQSREIWFHPAGNVIKKRGQATGYPGCELRLALIRVENK* |
| Ga0070753_11375672 | 3300007346 | Aqueous | LGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0099849_10302091 | 3300007539 | Aqueous | TLCLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENK* |
| Ga0099849_10541351 | 3300007539 | Aqueous | TLCLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENK* |
| Ga0099849_10726583 | 3300007539 | Aqueous | LGDKQSRETWFHPAGNVIKKRGQATGYPGCELRLAAIRVEND* |
| Ga0099849_12548172 | 3300007539 | Aqueous | GDKRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENK* |
| Ga0099848_10485733 | 3300007541 | Aqueous | DKRLQEIWFHPAGNVIKKRGLATGYLGCEPRLAAIQIENN* |
| Ga0099848_10696701 | 3300007541 | Aqueous | EIWFHPAGNVIKKRGLATGYLGCEPRLAAIQIENN* |
| Ga0099848_12379462 | 3300007541 | Aqueous | LATLGDKRLQEIWFHPAGNVIKKRGLATGYLGCEPRLAAIRIENN* |
| Ga0099846_10359811 | 3300007542 | Aqueous | TLGDKRLQEIWFHPAGNVIKKRGLATGYLGCEPRLAAIRIENN* |
| Ga0070751_11002221 | 3300007640 | Aqueous | QETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0070751_13333072 | 3300007640 | Aqueous | LALLGDKRLQETWFHPAGNVIKKRGQATGYPGCEPRLVPIRVENN* |
| Ga0099850_11247403 | 3300007960 | Aqueous | CLVILGDKQSRETWFHPAGNVIKKRGQATGYPGCELRLAPIRVENN* |
| Ga0102960_12435261 | 3300009000 | Pond Water | TWFHPAGNVIKKRGQATGYPGCELRLATIRVENN* |
| Ga0102963_11044081 | 3300009001 | Pond Water | LVILGDKQSRETWFHPAGNVIKKRGQANGYPGCELRLATIPIENN* |
| Ga0102963_11294401 | 3300009001 | Pond Water | SRETWFHPAGNVIKKRGQATGYPGCELRLATIRVENN* |
| Ga0102963_13551601 | 3300009001 | Pond Water | LVILGDKQSRETWFHPAGNVIKKRGQATGYLGCEPRLVPIRVENN* |
| Ga0102957_10645323 | 3300009027 | Pond Water | LGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAPIRIENK* |
| Ga0103843_1005833 | 3300009327 | River Water | LAILGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0103843_1010893 | 3300009327 | River Water | LAILGDKRLQETWFHPAGNVIKKRGLATGYPGCELRLAAIRVENS* |
| Ga0103843_1019051 | 3300009327 | River Water | LAILGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLATIRVENN* |
| Ga0103826_1036433 | 3300009338 | River Water | DKQLQGTWFHPAGNVIKRRGQATGYPGCELRLAAIRVENN* |
| Ga0129348_10582403 | 3300010296 | Freshwater To Marine Saline Gradient | LALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVEND* |
| Ga0129348_10619883 | 3300010296 | Freshwater To Marine Saline Gradient | TLCLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN* |
| Ga0129348_10714313 | 3300010296 | Freshwater To Marine Saline Gradient | CLALLGDRQSREIWFHPAGNVIKKRGQATGYPGCELRLAAIRVEND* |
| Ga0129348_10886063 | 3300010296 | Freshwater To Marine Saline Gradient | GDKQSRETWFHPAGNVIKKRGQATGYPGCELRLAPIRVENN* |
| Ga0129348_11501732 | 3300010296 | Freshwater To Marine Saline Gradient | LVILGDKQSRETWFHPAGNVIKKRGQATGYLGCEPRLAVIQIENN* |
| Ga0129345_10394153 | 3300010297 | Freshwater To Marine Saline Gradient | LGDKQSRETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0129345_10999461 | 3300010297 | Freshwater To Marine Saline Gradient | TLCLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAPIRVENN* |
| Ga0129345_11210241 | 3300010297 | Freshwater To Marine Saline Gradient | TLCLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLATIRVENN* |
| Ga0129345_13263952 | 3300010297 | Freshwater To Marine Saline Gradient | LALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENK* |
| Ga0129342_10792923 | 3300010299 | Freshwater To Marine Saline Gradient | LVILGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLVAIRVEND* |
| Ga0129342_11155032 | 3300010299 | Freshwater To Marine Saline Gradient | LQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0129351_11272402 | 3300010300 | Freshwater To Marine Saline Gradient | TLCLVILGDKQSRETWFHPAENVIKKRGQATGYPGCELRLVPIRVENN* |
| Ga0136656_11000412 | 3300010318 | Freshwater To Marine Saline Gradient | CLALLGDKRLPETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0129336_100925593 | 3300010370 | Freshwater To Marine Saline Gradient | TLFLATLGDKRLQEIWFHPAGNVIKKRGLATGYLGCEPRLAAIQIENN* |
| Ga0129336_101710152 | 3300010370 | Freshwater To Marine Saline Gradient | TLFLATLGDKRLQEIWFHPAGNVIKKRGLATGYLGCEPRLVAIQIENN* |
| Ga0136549_101710201 | 3300010389 | Marine Methane Seep Sediment | MNYMNLLWITLCLALLGDRQSREIWFHPAGNVIKKRGQATGYPGCELRLA |
| Ga0136549_101907632 | 3300010389 | Marine Methane Seep Sediment | CLVILGDKQSRETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0129347_12177362 | 3300012504 | Aqueous | LQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN* |
| Ga0129349_11279761 | 3300012518 | Aqueous | ETWFHPAGNVIKKRGQATGYPGCELHLVPIRVENN* |
| Ga0129344_10139861 | 3300012520 | Aqueous | RQSREIWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN* |
| Ga0129350_10374511 | 3300012523 | Aqueous | QETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN* |
| Ga0129350_10400171 | 3300012523 | Aqueous | RETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN* |
| Ga0129341_11177873 | 3300012966 | Aqueous | LQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENK* |
| Ga0129343_13931192 | 3300012967 | Aqueous | LGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVESN* |
| Ga0181577_101606873 | 3300017951 | Salt Marsh | DKQSREIWFHPAGNVIKRRGQATGYPGCELRLAAIRVENN |
| Ga0181590_101782051 | 3300017967 | Salt Marsh | RETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0181590_101937911 | 3300017967 | Salt Marsh | KQSREIWFHPAGNVIKRRGLATGYPGCEPRLVPIRVENN |
| Ga0181585_107954971 | 3300017969 | Salt Marsh | ETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0181592_102129233 | 3300018421 | Salt Marsh | GDKQSRETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0181592_102429703 | 3300018421 | Salt Marsh | NLLWITLCLVTLGDRQSQEVWFHRAGNVIKRRGQATGYPGCEPRLAAIRVENN |
| Ga0181592_102665471 | 3300018421 | Salt Marsh | ETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0181592_103752913 | 3300018421 | Salt Marsh | ILGDKQSREIWFHPAGNVIKRRGLATGYPGCEPRLAVIRVENN |
| Ga0181592_103859042 | 3300018421 | Salt Marsh | FLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0181592_105621482 | 3300018421 | Salt Marsh | ALLGDKRLQETWFHPAGNVIKKRGQATGYLGCEPRLVPIRVENN |
| Ga0181592_107259411 | 3300018421 | Salt Marsh | GDKRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENK |
| Ga0181591_101682373 | 3300018424 | Salt Marsh | GDRQSREIWFHPAGNVIKKRGQATGYPGCELRLAPIRVENN |
| Ga0181591_103084251 | 3300018424 | Salt Marsh | KRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0181591_103392443 | 3300018424 | Salt Marsh | GDKQSRETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0181591_103403501 | 3300018424 | Salt Marsh | TLCLVILGDKQSRETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0181591_103890541 | 3300018424 | Salt Marsh | LCLALLGDRQSREIWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0181591_108425641 | 3300018424 | Salt Marsh | SRETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0181591_109264541 | 3300018424 | Salt Marsh | QETWFHPAGNVIKRRGQATGYPGCELRLAPIRVENK |
| Ga0213859_101956151 | 3300021364 | Seawater | LGDKQSRETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0222718_100594993 | 3300021958 | Estuarine Water | VLLGDRQSREIWFHPAGNVIKKRGQATGYPGCELRLATIRVENN |
| Ga0222718_100918291 | 3300021958 | Estuarine Water | LLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0222716_102190411 | 3300021959 | Estuarine Water | DKRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0222716_104959441 | 3300021959 | Estuarine Water | CLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0222715_100818713 | 3300021960 | Estuarine Water | VILGDKQSRETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0222715_102699183 | 3300021960 | Estuarine Water | GDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAPIRIENK |
| Ga0222719_104138291 | 3300021964 | Estuarine Water | QSRETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0212026_10460401 | 3300022069 | Aqueous | LCLVILGDKQSREIWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0196899_10194151 | 3300022187 | Aqueous | GDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0196899_10229761 | 3300022187 | Aqueous | ETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENK |
| Ga0196899_10586423 | 3300022187 | Aqueous | ALLGDKRLQETWFHPAGNVIKKRGQATGYPGCEPRLVPIRVENN |
| Ga0196901_11006192 | 3300022200 | Aqueous | LGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0255751_102058073 | 3300023116 | Salt Marsh | LSITLCLALLGDRQSREIWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0255751_103237461 | 3300023116 | Salt Marsh | LGDKQSREIWFHPAGNVIKRRGLATGYPGCELRLAAIRVENN |
| Ga0208161_10483971 | 3300025646 | Aqueous | EIWFHPAGNVIKKRGLATGYLGCEPRLAAIQIENN |
| Ga0208160_11157041 | 3300025647 | Aqueous | RLQETWFHPAGNVIKKRGQATGYPGCELRLAPIRVENN |
| Ga0208428_10268353 | 3300025653 | Aqueous | LLWITLCLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCEPRLVPIRVENN |
| Ga0208428_10418323 | 3300025653 | Aqueous | ALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0208428_10637251 | 3300025653 | Aqueous | LVILGDKQSREIWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0208898_10387361 | 3300025671 | Aqueous | LWITLCLVILGDKQLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0208162_10778201 | 3300025674 | Aqueous | SRETWFHPAENVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0208162_10882082 | 3300025674 | Aqueous | LQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENK |
| Ga0208162_11910921 | 3300025674 | Aqueous | KRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENK |
| Ga0208150_10354323 | 3300025751 | Aqueous | ETWFHPAGNVIKKRGQATGYPGCELRLAPIRVENN |
| Ga0208767_10632193 | 3300025769 | Aqueous | CLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0208542_10600442 | 3300025818 | Aqueous | LGDKQSRETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0208547_10434761 | 3300025828 | Aqueous | DKQSRETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0208645_10393051 | 3300025853 | Aqueous | WITLCLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0208645_10607261 | 3300025853 | Aqueous | WITLCLALLGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0208645_10659963 | 3300025853 | Aqueous | LGDRQSRETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0208644_10456543 | 3300025889 | Aqueous | CLVILGDKQSRETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0208644_11452921 | 3300025889 | Aqueous | TLCLALLGDKRLQETWFHPAGNVIKRRGQATGYPGCELRLAPIRIENN |
| Ga0209536_1012911112 | 3300027917 | Marine Sediment | DKQSRETWFHPAGNVIKKRGQATGYPGCELRLAPIRVENN |
| Ga0209536_1016173551 | 3300027917 | Marine Sediment | LQETWFHPAGNVIKRRVQATGYPGCELRLVPIRVENK |
| Ga0307379_104482213 | 3300031565 | Soil | QSREIWFHPAGNVIKKRGQATGYPGCELRLVPIRVENN |
| Ga0307378_106554371 | 3300031566 | Soil | ETWFHPAGNVIKKRGQATGYPGCELRLVPIRVENK |
| Ga0307376_104353911 | 3300031578 | Soil | LCLALLGDKQLQGTWFHPAGNVIKKRGLATGYSGCEPRLAAIRIENN |
| Ga0316201_103146873 | 3300032136 | Worm Burrow | GDRQSREIWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| Ga0316201_117922412 | 3300032136 | Worm Burrow | ETWFHPAGNVIKKRGQATGYPGCEPRLAVIRIENN |
| Ga0348335_096116_824_946 | 3300034374 | Aqueous | DRQSREIWFHPAGNVIKKRGQATGYPGCELRLAPIRVENN |
| Ga0348337_044563_1_168 | 3300034418 | Aqueous | YMNLLWITLCLVILGDKRLQETWFHPAGNVIKKRGQATGYPGCELRLAAIRVENN |
| ⦗Top⦘ |