


| Basic Information | |
|---|---|
| Family ID | F053096 |
| Family Type | Metagenome |
| Number of Sequences | 141 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKYTGPAKPIPTHVELITDKGERVIFLLLAIFLAVFLYLE |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 81.56 % |
| % of genes near scaffold ends (potentially truncated) | 24.82 % |
| % of genes from short scaffolds (< 2000 bps) | 78.72 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (48.936 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment (24.823 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.461 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (36.879 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.88% β-sheet: 0.00% Coil/Unstructured: 69.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF10765 | Phage_P22_NinX | 10.64 |
| PF06067 | DUF932 | 2.84 |
| PF13203 | DUF2201_N | 2.13 |
| PF09967 | DUF2201 | 1.42 |
| PF04389 | Peptidase_M28 | 1.42 |
| PF01870 | Hjc | 0.71 |
| PF11753 | DUF3310 | 0.71 |
| PF13362 | Toprim_3 | 0.71 |
| PF01555 | N6_N4_Mtase | 0.71 |
| PF00271 | Helicase_C | 0.71 |
| PF00476 | DNA_pol_A | 0.71 |
| PF02195 | ParBc | 0.71 |
| PF14279 | HNH_5 | 0.71 |
| PF01844 | HNH | 0.71 |
| PF05732 | RepL | 0.71 |
| PF12705 | PDDEXK_1 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.71 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.71 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG1591 | Holliday junction resolvase Hjc, archaeal type | Replication, recombination and repair [L] | 0.71 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.35 % |
| Unclassified | root | N/A | 48.94 % |
| unclassified Thiobacillus | no rank | unclassified Thiobacillus | 0.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000269|M3P_1029994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300001605|Draft_10251822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas stutzeri group → Pseudomonas stutzeri subgroup → Pseudomonas stutzeri | 1015 | Open in IMG/M |
| 3300002408|B570J29032_109545095 | Not Available | 857 | Open in IMG/M |
| 3300002835|B570J40625_100400513 | All Organisms → Viruses → Predicted Viral | 1334 | Open in IMG/M |
| 3300003430|JGI25921J50272_10032471 | All Organisms → Viruses → Predicted Viral | 1285 | Open in IMG/M |
| 3300004112|Ga0065166_10237186 | Not Available | 729 | Open in IMG/M |
| 3300004481|Ga0069718_10015442 | All Organisms → Viruses → Predicted Viral | 1395 | Open in IMG/M |
| 3300004481|Ga0069718_14548658 | Not Available | 782 | Open in IMG/M |
| 3300004481|Ga0069718_15345888 | All Organisms → Viruses → Predicted Viral | 1159 | Open in IMG/M |
| 3300004481|Ga0069718_15764605 | Not Available | 565 | Open in IMG/M |
| 3300004481|Ga0069718_15784772 | Not Available | 552 | Open in IMG/M |
| 3300005527|Ga0068876_10071670 | All Organisms → Viruses → Predicted Viral | 2088 | Open in IMG/M |
| 3300005527|Ga0068876_10676943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300005581|Ga0049081_10112401 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
| 3300005581|Ga0049081_10150071 | Not Available | 853 | Open in IMG/M |
| 3300005581|Ga0049081_10297869 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005662|Ga0078894_10211569 | All Organisms → Viruses → Predicted Viral | 1756 | Open in IMG/M |
| 3300005662|Ga0078894_10334538 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
| 3300005662|Ga0078894_10550945 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300007165|Ga0079302_1115292 | Not Available | 554 | Open in IMG/M |
| 3300007538|Ga0099851_1101663 | Not Available | 1095 | Open in IMG/M |
| 3300007538|Ga0099851_1234727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300007974|Ga0105747_1108959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
| 3300008107|Ga0114340_1163921 | Not Available | 801 | Open in IMG/M |
| 3300008107|Ga0114340_1235495 | Not Available | 573 | Open in IMG/M |
| 3300008114|Ga0114347_1119472 | Not Available | 989 | Open in IMG/M |
| 3300008267|Ga0114364_1123510 | Not Available | 765 | Open in IMG/M |
| 3300009009|Ga0105105_10084826 | Not Available | 1501 | Open in IMG/M |
| 3300009009|Ga0105105_10852886 | Not Available | 554 | Open in IMG/M |
| 3300009009|Ga0105105_11007177 | Not Available | 518 | Open in IMG/M |
| 3300009009|Ga0105105_11053553 | Not Available | 508 | Open in IMG/M |
| 3300009037|Ga0105093_10231437 | Not Available | 961 | Open in IMG/M |
| 3300009037|Ga0105093_10474476 | Not Available | 693 | Open in IMG/M |
| 3300009037|Ga0105093_10486643 | Not Available | 685 | Open in IMG/M |
| 3300009037|Ga0105093_10653356 | Not Available | 600 | Open in IMG/M |
| 3300009037|Ga0105093_10854879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300009056|Ga0102860_1211020 | Not Available | 557 | Open in IMG/M |
| 3300009081|Ga0105098_10164678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aureimonas → Aureimonas frigidaquae | 1004 | Open in IMG/M |
| 3300009082|Ga0105099_10073924 | All Organisms → Viruses → Predicted Viral | 1833 | Open in IMG/M |
| 3300009082|Ga0105099_10118445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1468 | Open in IMG/M |
| 3300009082|Ga0105099_10141963 | Not Available | 1347 | Open in IMG/M |
| 3300009082|Ga0105099_10408931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
| 3300009082|Ga0105099_10515226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
| 3300009082|Ga0105099_10749434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300009082|Ga0105099_10779542 | Not Available | 597 | Open in IMG/M |
| 3300009082|Ga0105099_11012885 | Not Available | 529 | Open in IMG/M |
| 3300009085|Ga0105103_10292040 | Not Available | 887 | Open in IMG/M |
| 3300009165|Ga0105102_10082087 | Not Available | 1482 | Open in IMG/M |
| 3300009168|Ga0105104_10529536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aureimonas → Aureimonas frigidaquae | 665 | Open in IMG/M |
| 3300009168|Ga0105104_10563487 | Not Available | 646 | Open in IMG/M |
| 3300009168|Ga0105104_10600792 | Not Available | 626 | Open in IMG/M |
| 3300009168|Ga0105104_10977358 | Not Available | 500 | Open in IMG/M |
| 3300009169|Ga0105097_10052364 | All Organisms → Viruses → Predicted Viral | 2199 | Open in IMG/M |
| 3300009169|Ga0105097_10175627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aureimonas → Aureimonas frigidaquae | 1179 | Open in IMG/M |
| 3300009169|Ga0105097_10580676 | Not Available | 630 | Open in IMG/M |
| 3300009419|Ga0114982_1000360 | Not Available | 24568 | Open in IMG/M |
| 3300009419|Ga0114982_1146830 | Not Available | 728 | Open in IMG/M |
| 3300009419|Ga0114982_1219123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300009419|Ga0114982_1251490 | Not Available | 550 | Open in IMG/M |
| 3300009433|Ga0115545_1127630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
| 3300010374|Ga0114986_1033065 | Not Available | 956 | Open in IMG/M |
| 3300010374|Ga0114986_1034257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
| 3300012346|Ga0157141_1000014 | Not Available | 99355 | Open in IMG/M |
| 3300012348|Ga0157140_10001884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2407 | Open in IMG/M |
| 3300012348|Ga0157140_10014756 | Not Available | 810 | Open in IMG/M |
| 3300012665|Ga0157210_1000051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 62859 | Open in IMG/M |
| 3300017707|Ga0181363_1017748 | Not Available | 1412 | Open in IMG/M |
| 3300017716|Ga0181350_1049857 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300017747|Ga0181352_1205628 | Not Available | 505 | Open in IMG/M |
| 3300017754|Ga0181344_1010038 | All Organisms → Viruses → Predicted Viral | 3051 | Open in IMG/M |
| 3300017754|Ga0181344_1019960 | All Organisms → Viruses → Predicted Viral | 2086 | Open in IMG/M |
| 3300017754|Ga0181344_1032358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1596 | Open in IMG/M |
| 3300017754|Ga0181344_1122438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
| 3300017766|Ga0181343_1019738 | All Organisms → Viruses → Predicted Viral | 2093 | Open in IMG/M |
| 3300017766|Ga0181343_1045624 | All Organisms → Viruses → Predicted Viral | 1297 | Open in IMG/M |
| 3300017766|Ga0181343_1064239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
| 3300017766|Ga0181343_1098883 | Not Available | 829 | Open in IMG/M |
| 3300017766|Ga0181343_1116346 | Not Available | 753 | Open in IMG/M |
| 3300020048|Ga0207193_1199993 | Not Available | 1581 | Open in IMG/M |
| 3300020151|Ga0211736_10758565 | All Organisms → Viruses → Predicted Viral | 2769 | Open in IMG/M |
| 3300020159|Ga0211734_10253057 | Not Available | 6016 | Open in IMG/M |
| 3300020160|Ga0211733_10836072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6023 | Open in IMG/M |
| 3300020162|Ga0211735_11371820 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
| 3300020543|Ga0208089_1047963 | Not Available | 566 | Open in IMG/M |
| 3300021961|Ga0222714_10168065 | All Organisms → Viruses → Predicted Viral | 1297 | Open in IMG/M |
| 3300021961|Ga0222714_10265515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
| 3300021961|Ga0222714_10269967 | Not Available | 945 | Open in IMG/M |
| 3300021961|Ga0222714_10275326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
| 3300021962|Ga0222713_10140687 | All Organisms → Viruses → Predicted Viral | 1678 | Open in IMG/M |
| 3300021963|Ga0222712_10006374 | Not Available | 11669 | Open in IMG/M |
| 3300021963|Ga0222712_10010877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8246 | Open in IMG/M |
| 3300022063|Ga0212029_1055279 | Not Available | 577 | Open in IMG/M |
| 3300022179|Ga0181353_1148344 | Not Available | 542 | Open in IMG/M |
| 3300022190|Ga0181354_1096821 | Not Available | 964 | Open in IMG/M |
| 3300022407|Ga0181351_1003697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5604 | Open in IMG/M |
| 3300022407|Ga0181351_1045513 | All Organisms → Viruses → Predicted Viral | 1844 | Open in IMG/M |
| 3300022407|Ga0181351_1152079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 830 | Open in IMG/M |
| 3300027285|Ga0255131_1000145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23075 | Open in IMG/M |
| 3300027285|Ga0255131_1003649 | Not Available | 4124 | Open in IMG/M |
| 3300027300|Ga0255140_1000911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9068 | Open in IMG/M |
| 3300027710|Ga0209599_10148640 | Not Available | 624 | Open in IMG/M |
| 3300027710|Ga0209599_10191773 | Not Available | 550 | Open in IMG/M |
| 3300027721|Ga0209492_1205181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Aureimonas → Aureimonas frigidaquae | 676 | Open in IMG/M |
| 3300027762|Ga0209288_10146725 | Not Available | 758 | Open in IMG/M |
| 3300027762|Ga0209288_10194593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300027792|Ga0209287_10045625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1602 | Open in IMG/M |
| 3300027792|Ga0209287_10061444 | Not Available | 1383 | Open in IMG/M |
| 3300027792|Ga0209287_10087726 | All Organisms → Viruses → Predicted Viral | 1159 | Open in IMG/M |
| 3300027792|Ga0209287_10116228 | unclassified Thiobacillus → Thiobacillus sp. 65-1402 | 1006 | Open in IMG/M |
| 3300027792|Ga0209287_10138233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300027805|Ga0209229_10006043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5060 | Open in IMG/M |
| 3300027808|Ga0209354_10201558 | Not Available | 807 | Open in IMG/M |
| 3300027816|Ga0209990_10060661 | All Organisms → Viruses → Predicted Viral | 1903 | Open in IMG/M |
| 3300028025|Ga0247723_1000154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 43281 | Open in IMG/M |
| 3300028025|Ga0247723_1004585 | Not Available | 6466 | Open in IMG/M |
| 3300028025|Ga0247723_1054065 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1010936 | Not Available | 9482 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1027655 | All Organisms → Viruses → Predicted Viral | 4017 | Open in IMG/M |
| 3300031578|Ga0307376_10036021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3700 | Open in IMG/M |
| 3300031758|Ga0315907_10076423 | All Organisms → Viruses → Predicted Viral | 2893 | Open in IMG/M |
| 3300031758|Ga0315907_10612793 | Not Available | 842 | Open in IMG/M |
| 3300031758|Ga0315907_10634103 | Not Available | 823 | Open in IMG/M |
| 3300031787|Ga0315900_10390568 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
| 3300031787|Ga0315900_11015096 | Not Available | 543 | Open in IMG/M |
| 3300031857|Ga0315909_10664534 | Not Available | 683 | Open in IMG/M |
| 3300031857|Ga0315909_10840738 | Not Available | 574 | Open in IMG/M |
| 3300031951|Ga0315904_10102345 | All Organisms → Viruses → Predicted Viral | 3007 | Open in IMG/M |
| 3300031951|Ga0315904_10547836 | Not Available | 1008 | Open in IMG/M |
| 3300033992|Ga0334992_0280239 | Not Available | 790 | Open in IMG/M |
| 3300033994|Ga0334996_0468461 | Not Available | 572 | Open in IMG/M |
| 3300033996|Ga0334979_0168379 | Not Available | 1312 | Open in IMG/M |
| 3300033996|Ga0334979_0399914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300034018|Ga0334985_0017249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5639 | Open in IMG/M |
| 3300034018|Ga0334985_0019360 | Not Available | 5296 | Open in IMG/M |
| 3300034064|Ga0335001_0015337 | All Organisms → Viruses → Predicted Viral | 4531 | Open in IMG/M |
| 3300034064|Ga0335001_0220406 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
| 3300034066|Ga0335019_0652782 | Not Available | 610 | Open in IMG/M |
| 3300034102|Ga0335029_0075489 | Not Available | 2422 | Open in IMG/M |
| 3300034116|Ga0335068_0092696 | All Organisms → Viruses → Predicted Viral | 1703 | Open in IMG/M |
| 3300034119|Ga0335054_0680404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 554 | Open in IMG/M |
| 3300034356|Ga0335048_0325745 | Not Available | 787 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 24.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.44% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.38% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 6.38% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.96% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 3.55% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.84% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.13% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.13% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.13% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.13% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.71% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.71% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.71% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.71% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.71% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.71% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.71% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000269 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 7, Mississippi Headwaters | Environmental | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
| 3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020543 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300027285 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300027300 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| M3P_10299941 | 3300000269 | Lotic | MTKYTGPAKPIHTHVELISDRAERIIFLLFAIFIAVYLYLE* |
| Draft_102518223 | 3300001605 | Hydrocarbon Resource Environments | MKKYKGPAKPIPTHRELITDKGERIIFLLLAIVAAVFLWLE* |
| B570J29032_1095450951 | 3300002408 | Freshwater | TQGESMRYKGPAKPIPTRREIVSDKAERVVFLLLAIFMAVFLLLE* |
| B570J40625_1004005131 | 3300002835 | Freshwater | GITQGESMRYKGPAKPIPTRREIVSDKAERVVFLLLAIFMAVFLLLE* |
| JGI25921J50272_100324713 | 3300003430 | Freshwater Lake | MKYRGPAKPVPTHIEIVSDKAERVIFLLLAIYLAVFLYLE* |
| Ga0065166_102371861 | 3300004112 | Freshwater Lake | RYTGPAKPLPTHIEIVSDKAERIIFLLLAIYLAVFLYLE* |
| Ga0069718_100154421 | 3300004481 | Sediment | MKRKYKGPPKPIPTHREIISDKAEAVIFILLAIVAAAILYLE* |
| Ga0069718_145486581 | 3300004481 | Sediment | MTKPDNQTKYTGPSKPLPTHVEIISDKAERVIFLLFAVFLAVYFYVEG* |
| Ga0069718_153458882 | 3300004481 | Sediment | MTRYTGPARGIPTHIEIISDKAERVIFLLLAIFMAVFLYLE* |
| Ga0069718_157646051 | 3300004481 | Sediment | MPKYTGPAKPIPTHIELITDKGERIIFLLLAIVAAVILYLE* |
| Ga0069718_157847722 | 3300004481 | Sediment | MPKYTGPAKPIPTHIEIVSDKAERIIFLLLAIYMAVYLYLE* |
| Ga0068876_100716706 | 3300005527 | Freshwater Lake | MPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLAIFLYLE* |
| Ga0068876_106769432 | 3300005527 | Freshwater Lake | MKYRGPAKPIPTHIELITDKGERVIFLLLAIFMAVFLYLE* |
| Ga0049081_101124013 | 3300005581 | Freshwater Lentic | MKKYKGPPKPIPTTREIITDKAERVIFLLLAIFLAVFLWLE* |
| Ga0049081_101500713 | 3300005581 | Freshwater Lentic | MPKYKGPAKPIPTYREPITDKGERIIFLLLAIFLAVYLYLE* |
| Ga0049081_102978692 | 3300005581 | Freshwater Lentic | MKRYTGPAKPIPTYREPITDKGERIIFLLLAIFLAVFLYLE* |
| Ga0078894_102115694 | 3300005662 | Freshwater Lake | MKKYTGPAKPIPTHTEIVSDKAERIIFLILAIVVAVILYVE* |
| Ga0078894_103345383 | 3300005662 | Freshwater Lake | MTRKYKGPARGIPTHIEIVSDKAERIIFLLLAIYLAVVLYVE* |
| Ga0078894_105509452 | 3300005662 | Freshwater Lake | MLEKKPNPLRYTGPAKPLPTHIEIVSDKAERIIFLLLAIYLAVFLYLE* |
| Ga0079302_11152923 | 3300007165 | Deep Subsurface | MKYTGPAKPIPTHVELITDKGERVIFLLLAIVAAVFLYLE* |
| Ga0099851_11016632 | 3300007538 | Aqueous | MKYTGPAKPIPTHVELVTDKAERVIFLLLAIVAAVFLYLE* |
| Ga0099851_12347272 | 3300007538 | Aqueous | MKQSYKGPAEPSPTQRELITDKGERIIFLLLAIFMAVYLWLE* |
| Ga0105747_11089592 | 3300007974 | Estuary Water | MPKYTGPAKPIRTHVELVSDKAERIIFLLFAIFLATYLYLE* |
| Ga0114340_11639211 | 3300008107 | Freshwater, Plankton | AKPIPTHIELITDKGERVIFLLLAIFMAVFLYLE* |
| Ga0114340_12354953 | 3300008107 | Freshwater, Plankton | SNMPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLAIFLYLE* |
| Ga0114347_11194723 | 3300008114 | Freshwater, Plankton | MPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLAVYLYLE* |
| Ga0114364_11235103 | 3300008267 | Freshwater, Plankton | VKYTGPAKPIDTHIELITDRGERIIFLLLAIFMAVYLYLE* |
| Ga0105105_100848261 | 3300009009 | Freshwater Sediment | RRNEMKYTGPAKPIPTHIEIVSDKAERIIFLLLAIFMAVFLYLE* |
| Ga0105105_108528862 | 3300009009 | Freshwater Sediment | MKYTGPAKPIPTHVELITDKGERVIFLLLAIFAAVFLYLE* |
| Ga0105105_110071771 | 3300009009 | Freshwater Sediment | MKYTGPTKPTPTHIEIVSDKAERIIFLLLAVYLAVFLYLE* |
| Ga0105105_110535532 | 3300009009 | Freshwater Sediment | MKRYQGPPKPIPTHIEIVSDKTERVVFLLLAIFMAVYLYLE* |
| Ga0105093_102314374 | 3300009037 | Freshwater Sediment | VKYTGPAKPIPTHVELITDKGERVIFLLLAIVAAVFLYLE* |
| Ga0105093_104744762 | 3300009037 | Freshwater Sediment | MKYTGPAIPTHIELITDKAERVIFLLLAIFLAVFLYLE* |
| Ga0105093_104866431 | 3300009037 | Freshwater Sediment | KYTGPAKPIPTHVELITDKGERVIFLLLAIFIAVFLYLE* |
| Ga0105093_106533562 | 3300009037 | Freshwater Sediment | MKKYTGPAKPIPTHIEIVSDKAERIIFLLLAIFLAVFLWLE* |
| Ga0105093_108548792 | 3300009037 | Freshwater Sediment | MPTKYKGPAEPIPTHVELISDKAERVIFLLFAIFMAVYLYLE* |
| Ga0102860_12110202 | 3300009056 | Estuarine | MPKYTGPAKPIRTHVELISDKAERIIFLLFAIFLATYLYLE* |
| Ga0105098_101646782 | 3300009081 | Freshwater Sediment | MKYTGPAKPIPTHVELITDKGELVIFLLLAIVAAVFLYLD* |
| Ga0105099_100739241 | 3300009082 | Freshwater Sediment | VKYTGPAKPIPTYREPITHKVDRVLFLLALIVLALDLLI |
| Ga0105099_101184451 | 3300009082 | Freshwater Sediment | KLKERDMKRYTGPARGIPTHIEIVSDKAERVIFLLLAIFLAVYLYLE* |
| Ga0105099_101419631 | 3300009082 | Freshwater Sediment | MKYTGPAKPIPTHIELITDKGERVIFLLLAIVAAV |
| Ga0105099_104089311 | 3300009082 | Freshwater Sediment | KYTGPAKPIPTHIEIVSDKAERVIFLLLAIFMAVFLYLE* |
| Ga0105099_105152261 | 3300009082 | Freshwater Sediment | MKYKGPAKPIPTHIEIVSDKAERIIFLLLAIFMAVFLWLE* |
| Ga0105099_107494342 | 3300009082 | Freshwater Sediment | MKKYTGPAKPIPTHRELITDKGERIIFLLLAIFLAVYLWLE* |
| Ga0105099_107795423 | 3300009082 | Freshwater Sediment | VKYTGPAKPIPTHVELITDKGERVIFLLLAIFMAVFLYLE* |
| Ga0105099_110128851 | 3300009082 | Freshwater Sediment | QMKKYTGPAEPIPTHIEIVSDKAERVIFLLLAIVAAVILYLE* |
| Ga0105103_102920402 | 3300009085 | Freshwater Sediment | MKYTGPAKPIPTHTELITDKGERVIFLLLAIFMAVFLYLE* |
| Ga0105102_100820871 | 3300009165 | Freshwater Sediment | MKYTGPAKPIPSHTELIADKAERVIFLLLAIFAAVFLYLE* |
| Ga0105104_105295363 | 3300009168 | Freshwater Sediment | MKYTGPAKPIPTHVELITDKGELVIFLLLAIVAAVFLYLE* |
| Ga0105104_105634872 | 3300009168 | Freshwater Sediment | MKRYTGPAKPIPTYREPITDKGERVIFLLLAIFMAVYLYLEN* |
| Ga0105104_106007923 | 3300009168 | Freshwater Sediment | MKYTGPAKPIPTHTELITDKGERVIFLLLAVVAAVFLYLD* |
| Ga0105104_109773582 | 3300009168 | Freshwater Sediment | MKYTVPSKPIPTHVELISDKTERVIFLLLAIFLAVFLYLE* |
| Ga0105097_100523641 | 3300009169 | Freshwater Sediment | MKYTGPTKPLTTHIELVSDKAERVIFLLLAIFLATYLY |
| Ga0105097_101756274 | 3300009169 | Freshwater Sediment | MKYTGPAKPIPTHVELITDKGELVIFLLLAIVAAVFPYLD* |
| Ga0105097_105806762 | 3300009169 | Freshwater Sediment | MRYTGPAKPIPTHTELITDKGERVIFLLLAVVAAVFLYLE* |
| Ga0114982_100036012 | 3300009419 | Deep Subsurface | MLEKPSKYKGPSKPLPTHVELISDKAERVIFLLFAIFMAVFLYLE* |
| Ga0114982_11468302 | 3300009419 | Deep Subsurface | MRYKGPAKPIPTRHEIVSDKAERVAFLLLAIFMAVFLLLE* |
| Ga0114982_12191231 | 3300009419 | Deep Subsurface | SKPIPTKVEIVSDKAERIIFLLLAFFLAVYLFLE* |
| Ga0114982_12514903 | 3300009419 | Deep Subsurface | MKKYTGPAKPIPTHIELITDKGERVIFLLLAIFMAVYLYLE* |
| Ga0115545_11276304 | 3300009433 | Pelagic Marine | MKKYKPIPTHVELITDKGERVIFLLFAIFMAVYLYLEV* |
| Ga0114986_10330652 | 3300010374 | Deep Subsurface | MKRYTGPSKPIPTKVEIVSDKAERIIFLLLAFFLAVYLFLE* |
| Ga0114986_10342573 | 3300010374 | Deep Subsurface | MKYTGPTKPIHTHIEIVSDKAERVIFLLLAIFLAAYLYLE* |
| Ga0157141_100001413 | 3300012346 | Freshwater | MKRYTGPARGVPTRIEIVSDKAERVIFLLLALFMAVYLYLE* |
| Ga0157140_100018843 | 3300012348 | Freshwater | MKYRGPAKPIPTHVELITDKGERVIFLLLAIFMAAYLYLE* |
| Ga0157140_100147563 | 3300012348 | Freshwater | MTKYTGPAKPIPTHREIISDKAELVIFVLFAIFMVAFLILE* |
| Ga0157210_100005122 | 3300012665 | Freshwater | MPKYNGPAKPIPTYREPITDRGERVIFLLLAIFMAVFLYLE* |
| Ga0181363_10177482 | 3300017707 | Freshwater Lake | MTRKYKGPAEPIPTHIEIVSDKAERIIFLLLAIYLAVFLYVE |
| Ga0181350_10498574 | 3300017716 | Freshwater Lake | MKKYQGPAKPIPTTREIITDKAERVIFLLFAIFLAVYLLVA |
| Ga0181352_12056282 | 3300017747 | Freshwater Lake | MTRKYKGPAKPIPTHIEIVSDKAERIIFLLLAIYLAVVLYVE |
| Ga0181344_10100384 | 3300017754 | Freshwater Lake | MKKYTGPAKPIPTKVEIVSDKAERIIFLLLAVFLAVYLFLE |
| Ga0181344_10199601 | 3300017754 | Freshwater Lake | KYTGPAKPVPTHIEIVSDKAERIIFLLLAIYLAVVLYVE |
| Ga0181344_10323583 | 3300017754 | Freshwater Lake | MKYKGPAKPIPTRIEIVSDKAERVIFLLLAVAFAFIMYLE |
| Ga0181344_11224381 | 3300017754 | Freshwater Lake | TGPAKPIRTHVELVSDKAERIIFLLFAIFLATYLYLE |
| Ga0181343_10197381 | 3300017766 | Freshwater Lake | TRKYKGPAEPIPTHIEIVSDKAERIIFLLLAIYLAVVLYVE |
| Ga0181343_10456242 | 3300017766 | Freshwater Lake | MKKYTGPSKPIPTKVEIVSDKAERIIFLLLAFFLAVYLFLE |
| Ga0181343_10642393 | 3300017766 | Freshwater Lake | MKQSYKGPAKPIPTHIELISDRAERIIFLLLAIFMAVYLYLE |
| Ga0181343_10988833 | 3300017766 | Freshwater Lake | MKYRGPAKPIPTHIEIVSDKAERVIFLLLAIYLAVFLYLE |
| Ga0181343_11163462 | 3300017766 | Freshwater Lake | MKYRGPAKPIPTHSELITDNGERVIFLLLAVLAAVILYLE |
| Ga0207193_11999931 | 3300020048 | Freshwater Lake Sediment | MRYTGPAKPIPTHTELITDKGERVIFLLLAIFLAVYLYLE |
| Ga0211736_107585655 | 3300020151 | Freshwater | MKKYTGPAKPIPTHTEIVSDKAERIIFLILAIVAAVILYVE |
| Ga0211734_102530572 | 3300020159 | Freshwater | VKYTGPAKPIDTETELITDKGERIIFLLLAIFLAVFLYLE |
| Ga0211733_108360727 | 3300020160 | Freshwater | MKQEYKGPSEPIPTHRELISDRAERVIFLLLAIFMAVYLYLE |
| Ga0211735_113718202 | 3300020162 | Freshwater | MKKYTGPAKPIPTHTEIVSDKAERIIFLILAIVVAVILYVE |
| Ga0208089_10479631 | 3300020543 | Freshwater | GITQGESMRYKGPAKPIPTRREIVSDKAERVVFLLLAIFMAVFLLLE |
| Ga0222714_101680653 | 3300021961 | Estuarine Water | MKKYKGPAKPIPTHTEIVSDKAERIIFLLLAIVLAVILYVE |
| Ga0222714_102655152 | 3300021961 | Estuarine Water | MKKPIPTHRELITDKGERIIFLLLAIFMAVYLYLE |
| Ga0222714_102699673 | 3300021961 | Estuarine Water | MPKYTGPAKPIPTHIELITDRGERIIFLLLAIFMAVFLYLD |
| Ga0222714_102753262 | 3300021961 | Estuarine Water | MPKYTGPAKPIPTHIEIISDKAERIIFLLLAIFMAVYLYLE |
| Ga0222713_101406874 | 3300021962 | Estuarine Water | MTRKYTGPAKPVPTHIEIVSDKAERIIFLLLAIYLAVVLYVE |
| Ga0222712_1000637418 | 3300021963 | Estuarine Water | MKYTGPSKPVPTAVEIVSDKAERVIFLLLAIFLAVLLYLE |
| Ga0222712_1001087713 | 3300021963 | Estuarine Water | MSYKGPAKPIPTRCEIVSDKAERVVFLLLAIFMAVFLLLE |
| Ga0212029_10552792 | 3300022063 | Aqueous | MKYTGPAKPIPTHVELVTDKAERVIFLLLAIVAAVFLYLE |
| Ga0181353_11483442 | 3300022179 | Freshwater Lake | MLEKKPNPLRYTGPAKPLPTHIEIVSDKAERIIFLLLAIYLAVFLYLE |
| Ga0181354_10968211 | 3300022190 | Freshwater Lake | MKKYQGPAKPIPTTREIITDKAERVIFLLFAIFLAVYLLVE |
| Ga0181351_10036972 | 3300022407 | Freshwater Lake | MPKYKGPAKPIPTHIELITDKGERIIFLLLAIFMAVYLWLE |
| Ga0181351_10455134 | 3300022407 | Freshwater Lake | MPKYTGPAKPIRTHVELVSDKAERIIFLLFAIFLATYLYLE |
| Ga0181351_11520792 | 3300022407 | Freshwater Lake | MPKYKGPAKPIPTYREPITDKGERIIFLLLAIFLAVYLYLE |
| Ga0255131_100014539 | 3300027285 | Freshwater | MPKYTGPAKPIPTHREHISDKAELIIFALFAIFMVVFLLLE |
| Ga0255131_10036497 | 3300027285 | Freshwater | MPKYTGPAKPIPTHREHISDKAELIIFALFAIFMVVFLFLE |
| Ga0255140_100091117 | 3300027300 | Freshwater | KYTGPAKPIPTHREHISDKAELIIFALFAIFMVVFLLLE |
| Ga0209599_101486402 | 3300027710 | Deep Subsurface | MRYKGPAKPIPTRHEIVSDKAERVAFLLLAIFMAVFLLLE |
| Ga0209599_101917733 | 3300027710 | Deep Subsurface | MKKYTGPAKPIPTHIELITDKGERVIFLLLAIFMAVYLYLE |
| Ga0209492_12051811 | 3300027721 | Freshwater Sediment | MKYTGPAKPIPTHVELITDKGELVIFLLLAIVAAVFPYLD |
| Ga0209288_101467251 | 3300027762 | Freshwater Sediment | MKYTGPAKPIPTHVELITDKGERVIFLLLAIFLAVFLYLE |
| Ga0209288_101945932 | 3300027762 | Freshwater Sediment | MKYTGPKKPTPTHIELVSDKAERIIFLLLAIFMAVFLYLE |
| Ga0209287_100456256 | 3300027792 | Freshwater Sediment | MKRYTGPARGVPTHIEIVSDKAERVIFLLLAIFLAVYLYLE |
| Ga0209287_100614444 | 3300027792 | Freshwater Sediment | MKYTGPANPIPTHVELITDKGERVIFLLLAIFAAVFLYLE |
| Ga0209287_100877261 | 3300027792 | Freshwater Sediment | VKYTGPAKPIPTHVELITDKGERVIFLLLAIVAAVFLYL |
| Ga0209287_101162283 | 3300027792 | Freshwater Sediment | MKYTGPANPIPTHVELITDKGERVIFLLLAIVAAVFLYLE |
| Ga0209287_101382333 | 3300027792 | Freshwater Sediment | MPKYTGPAKPIPTHIEIVSDKAERIIFLLLAIFMAVFLYLE |
| Ga0209229_100060436 | 3300027805 | Freshwater And Sediment | MPKYTGPAKPIRTHVELISDKAERIIFLLFAIFLATYLYLE |
| Ga0209354_102015584 | 3300027808 | Freshwater Lake | QGPAKPIPTTREIITDKAERVIFLLFAIFLAVYLLVE |
| Ga0209990_100606616 | 3300027816 | Freshwater Lake | NLKGSNMPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLAIFLYLE |
| Ga0247723_100015427 | 3300028025 | Deep Subsurface Sediment | MKYKGPPKPLPTHIEIVSDKAERVIFLLLAFFLAVHLYLE |
| Ga0247723_100458516 | 3300028025 | Deep Subsurface Sediment | MKKYTGPAKPIPTKVEIVSDKAERIIFLLLAFFLAVYLFLE |
| Ga0247723_10540653 | 3300028025 | Deep Subsurface Sediment | MKYTGPTKPIHTHIEIVSDKAERVIFLLLAIFLAAYLYLE |
| (restricted) Ga0247843_101093614 | 3300028569 | Freshwater | MKKYTGPAKPIDTHIEIITDKGERIIFLLLAIFLALFLYLE |
| (restricted) Ga0247843_10276554 | 3300028569 | Freshwater | MKRYTGPAKPIPTYREPITDKGERIIFLLLAIFLAVFLYLE |
| Ga0307376_1003602110 | 3300031578 | Soil | MKYTGPAKPIPTHVELITDKGERVIFLLLAIVAAVFLYLE |
| Ga0315907_100764233 | 3300031758 | Freshwater | MKYRGPAKPIPTHIELITDKGERVIFLLLAIFMAVFLYLE |
| Ga0315907_106127933 | 3300031758 | Freshwater | MPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLAIFLYLE |
| Ga0315907_106341033 | 3300031758 | Freshwater | MPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLAVYLYLE |
| Ga0315900_103905683 | 3300031787 | Freshwater | MPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLAIYLYLE |
| Ga0315900_110150963 | 3300031787 | Freshwater | YTGPAKPIDTHIELITDRGERIIFLLLAIFLAIFLYLE |
| Ga0315909_106645341 | 3300031857 | Freshwater | GPAKPIPTHIELITDKGERVIFLLLAIFMAVFLYLE |
| Ga0315909_108407383 | 3300031857 | Freshwater | KYTGPAKPIDTHIELITDRGERIIFLLLAIFLAIFLYLE |
| Ga0315904_101023451 | 3300031951 | Freshwater | MPKYTGPAKPIDTHIELITDRGERIIFLLLAIFLA |
| Ga0315904_105478363 | 3300031951 | Freshwater | YRGPAKPIPTHIELITDKGERVIFLLLAIFMAVFLYLE |
| Ga0334992_0280239_471_596 | 3300033992 | Freshwater | MKKYKGPAKPIPTTREIITDKAERVIFLLFAIFLAVYLLVE |
| Ga0334996_0468461_164_286 | 3300033994 | Freshwater | MKYTGPAKPIPTHIELISDKAERVIFLLLAIVAAVFLYLE |
| Ga0334979_0168379_135_260 | 3300033996 | Freshwater | MKKYQGPAKPLPTRVELISDKAERVIFLLLAIFMAVYLWLE |
| Ga0334979_0399914_2_115 | 3300033996 | Freshwater | MRYKGPAKPIPTRREIVSDKAERVVFLLLAIFMAVFLL |
| Ga0334985_0017249_4916_5038 | 3300034018 | Freshwater | MRYKGPAKPIPTRCEIVSDKAERVVFLLLAIFMAVFLLLE |
| Ga0334985_0019360_3013_3135 | 3300034018 | Freshwater | MRYTGPAKPIPTHTELISDKAERVIFLLLAVVAAVFLYLD |
| Ga0335001_0015337_3_122 | 3300034064 | Freshwater | RYKGPAKPIPTRCEIVSDKAERVVFLLLAIFMAVFLLLE |
| Ga0335001_0220406_94_216 | 3300034064 | Freshwater | MRYKGPAKPIPTRREIVSDKAERVVFLLLAIFMAVFLLLE |
| Ga0335019_0652782_440_565 | 3300034066 | Freshwater | MKKYTGPAKPLPTRVELISDKAERVIFLLLAIFMAVYLWLE |
| Ga0335029_0075489_2310_2420 | 3300034102 | Freshwater | GPAKPIPTHREPITDKGERIIFLLLAIFLAVYLYLE |
| Ga0335068_0092696_560_688 | 3300034116 | Freshwater | MPKYKGPAKPIPTYREPITDKGERIIFLLLAIFLAVFLYLEN |
| Ga0335054_0680404_446_553 | 3300034119 | Freshwater | MKYTGPAKPIPTHTELISDQAERVIFLLLAIVAAVF |
| Ga0335048_0325745_2_118 | 3300034356 | Freshwater | MKKYQGPAKPIPTTREIITDKAERVIFLLFAIFLAVYLL |
| ⦗Top⦘ |