


| Basic Information | |
|---|---|
| Family ID | F053123 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LSEKHNSFLRLLKNKGFKEESTTKVGLYAIGTSTTLESNKS |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 27.54 % |
| % of genes near scaffold ends (potentially truncated) | 63.12 % |
| % of genes from short scaffolds (< 2000 bps) | 85.82 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.284 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.404 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.206 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.901 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.48% β-sheet: 0.00% Coil/Unstructured: 56.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF01370 | Epimerase | 3.55 |
| PF01609 | DDE_Tnp_1 | 2.13 |
| PF07690 | MFS_1 | 2.13 |
| PF13701 | DDE_Tnp_1_4 | 1.42 |
| PF00296 | Bac_luciferase | 1.42 |
| PF13560 | HTH_31 | 1.42 |
| PF07719 | TPR_2 | 1.42 |
| PF10282 | Lactonase | 1.42 |
| PF12762 | DDE_Tnp_IS1595 | 1.42 |
| PF07883 | Cupin_2 | 1.42 |
| PF13340 | DUF4096 | 1.42 |
| PF13676 | TIR_2 | 1.42 |
| PF00211 | Guanylate_cyc | 0.71 |
| PF12727 | PBP_like | 0.71 |
| PF03476 | MOSC_N | 0.71 |
| PF00589 | Phage_integrase | 0.71 |
| PF12706 | Lactamase_B_2 | 0.71 |
| PF01850 | PIN | 0.71 |
| PF05974 | DUF892 | 0.71 |
| PF02683 | DsbD | 0.71 |
| PF13551 | HTH_29 | 0.71 |
| PF13460 | NAD_binding_10 | 0.71 |
| PF01594 | AI-2E_transport | 0.71 |
| PF00076 | RRM_1 | 0.71 |
| PF00158 | Sigma54_activat | 0.71 |
| PF13384 | HTH_23 | 0.71 |
| PF13751 | DDE_Tnp_1_6 | 0.71 |
| PF13424 | TPR_12 | 0.71 |
| PF13358 | DDE_3 | 0.71 |
| PF08241 | Methyltransf_11 | 0.71 |
| PF01139 | RtcB | 0.71 |
| PF16694 | Cytochrome_P460 | 0.71 |
| PF09471 | Peptidase_M64 | 0.71 |
| PF02781 | G6PD_C | 0.71 |
| PF10604 | Polyketide_cyc2 | 0.71 |
| PF12759 | HTH_Tnp_IS1 | 0.71 |
| PF01797 | Y1_Tnp | 0.71 |
| PF01425 | Amidase | 0.71 |
| PF13419 | HAD_2 | 0.71 |
| PF13672 | PP2C_2 | 0.71 |
| PF13191 | AAA_16 | 0.71 |
| PF00206 | Lyase_1 | 0.71 |
| PF10544 | T5orf172 | 0.71 |
| PF00496 | SBP_bac_5 | 0.71 |
| PF04392 | ABC_sub_bind | 0.71 |
| PF13432 | TPR_16 | 0.71 |
| PF13610 | DDE_Tnp_IS240 | 0.71 |
| PF01042 | Ribonuc_L-PSP | 0.71 |
| PF00578 | AhpC-TSA | 0.71 |
| PF07681 | DoxX | 0.71 |
| PF13646 | HEAT_2 | 0.71 |
| PF03050 | DDE_Tnp_IS66 | 0.71 |
| PF02771 | Acyl-CoA_dh_N | 0.71 |
| PF02705 | K_trans | 0.71 |
| PF07978 | NIPSNAP | 0.71 |
| PF01494 | FAD_binding_3 | 0.71 |
| PF04191 | PEMT | 0.71 |
| PF13518 | HTH_28 | 0.71 |
| PF13714 | PEP_mutase | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.13 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.13 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.13 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.13 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.13 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.13 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.42 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.42 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.71 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.71 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.71 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.71 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.71 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.71 |
| COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.71 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.71 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.71 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.71 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.71 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.71 |
| COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.71 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.71 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.70 % |
| Unclassified | root | N/A | 37.59 % |
| Polyangium | genus | Polyangium | 0.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_105984621 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300004153|Ga0063455_100896329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300005181|Ga0066678_10256350 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1133 | Open in IMG/M |
| 3300005187|Ga0066675_11183972 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005332|Ga0066388_100060578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4005 | Open in IMG/M |
| 3300005332|Ga0066388_100397687 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 2023 | Open in IMG/M |
| 3300005332|Ga0066388_101745673 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila | 1104 | Open in IMG/M |
| 3300005332|Ga0066388_105229380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300005332|Ga0066388_105452658 | Not Available | 645 | Open in IMG/M |
| 3300005332|Ga0066388_106688982 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005332|Ga0066388_106876253 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005332|Ga0066388_108454957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 513 | Open in IMG/M |
| 3300005332|Ga0066388_108544879 | Not Available | 510 | Open in IMG/M |
| 3300005438|Ga0070701_10637920 | Not Available | 710 | Open in IMG/M |
| 3300005556|Ga0066707_10029005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 3037 | Open in IMG/M |
| 3300005559|Ga0066700_10168768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium RIFOXYD1_FULL_55_31 | 1495 | Open in IMG/M |
| 3300005564|Ga0070664_101011510 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 781 | Open in IMG/M |
| 3300005713|Ga0066905_100634598 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300005764|Ga0066903_100471144 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300005764|Ga0066903_101445445 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila | 1295 | Open in IMG/M |
| 3300005844|Ga0068862_101414583 | Not Available | 699 | Open in IMG/M |
| 3300005937|Ga0081455_10331336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1080 | Open in IMG/M |
| 3300006844|Ga0075428_100041507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5060 | Open in IMG/M |
| 3300006844|Ga0075428_100150258 | All Organisms → cellular organisms → Bacteria | 2530 | Open in IMG/M |
| 3300006844|Ga0075428_100928714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 922 | Open in IMG/M |
| 3300006844|Ga0075428_101333439 | Not Available | 754 | Open in IMG/M |
| 3300006844|Ga0075428_102328913 | Not Available | 551 | Open in IMG/M |
| 3300006845|Ga0075421_100074337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4288 | Open in IMG/M |
| 3300006846|Ga0075430_100091276 | All Organisms → cellular organisms → Bacteria | 2547 | Open in IMG/M |
| 3300006847|Ga0075431_100099440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3002 | Open in IMG/M |
| 3300006847|Ga0075431_100410833 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 1354 | Open in IMG/M |
| 3300006880|Ga0075429_100930469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 760 | Open in IMG/M |
| 3300006904|Ga0075424_100587867 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300006969|Ga0075419_10322154 | Not Available | 1046 | Open in IMG/M |
| 3300007258|Ga0099793_10004498 | All Organisms → cellular organisms → Bacteria | 4969 | Open in IMG/M |
| 3300009038|Ga0099829_11750248 | Not Available | 510 | Open in IMG/M |
| 3300009089|Ga0099828_10661659 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 939 | Open in IMG/M |
| 3300009090|Ga0099827_11051796 | Not Available | 706 | Open in IMG/M |
| 3300009094|Ga0111539_12432504 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300009100|Ga0075418_10390152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1488 | Open in IMG/M |
| 3300009100|Ga0075418_11668622 | Not Available | 693 | Open in IMG/M |
| 3300009143|Ga0099792_10387171 | Not Available | 852 | Open in IMG/M |
| 3300009143|Ga0099792_10707668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300009147|Ga0114129_10630365 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300009147|Ga0114129_10755168 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300009147|Ga0114129_10951483 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300009147|Ga0114129_12566389 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300009147|Ga0114129_12736279 | Not Available | 587 | Open in IMG/M |
| 3300009156|Ga0111538_13765461 | Not Available | 525 | Open in IMG/M |
| 3300009162|Ga0075423_10462667 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300009162|Ga0075423_10666298 | Polyangium → Polyangium fumosum | 1098 | Open in IMG/M |
| 3300009162|Ga0075423_11673484 | Not Available | 685 | Open in IMG/M |
| 3300009176|Ga0105242_13034853 | Not Available | 520 | Open in IMG/M |
| 3300009792|Ga0126374_10815582 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300009816|Ga0105076_1076134 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300009822|Ga0105066_1030775 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300010043|Ga0126380_10532122 | Not Available | 910 | Open in IMG/M |
| 3300010043|Ga0126380_10542063 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300010043|Ga0126380_10906810 | Not Available | 733 | Open in IMG/M |
| 3300010046|Ga0126384_10185529 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300010046|Ga0126384_10268790 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300010046|Ga0126384_10565835 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 990 | Open in IMG/M |
| 3300010047|Ga0126382_10144726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1617 | Open in IMG/M |
| 3300010047|Ga0126382_10181100 | Not Available | 1479 | Open in IMG/M |
| 3300010047|Ga0126382_10687001 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300010047|Ga0126382_11884237 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 565 | Open in IMG/M |
| 3300010358|Ga0126370_11062129 | Not Available | 744 | Open in IMG/M |
| 3300010358|Ga0126370_11167619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 714 | Open in IMG/M |
| 3300010359|Ga0126376_10066993 | All Organisms → cellular organisms → Bacteria | 2610 | Open in IMG/M |
| 3300010359|Ga0126376_11900729 | Not Available | 635 | Open in IMG/M |
| 3300010359|Ga0126376_12525660 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 562 | Open in IMG/M |
| 3300010361|Ga0126378_11217614 | Not Available | 850 | Open in IMG/M |
| 3300010362|Ga0126377_10911284 | Not Available | 942 | Open in IMG/M |
| 3300010362|Ga0126377_11415261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300010362|Ga0126377_12998092 | Not Available | 545 | Open in IMG/M |
| 3300010366|Ga0126379_10485689 | Not Available | 1304 | Open in IMG/M |
| 3300010366|Ga0126379_12385697 | Not Available | 629 | Open in IMG/M |
| 3300010375|Ga0105239_11154455 | Not Available | 892 | Open in IMG/M |
| 3300010398|Ga0126383_10046516 | All Organisms → cellular organisms → Bacteria | 3584 | Open in IMG/M |
| 3300010398|Ga0126383_10747460 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300011270|Ga0137391_11393245 | Not Available | 547 | Open in IMG/M |
| 3300012189|Ga0137388_10682015 | Not Available | 954 | Open in IMG/M |
| 3300012202|Ga0137363_10444621 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300012202|Ga0137363_10572421 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300012203|Ga0137399_10078642 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis → Arabidopsis thaliana | 2497 | Open in IMG/M |
| 3300012203|Ga0137399_10241903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1478 | Open in IMG/M |
| 3300012205|Ga0137362_10353540 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300012205|Ga0137362_11478081 | Not Available | 566 | Open in IMG/M |
| 3300012206|Ga0137380_10270339 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300012206|Ga0137380_10770436 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300012207|Ga0137381_11475751 | Not Available | 572 | Open in IMG/M |
| 3300012209|Ga0137379_10896411 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300012212|Ga0150985_101779893 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300012212|Ga0150985_117920431 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012359|Ga0137385_11592992 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012361|Ga0137360_11731852 | Not Available | 530 | Open in IMG/M |
| 3300012362|Ga0137361_10293990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1486 | Open in IMG/M |
| 3300012362|Ga0137361_11889272 | Not Available | 514 | Open in IMG/M |
| 3300012363|Ga0137390_10845124 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300012685|Ga0137397_10437800 | Not Available | 974 | Open in IMG/M |
| 3300012922|Ga0137394_10176830 | Not Available | 1820 | Open in IMG/M |
| 3300012925|Ga0137419_10380601 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300012925|Ga0137419_11320889 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber | 607 | Open in IMG/M |
| 3300012927|Ga0137416_11341091 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 647 | Open in IMG/M |
| 3300012944|Ga0137410_10602146 | Not Available | 908 | Open in IMG/M |
| 3300012948|Ga0126375_11274823 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300012948|Ga0126375_11431005 | Not Available | 587 | Open in IMG/M |
| 3300012948|Ga0126375_11550481 | Not Available | 568 | Open in IMG/M |
| 3300012971|Ga0126369_10186773 | All Organisms → cellular organisms → Bacteria | 1986 | Open in IMG/M |
| 3300012971|Ga0126369_10570517 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300012971|Ga0126369_12189071 | Not Available | 640 | Open in IMG/M |
| 3300013306|Ga0163162_10197168 | Not Available | 2142 | Open in IMG/M |
| 3300013306|Ga0163162_11139772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
| 3300013308|Ga0157375_13127807 | Not Available | 552 | Open in IMG/M |
| 3300014968|Ga0157379_12576543 | Not Available | 509 | Open in IMG/M |
| 3300015245|Ga0137409_10069381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3304 | Open in IMG/M |
| 3300015245|Ga0137409_10109101 | All Organisms → cellular organisms → Bacteria | 2560 | Open in IMG/M |
| 3300015264|Ga0137403_10504227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10 | 1081 | Open in IMG/M |
| 3300016319|Ga0182033_10535238 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1011 | Open in IMG/M |
| 3300016319|Ga0182033_11302621 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300016387|Ga0182040_10845303 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 756 | Open in IMG/M |
| 3300016422|Ga0182039_10148604 | Not Available | 1811 | Open in IMG/M |
| 3300021560|Ga0126371_13669709 | Not Available | 518 | Open in IMG/M |
| 3300025945|Ga0207679_10952135 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 786 | Open in IMG/M |
| 3300025961|Ga0207712_10736581 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 863 | Open in IMG/M |
| 3300026023|Ga0207677_10577496 | Not Available | 983 | Open in IMG/M |
| 3300027873|Ga0209814_10009801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3756 | Open in IMG/M |
| 3300027880|Ga0209481_10057291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1817 | Open in IMG/M |
| 3300027880|Ga0209481_10277193 | Not Available | 848 | Open in IMG/M |
| 3300027961|Ga0209853_1155043 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300028587|Ga0247828_10362290 | Not Available | 822 | Open in IMG/M |
| 3300028592|Ga0247822_11129722 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300031941|Ga0310912_10972465 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300031946|Ga0310910_11064332 | Not Available | 631 | Open in IMG/M |
| 3300031954|Ga0306926_12492044 | Not Available | 567 | Open in IMG/M |
| 3300033551|Ga0247830_10447792 | Not Available | 1010 | Open in IMG/M |
| 3300034659|Ga0314780_070838 | Not Available | 742 | Open in IMG/M |
| 3300034660|Ga0314781_094705 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 594 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 21.99% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 19.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.13% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.13% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.42% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1059846211 | 3300000955 | Soil | MLSENHDSFFRLLKNKDFKEERMTKVELYAIDKSTTLESNKSLGRKQDMTPW* |
| Ga0063455_1008963291 | 3300004153 | Soil | LSEKCNSFLRLLKNKGFKEERMTKVGLYAIGTSTTLESNKSLEEK* |
| Ga0066678_102563501 | 3300005181 | Soil | LSEKWNSFLRLLKNKSFKKERMTKVGLYVLGKSTTLESNKS |
| Ga0066675_111839722 | 3300005187 | Soil | LSEKGNSFLRLLKNKGFREESMTKVGLYAIGTSTTLESNKS |
| Ga0065705_107832262 | 3300005294 | Switchgrass Rhizosphere | KRNLCLRLLKNKGFRDESMTKGGSYAIGTSTTLESNKSQGEMYG* |
| Ga0066388_1000605781 | 3300005332 | Tropical Forest Soil | VWSEKGNAFSGLLKNKGFKEERKTKVGLDAIDKSTTLKSNKSPLCMSKGHAQYGR* |
| Ga0066388_1003976871 | 3300005332 | Tropical Forest Soil | LSKNRNSFLNLLKNKGFKEERMTKVGWYAVDTSTTLESNKSLL* |
| Ga0066388_1017456733 | 3300005332 | Tropical Forest Soil | ALSEKHKSFLRLLKNKGFKEESMTKAGLYAIGTSTTLESNKSL* |
| Ga0066388_1052293802 | 3300005332 | Tropical Forest Soil | VRSEKGKAFSGLLQNKGFKEERKTKVGLDAIDKSTTLESNKS |
| Ga0066388_1054526581 | 3300005332 | Tropical Forest Soil | MLSEKRNLFLRLLKNKDFKDESMTKVESYAIGTSTTLESNKSPVR* |
| Ga0066388_1066889822 | 3300005332 | Tropical Forest Soil | MLSEKHNSFLRLLKNKGFKAERRTKNGLYAIGKFTTLESNKSLPS* |
| Ga0066388_1068762532 | 3300005332 | Tropical Forest Soil | LSEKPNSFLRLLKNKGFKEKRITKIRFYAIGTSTTLESNKSL |
| Ga0066388_1084549572 | 3300005332 | Tropical Forest Soil | VLSEKRNLCLRPLKNKGFKDESMTKGGSYAIGTSTTLESNKSL |
| Ga0066388_1085448791 | 3300005332 | Tropical Forest Soil | LSEKHKSFLRLLKNKGFQEESMTKVRLDAIGTSTTLESNKS |
| Ga0070701_106379201 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSEKRSVCLRLLKKKGFKDESMTKGGPYAIATSTTLESNKSL |
| Ga0066707_100290054 | 3300005556 | Soil | LSEKRNSFSGLLKNKGFKEERKTKVGLDAIDKSTTLESNKSYFGSSS* |
| Ga0066700_101687681 | 3300005559 | Soil | NSFLRLLKNKGFKEERMTKVGLYAIGKSTTLESNKSLFGKNQHPS* |
| Ga0070664_1010115102 | 3300005564 | Corn Rhizosphere | VLSKKGNAFLRLLKKKSFKEESLSKARVYAIRTSTPLESNKSLDA* |
| Ga0066905_1006345982 | 3300005713 | Tropical Forest Soil | MLSEKHNSFLRLLKNKGFKAERRTKNGLYPIGTFTTLESNKSLWR* |
| Ga0066903_1004711444 | 3300005764 | Tropical Forest Soil | MLSEKHNSFLRLLKKKGFKEERMTKIGLYTIATFTTLESNKSLS* |
| Ga0066903_1014454451 | 3300005764 | Tropical Forest Soil | ALSEKHKSFLRLLKNKGFKEESMTKVGLYAIGTSTTLESNKSL* |
| Ga0068862_1014145832 | 3300005844 | Switchgrass Rhizosphere | LSEKHNSFLRPLKKKGFKDKRVTTMGLYAIGKSTTLESNKTQGRTSF* |
| Ga0081455_103313363 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LSKKRTSLLRPLKNEGFKEERMTKIGLYAISTSTTLESNKSLHTM* |
| Ga0075428_1000415077 | 3300006844 | Populus Rhizosphere | LSEKHNSFLWLLKNKGFKEERVTKIKLYAIGASKTLESNKSLDR* |
| Ga0075428_1001502582 | 3300006844 | Populus Rhizosphere | EKRNSFSGLLKNKGFKEERKTKVGLDAIDTSTTLESNKSPGGM* |
| Ga0075428_1009287141 | 3300006844 | Populus Rhizosphere | VLSEKRNSFSGLLKNKGFKEERKTKVGLDAIDTSTTLESNKS |
| Ga0075428_1013334392 | 3300006844 | Populus Rhizosphere | LSEKRHSFFRLGKDNGFKEERMTKVGVYALSPSTTLE |
| Ga0075428_1023289131 | 3300006844 | Populus Rhizosphere | LCENRNSFLRLLKNKGFKEEKTTKVGLCAIGKSTTLESNKSL |
| Ga0075421_1000743371 | 3300006845 | Populus Rhizosphere | RNSFSGLLKNKGFKEERKTKVGLDAIDTSTTLESNKSPGGM* |
| Ga0075430_1000912762 | 3300006846 | Populus Rhizosphere | LSEKRNSFSGLLKNKGFKEERKTKVGLDAIDTSTTLESNKSPGGM* |
| Ga0075431_1000994405 | 3300006847 | Populus Rhizosphere | LSEKHNAFLRPLINKGFKEESMTKFGVDAIGLSTTLESNKS |
| Ga0075431_1004108331 | 3300006847 | Populus Rhizosphere | HSFLRLLKNKGFKEEKRTKVGWYAIGKFTTLESNKSVPNC* |
| Ga0075429_1009304691 | 3300006880 | Populus Rhizosphere | VNSFPGLLKNKGFKEERKTKVGLDAIDKSTTLESNKS |
| Ga0075424_1005878671 | 3300006904 | Populus Rhizosphere | MLSEKHNSFLRLLKKKGFKEERRTKIGLYAIGTSTTLESNKS |
| Ga0075419_103221543 | 3300006969 | Populus Rhizosphere | RALYEKDNSFLRLLNNKGFREESMTKVGLYTIGTYTTLESNKSLHALSLLP* |
| Ga0099793_100044984 | 3300007258 | Vadose Zone Soil | MLSKNRNSFLRLLKNKGFKEERMTKVGLYAIDKSTTLESNKSQSVNCSQP* |
| Ga0099829_111122582 | 3300009038 | Vadose Zone Soil | MLLKNKGFKEERRTKIGLYAIGKSMTLESNKSHT* |
| Ga0099829_117502482 | 3300009038 | Vadose Zone Soil | LSEKGNSFLRLLKNKGFREKSMTKVGLYAIGTSTTLESNKSHYFNRDEEEK |
| Ga0099828_106616591 | 3300009089 | Vadose Zone Soil | LSEKHNSFLRLLKKKDFKEERVTTIGLYDIGKSTTLESNKSLIGL* |
| Ga0099827_110517962 | 3300009090 | Vadose Zone Soil | LPEKHDAFFRLLKTEGFKEESMTQVGLYAIGTSTTLESNKS |
| Ga0111539_124325042 | 3300009094 | Populus Rhizosphere | LSKKHHSFLRLLKNKGFKEESMTKVGLDAIGTSTTLESNKS |
| Ga0075418_103901523 | 3300009100 | Populus Rhizosphere | YKLSDSFLRLLINKSFQEVRMTKVGLDSIGTSTTLESNKSLAIN* |
| Ga0075418_116686221 | 3300009100 | Populus Rhizosphere | MFSERCDSFLRLWKNNDFKEERMTKVRLYALGTSMTLESNKSHI* |
| Ga0099792_103871711 | 3300009143 | Vadose Zone Soil | LPEKHDAFFRLLKTEGFKEESMTQVGLYAIGTSTTLESNKSL |
| Ga0099792_107076681 | 3300009143 | Vadose Zone Soil | LSEKHNSFLRPLKKKDFKEERVTTIGLYDIGKSTTLESNKSLWCL |
| Ga0114129_106303651 | 3300009147 | Populus Rhizosphere | VFSETRNAFLRLLKNKSFKEESMAKVRLYASGTSTTLESNKSLFGLRDGN* |
| Ga0114129_107551682 | 3300009147 | Populus Rhizosphere | SGLLKNKGFKEERKTKVGLDAIDTSTTLESNKSPGGM* |
| Ga0114129_109514832 | 3300009147 | Populus Rhizosphere | LSEKYNSLLRLLKNKGFKEERMTKVGLYAIGKSTTLES |
| Ga0114129_125663893 | 3300009147 | Populus Rhizosphere | VLSEKRNLCLRLLTNKGFKDESMTKGGSYAIGTSTTLESNKSQ |
| Ga0114129_127362792 | 3300009147 | Populus Rhizosphere | LSEKHDSFLRLLKNKGFKEEKMTQVELYAIGTSTTLESNKSL |
| Ga0111538_137654612 | 3300009156 | Populus Rhizosphere | LSDNHDSFLRLLKDKHFKEEGMTKVALDAIGTSTTLA |
| Ga0075423_104626672 | 3300009162 | Populus Rhizosphere | MLSKNWNSFLRLLKKKGFKEERMTKVGLYAIGKSTPLESNKSLRVDKW* |
| Ga0075423_106662981 | 3300009162 | Populus Rhizosphere | LSEKHSAFLRPLKNKGCKEESRTKFGVDAIGMSTPLESNKSL* |
| Ga0075423_116734841 | 3300009162 | Populus Rhizosphere | LSEKRDSFLKLLKNKGFKKDSMTQVGLYAISKSTTLESNKS |
| Ga0105242_130348532 | 3300009176 | Miscanthus Rhizosphere | VLSEKRNSFSGLLKNKGFKEERKTKVGLDAIDTSTTLESNKSPG |
| Ga0126374_108155821 | 3300009792 | Tropical Forest Soil | LSEKGDSFLRLLKNKGFREENMTKVGLYAIGTYTTLESNKSHS |
| Ga0105076_10761342 | 3300009816 | Groundwater Sand | LSEKRNSFLRLLKNKGFKEERMTKIELYAIDKSTTLESNKSPDSNLHD* |
| Ga0105066_10307751 | 3300009822 | Groundwater Sand | LSKKRNSFLSLLKNKGFKEESMTKIRLYALGKSTTLESNKSLAQIALV* |
| Ga0126380_105321221 | 3300010043 | Tropical Forest Soil | QLLFLKLQKKKDFTEESMTQVGLDAIGTSTLLDSNKSHVDRCS* |
| Ga0126380_105420632 | 3300010043 | Tropical Forest Soil | VKRNSFLRLLKNKGFKKESMTKVGLYAISKSTTLESNKSQGVLPHAQ* |
| Ga0126380_109068102 | 3300010043 | Tropical Forest Soil | LSENHDSFLRLLKKKDFKEERMTKVELYAIGTSTTLESNKSLLKYHDPGIQ* |
| Ga0126384_101855292 | 3300010046 | Tropical Forest Soil | MLSEKHNSFLRLLKKKGFKEESMTKIGLYTIATFTTLESNKSL* |
| Ga0126384_102687901 | 3300010046 | Tropical Forest Soil | LSEKGDSFLRLLKHKGFREENMTKVGLYAIGTYTT |
| Ga0126384_105658353 | 3300010046 | Tropical Forest Soil | SYALALSEKGDSFLRLLKHKGFREENMTKVGLYAIGTSTTLESNKSHHFLRQKIFL* |
| Ga0126382_101447261 | 3300010047 | Tropical Forest Soil | MLSEKHNAFLRLLKKKGFKERMTKIGLDAIGTSKTLESNKS |
| Ga0126382_101811001 | 3300010047 | Tropical Forest Soil | LSEKRNSFLRLLKNKGFQEENMTQVGWYAVGTATTLESNKS |
| Ga0126382_106870011 | 3300010047 | Tropical Forest Soil | LSEKHDSFLRLLKNKDFKEERRTKVALDAIGTSTTLESNKSL |
| Ga0126382_118842371 | 3300010047 | Tropical Forest Soil | MLSEKHNAFLRLLKKKGFKEESMTKIELDAIGKSKTLEPNKSHP* |
| Ga0126370_110621291 | 3300010358 | Tropical Forest Soil | VWSEKGNAFSGLLKNKGFKEERKTKVGLDAIDKSTTLKSNKSPLC |
| Ga0126370_111676192 | 3300010358 | Tropical Forest Soil | LSEKHNAFLRLLKKKGFKERMTKIGLDAIGTATTLESNKSLRG* |
| Ga0126376_100669931 | 3300010359 | Tropical Forest Soil | LSEKCNSLLRLLKNKGFKEESMTKVGVYAIDTSTTLES |
| Ga0126376_119007291 | 3300010359 | Tropical Forest Soil | APTLSENHDSFLRLLKDKDFKGESMTKVELYAIGTSTTLESNKSQGVL* |
| Ga0126376_125256601 | 3300010359 | Tropical Forest Soil | FLRLLKNKGFKKASMTKVGLYAISTSTTLEANKSLQRFAPE* |
| Ga0126378_112176142 | 3300010361 | Tropical Forest Soil | LSEKHNSFLRLLKKKGFKEESMTKVALDAIGTFTTLESNKSPRPMKIVVDWGHG* |
| Ga0126377_109112843 | 3300010362 | Tropical Forest Soil | SKKHHSFLRLLKNKGFKAESMTQVGLDAIGTSTTLESNKSLVP* |
| Ga0126377_114152612 | 3300010362 | Tropical Forest Soil | MLSEKRNAIFRLLKKKGFKERMTKIGLDAIGTSKTLESNKSLRG* |
| Ga0126377_129980921 | 3300010362 | Tropical Forest Soil | LSAKHNSFLRLLKKKGFKEESTTKVGVYAIGTSTTLESNKSLR |
| Ga0126379_104856891 | 3300010366 | Tropical Forest Soil | LSDSFLRLLKNKAFKKERRTKTGVYAIGEGTPLESNKSL* |
| Ga0126379_123856971 | 3300010366 | Tropical Forest Soil | LSEHHASFLRLWKNKDFKEESMIKVELYAIGLSTTLESNKSHGGLAHG* |
| Ga0105239_111544553 | 3300010375 | Corn Rhizosphere | MVSEKHNSFLRLWKKKGFKEESMTKVRLYALGTSTTLESNKSEVGL* |
| Ga0126383_100465163 | 3300010398 | Tropical Forest Soil | LSEKGDSFLRLLKNKGFREENMTKVGLYVIGTYTTLESNKSHNG* |
| Ga0126383_107474602 | 3300010398 | Tropical Forest Soil | LSEKGNSLLRLLNNKGFREESMTKVELDAIGTSTTLKSNKRPKELATNV* |
| Ga0137391_113932451 | 3300011270 | Vadose Zone Soil | VLSEKCNAFSGLLKNKGFKEERKTKVGLDAIDKSTTLESNKS |
| Ga0137388_106820152 | 3300012189 | Vadose Zone Soil | LSEKGNSFLRLLKNKGFREKSMTKVGLYAIGTSTTLESNKSHYFNRDEEEKSGTKM* |
| Ga0137363_104446213 | 3300012202 | Vadose Zone Soil | LSEKHNSFLRLLKNKGFKEESTTKVGLYAIGTSTTLESNKS |
| Ga0137363_105724212 | 3300012202 | Vadose Zone Soil | FLSLLKNKGFKEESMTKIRLYALGKSTTLESNKSLAQIALV* |
| Ga0137399_100786424 | 3300012203 | Vadose Zone Soil | LPEKHDAFFRLLKTKGFKEESLTQIGWYAIGTSTTLESNKSLAQIALV* |
| Ga0137399_102419034 | 3300012203 | Vadose Zone Soil | LPEKHDAFFRLLKTEGFKEESMTQVGLYAIGTSTTLES |
| Ga0137362_103535403 | 3300012205 | Vadose Zone Soil | LSEKRNSFLRLLKNKGFKEERRIKIGLYAIGKSTTLESNKSQRR |
| Ga0137362_114780811 | 3300012205 | Vadose Zone Soil | LPEKHDAFFRLLKTEGFKEESMTQVGLYAIGTSTTLESNK |
| Ga0137380_102703395 | 3300012206 | Vadose Zone Soil | LSEKHNSFLRLLKKKGFKEETRTKVGLYAIGTSTTLESNKSL |
| Ga0137380_107704362 | 3300012206 | Vadose Zone Soil | LSEKRNSFVRLLKNKGFKEERTTKVELDAIGTSTTLESNKSLP* |
| Ga0137381_114757511 | 3300012207 | Vadose Zone Soil | LSEKRNSFLRLLKNTGFKEERRTKIGLYAIGKSTTLE |
| Ga0137379_108964111 | 3300012209 | Vadose Zone Soil | LSEKHNSFLRLLKNKGFKEESMTKVGLDAIGTSTTLESNKSLRPF |
| Ga0150985_1017798932 | 3300012212 | Avena Fatua Rhizosphere | VLSEKRNLCLRLLKNKGFKDEGMTKGGSYAIGTSTTLESNKSLTRLV* |
| Ga0150985_1179204312 | 3300012212 | Avena Fatua Rhizosphere | LFAKRNPFFRLLKNKGFKEERRIKVGMNALGSSTTLESNKSLSVLHHD* |
| Ga0137385_115929922 | 3300012359 | Vadose Zone Soil | LPEKHDAFFRLLKTEGFKEESMTQVGLYAIGTSTTLESNKSLAQIALV* |
| Ga0137360_117318521 | 3300012361 | Vadose Zone Soil | LSEKRNSFLRLLKNKGFKEERRIKIGLYAIGKSTTLESNKSQ |
| Ga0137361_102939901 | 3300012362 | Vadose Zone Soil | VVSEKRNSFVSLLKKKGFKAERMTKVGLYAIGTSTTLESNKSLAGN* |
| Ga0137361_118892721 | 3300012362 | Vadose Zone Soil | MLSEKRGSFLRLLKNKGFKEESMTKVGLYAIGQSTTLESNK |
| Ga0137390_108451242 | 3300012363 | Vadose Zone Soil | LSEKRNSFLRLLKNKGFKEERRIKIGLYAIGKSTTLESNKSQR |
| Ga0137397_104378002 | 3300012685 | Vadose Zone Soil | LPEKHDAFFRLLKTEGFKEESMTQVGLYAIGTSTTLE |
| Ga0137394_101768301 | 3300012922 | Vadose Zone Soil | KNRNSFLRLLKNKGFKEERMTKVGLYAIDKSTTLESNKSQSVNGSQP* |
| Ga0137419_103806012 | 3300012925 | Vadose Zone Soil | LSEKHKSFLSLLKNKGFKEENMTKIRLYALGTSTTLESNKSLAQIALV* |
| Ga0137419_113208892 | 3300012925 | Vadose Zone Soil | LPEKHDAFFRLLKTEGFKEESMTQVGWYAIGTSTTLES |
| Ga0137416_113410912 | 3300012927 | Vadose Zone Soil | SENRHSFLRPLKKKGFKEERATKVWLYDIGKSTTLESNKSQSVYRTS* |
| Ga0137410_106021462 | 3300012944 | Vadose Zone Soil | MLSEKHNAFLRLLKNKGFKEERMTKVGLYAIDKSTTLESNKSQSVNGSQP* |
| Ga0126375_112748231 | 3300012948 | Tropical Forest Soil | LSEKRNSFLRLLTNKGFKEESMTKVGVDAIDKSTTLESDKSP* |
| Ga0126375_114310052 | 3300012948 | Tropical Forest Soil | WSEKHNSFLRLLKNQGFREESMTKFGWYTIGKTTTLESNKSLVGM* |
| Ga0126375_115504811 | 3300012948 | Tropical Forest Soil | MLSEKHNSFLRRLKKKGFKEESMTKFGWYAIGTSKTLESNKSLLN* |
| Ga0126369_101867731 | 3300012971 | Tropical Forest Soil | HNSFLRLLKNKSFKEESMTKVALDAVGTSTTLESNKSLARM* |
| Ga0126369_105705172 | 3300012971 | Tropical Forest Soil | LTEQHNLFVRLLKNKGFKEERMTKVGLYVIGTSTTLESNKSLI |
| Ga0126369_121890711 | 3300012971 | Tropical Forest Soil | VRSEKGKAFSGLLKNKGFKEERKTKVGLDAIDKSTTLESNKS |
| Ga0163162_101971683 | 3300013306 | Switchgrass Rhizosphere | LSEKHNAFLRLLKNKGFKEERRTKNGMYAISKATTLESNKSLTG* |
| Ga0163162_111397723 | 3300013306 | Switchgrass Rhizosphere | APTLSEKRDSFLRLLKNNDFKEERMTKVELYALGTSTTLESNKSLCWKR* |
| Ga0157375_131278072 | 3300013308 | Miscanthus Rhizosphere | LSEKHNSFLRPLKKKGFKDKRVTTMGLYAIGKSTTLESNKT |
| Ga0157379_125765431 | 3300014968 | Switchgrass Rhizosphere | LSEKHNAFLRLVKKKGFQEERMTKVEVDAIGMSTPLAPNKSLRKMPR* |
| Ga0137409_100693813 | 3300015245 | Vadose Zone Soil | PEKHDAFFRLLKTEGFKEESMTQVGWYAIGTSTTLESNKSLFS* |
| Ga0137409_101091012 | 3300015245 | Vadose Zone Soil | LPEKRNSFLRLLKNKGFKEERMTKVGLYAIDKSTTLESNKSQSVNGSQP* |
| Ga0137403_105042271 | 3300015264 | Vadose Zone Soil | LSEKHNSFLRLLKNEGFKEESTTKVGLYAIGTSTT |
| Ga0182033_105352382 | 3300016319 | Soil | SYAATGSEKRISFLRPLKNNGFKEETGAKILLYAIGTSTTLESNKSQL |
| Ga0182033_113026211 | 3300016319 | Soil | LSEKGNSFLRLLKNKGFREESMTKVGVDAIGTSTTLESNKS |
| Ga0182040_108453031 | 3300016387 | Soil | LSEKGDSFLRLLKHKGFREENMTKIGLYAIGTSTTLESNKSL |
| Ga0182039_101486043 | 3300016422 | Soil | LSEKRNSFLRLLKNKDFKKENLTKVRLYAISKSTTLESNKSLQEM |
| Ga0126371_136697091 | 3300021560 | Tropical Forest Soil | LSAKHNAFVRLLKKKGFKEESTTKVGVYAIGTSTTLESNKSQGRFGFVGIW |
| Ga0207679_109521351 | 3300025945 | Corn Rhizosphere | LSKKGNAFLRLLKKKSFKEESLSKARVYAIRTSTPLESNKSLDA |
| Ga0207712_107365811 | 3300025961 | Switchgrass Rhizosphere | TLSENHDSFLRLLKNKDFKEERMTKVELDAIGTSTPLESNKSLGGYAYTK |
| Ga0207677_105774961 | 3300026023 | Miscanthus Rhizosphere | LSEKHNAFLRLLKKKGFKEERMTKVEVDAIGMSTPLA |
| Ga0209814_100098014 | 3300027873 | Populus Rhizosphere | LSEHDDSFSRLLKNKDFKEESMTKVALYTIGKSTTLESNKSQIFMRMPR |
| Ga0209481_100572912 | 3300027880 | Populus Rhizosphere | LSEKHNSFLWLLKNKGFKEERVTKIKLYAIGASKTLESNKSLDR |
| Ga0209481_102771931 | 3300027880 | Populus Rhizosphere | RALYEKDNSFLRLLNNKGFREESMTKVGLYTIGTYTTLESNKSLHALSLLP |
| Ga0209853_11550432 | 3300027961 | Groundwater Sand | LSEKHKSFLSLLKNKGFKEESMTKIRLYALGKSTTLESNKSLAQIALV |
| Ga0247828_103622902 | 3300028587 | Soil | SYALALSEKRNSFLRLLKSKGFKEESMTKVGLYAIGKSTTLESNKSQP |
| Ga0247822_111297221 | 3300028592 | Soil | VLSEKRNPFSGLLKKKGSKEKRKTKVVLDAIGKSTTLESNKSLEEIQWV |
| Ga0310912_109724651 | 3300031941 | Soil | LSEKGDLFLSPLKNKGFREESIRQVGLYAIGTSTTLESNKS |
| Ga0310910_110643321 | 3300031946 | Soil | LSEKHKSFLRLLKNKGFQEESMTKVRLDAIGTSTTLESNKSLDG |
| Ga0310909_111081401 | 3300031947 | Soil | WIPGSYAPTLSEHHDSFLRLWKNKDFKEERMIKVELYAIGQSTTLESNKSL |
| Ga0306926_124920441 | 3300031954 | Soil | LSEKPNSCLRLLKNQGFKEKRLTKVGFYALGTSTTLATN |
| Ga0247830_104477921 | 3300033551 | Soil | LSEKHNAFLRPLINKGFKEESMTKFGVDAIGLSTTLESNK |
| Ga0314780_070838_499_669 | 3300034659 | Soil | LSEKHNAFLRPLINKGFKEESMTKVGLDAIGTSTTLESNKSLRQIHICGIKTYSEP |
| Ga0314781_094705_445_576 | 3300034660 | Soil | LSEKGDAFLRPLENKGFRKESMIKVGVDAIGQTTTLESNKSLG |
| ⦗Top⦘ |