


| Basic Information | |
|---|---|
| Family ID | F053093 |
| Family Type | Metagenome |
| Number of Sequences | 141 |
| Average Sequence Length | 38 residues |
| Representative Sequence | LIQAADGDARALSVEFLRCGQPDPAVAAGDKDILVR |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.71 % |
| % of genes near scaffold ends (potentially truncated) | 99.29 % |
| % of genes from short scaffolds (< 2000 bps) | 92.20 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.454 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (41.135 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.007 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.482 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.06% β-sheet: 0.00% Coil/Unstructured: 60.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF00440 | TetR_N | 10.64 |
| PF02082 | Rrf2 | 7.09 |
| PF07883 | Cupin_2 | 5.67 |
| PF13561 | adh_short_C2 | 2.84 |
| PF16576 | HlyD_D23 | 2.13 |
| PF13460 | NAD_binding_10 | 2.13 |
| PF14588 | YjgF_endoribonc | 2.13 |
| PF16925 | TetR_C_13 | 2.13 |
| PF14534 | DUF4440 | 1.42 |
| PF08240 | ADH_N | 1.42 |
| PF07690 | MFS_1 | 1.42 |
| PF01206 | TusA | 1.42 |
| PF00106 | adh_short | 0.71 |
| PF01152 | Bac_globin | 0.71 |
| PF00873 | ACR_tran | 0.71 |
| PF05368 | NmrA | 0.71 |
| PF00108 | Thiolase_N | 0.71 |
| PF07228 | SpoIIE | 0.71 |
| PF00107 | ADH_zinc_N | 0.71 |
| PF00903 | Glyoxalase | 0.71 |
| PF13545 | HTH_Crp_2 | 0.71 |
| PF00486 | Trans_reg_C | 0.71 |
| PF13565 | HTH_32 | 0.71 |
| PF13701 | DDE_Tnp_1_4 | 0.71 |
| PF02566 | OsmC | 0.71 |
| PF14552 | Tautomerase_2 | 0.71 |
| PF02803 | Thiolase_C | 0.71 |
| PF14497 | GST_C_3 | 0.71 |
| PF10011 | DUF2254 | 0.71 |
| PF02321 | OEP | 0.71 |
| PF07638 | Sigma70_ECF | 0.71 |
| PF00753 | Lactamase_B | 0.71 |
| PF12840 | HTH_20 | 0.71 |
| PF12704 | MacB_PCD | 0.71 |
| PF01548 | DEDD_Tnp_IS110 | 0.71 |
| PF12697 | Abhydrolase_6 | 0.71 |
| PF00857 | Isochorismatase | 0.71 |
| PF13437 | HlyD_3 | 0.71 |
| PF11994 | DUF3489 | 0.71 |
| PF01047 | MarR | 0.71 |
| PF12867 | DinB_2 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 7.09 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 7.09 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 7.09 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 7.09 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 7.09 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 7.09 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 7.09 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 7.09 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 1.42 |
| COG0425 | Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.42 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.42 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.71 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.71 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.71 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.71 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.71 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.71 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.45 % |
| Unclassified | root | N/A | 3.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459014|G1P06HT02HHYHK | Not Available | 671 | Open in IMG/M |
| 3300005332|Ga0066388_100504675 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300007255|Ga0099791_10066224 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300007255|Ga0099791_10087552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1425 | Open in IMG/M |
| 3300007255|Ga0099791_10349362 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300007255|Ga0099791_10382145 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300007265|Ga0099794_10590423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300007265|Ga0099794_10619455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300009038|Ga0099829_11279201 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300009088|Ga0099830_10453373 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300009088|Ga0099830_11413850 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300009088|Ga0099830_11418937 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300009089|Ga0099828_11155776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300009090|Ga0099827_11404036 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300009100|Ga0075418_10785614 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300009101|Ga0105247_10386492 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300009137|Ga0066709_101658790 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300009143|Ga0099792_10036468 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
| 3300009143|Ga0099792_10099391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1525 | Open in IMG/M |
| 3300009143|Ga0099792_10269320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 999 | Open in IMG/M |
| 3300009143|Ga0099792_10788021 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300009147|Ga0114129_10776875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → unclassified Serratia → Serratia sp. M24T3 | 1224 | Open in IMG/M |
| 3300009147|Ga0114129_11582338 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300009147|Ga0114129_12800737 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300009147|Ga0114129_13464117 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300009162|Ga0075423_10025659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5899 | Open in IMG/M |
| 3300009162|Ga0075423_10394890 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300009162|Ga0075423_10740299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1039 | Open in IMG/M |
| 3300009162|Ga0075423_12563373 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300009177|Ga0105248_10527632 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300009792|Ga0126374_10286860 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300010043|Ga0126380_10087175 | All Organisms → cellular organisms → Bacteria | 1830 | Open in IMG/M |
| 3300010043|Ga0126380_10296379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → unclassified Serratia → Serratia sp. M24T3 | 1148 | Open in IMG/M |
| 3300010043|Ga0126380_11680296 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300010043|Ga0126380_11976585 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300010046|Ga0126384_10892399 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300010046|Ga0126384_10912307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300010046|Ga0126384_11481429 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300010046|Ga0126384_12312207 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010047|Ga0126382_10549463 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300010047|Ga0126382_10766107 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300010047|Ga0126382_11318465 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
| 3300010048|Ga0126373_10488001 | Not Available | 1272 | Open in IMG/M |
| 3300010048|Ga0126373_12945544 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300010048|Ga0126373_13236767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 507 | Open in IMG/M |
| 3300010159|Ga0099796_10126230 | Not Available | 988 | Open in IMG/M |
| 3300010304|Ga0134088_10048097 | All Organisms → cellular organisms → Bacteria | 1956 | Open in IMG/M |
| 3300010337|Ga0134062_10712244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300010358|Ga0126370_11116992 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300010359|Ga0126376_12374207 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300010359|Ga0126376_12823894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300010359|Ga0126376_13175165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300010360|Ga0126372_12095337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 613 | Open in IMG/M |
| 3300010360|Ga0126372_12413929 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010361|Ga0126378_10052506 | All Organisms → cellular organisms → Bacteria | 3807 | Open in IMG/M |
| 3300010361|Ga0126378_10109421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni | 2744 | Open in IMG/M |
| 3300010361|Ga0126378_11040518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 921 | Open in IMG/M |
| 3300010361|Ga0126378_11078999 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300010361|Ga0126378_12666413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300010361|Ga0126378_12694105 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010361|Ga0126378_13026687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300010362|Ga0126377_10530119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1213 | Open in IMG/M |
| 3300010362|Ga0126377_12544236 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300010362|Ga0126377_12717676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → unclassified Serratia → Serratia sp. M24T3 | 570 | Open in IMG/M |
| 3300010366|Ga0126379_11257448 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300010366|Ga0126379_12390817 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300010366|Ga0126379_13028053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300010376|Ga0126381_103446178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300010396|Ga0134126_11342207 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300010398|Ga0126383_11367081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 798 | Open in IMG/M |
| 3300010398|Ga0126383_12153382 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010398|Ga0126383_12210704 | Not Available | 636 | Open in IMG/M |
| 3300010398|Ga0126383_12407325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300010403|Ga0134123_13235325 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300011269|Ga0137392_10080358 | All Organisms → cellular organisms → Bacteria | 2529 | Open in IMG/M |
| 3300011271|Ga0137393_10317705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1327 | Open in IMG/M |
| 3300012096|Ga0137389_10853107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300012189|Ga0137388_11464900 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300012189|Ga0137388_11595131 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300012189|Ga0137388_11915399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300012189|Ga0137388_11964753 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012198|Ga0137364_11037474 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300012200|Ga0137382_11165802 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012202|Ga0137363_10239939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1470 | Open in IMG/M |
| 3300012202|Ga0137363_10935525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
| 3300012203|Ga0137399_10327608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1269 | Open in IMG/M |
| 3300012203|Ga0137399_10955281 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300012205|Ga0137362_10887673 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012208|Ga0137376_11224930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300012208|Ga0137376_11616651 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012209|Ga0137379_11363566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 613 | Open in IMG/M |
| 3300012210|Ga0137378_11740879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300012211|Ga0137377_10500212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1154 | Open in IMG/M |
| 3300012211|Ga0137377_11937507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300012285|Ga0137370_10679786 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300012349|Ga0137387_10266452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1237 | Open in IMG/M |
| 3300012349|Ga0137387_10645658 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300012351|Ga0137386_10338487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → unclassified Serratia → Serratia sp. M24T3 | 1083 | Open in IMG/M |
| 3300012354|Ga0137366_10372208 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300012355|Ga0137369_11148358 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300012356|Ga0137371_11249793 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012361|Ga0137360_10023827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4136 | Open in IMG/M |
| 3300012361|Ga0137360_10997022 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300012362|Ga0137361_11211496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300012363|Ga0137390_10797327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300012582|Ga0137358_10403100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 925 | Open in IMG/M |
| 3300012685|Ga0137397_10140381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1787 | Open in IMG/M |
| 3300012896|Ga0157303_10076891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 755 | Open in IMG/M |
| 3300012917|Ga0137395_10047699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2677 | Open in IMG/M |
| 3300012923|Ga0137359_10043953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3873 | Open in IMG/M |
| 3300012923|Ga0137359_10207378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1750 | Open in IMG/M |
| 3300012924|Ga0137413_10018195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3638 | Open in IMG/M |
| 3300012925|Ga0137419_10190597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1511 | Open in IMG/M |
| 3300012929|Ga0137404_12075739 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012930|Ga0137407_10167479 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300012948|Ga0126375_10145803 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300012948|Ga0126375_10148209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1475 | Open in IMG/M |
| 3300012948|Ga0126375_10907996 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300012948|Ga0126375_11078711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300012948|Ga0126375_11366458 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300012961|Ga0164302_10000979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8601 | Open in IMG/M |
| 3300012971|Ga0126369_10430463 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300012971|Ga0126369_10545421 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300012971|Ga0126369_11461734 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300012971|Ga0126369_11533446 | Not Available | 756 | Open in IMG/M |
| 3300012971|Ga0126369_11637095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
| 3300012971|Ga0126369_12674861 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012989|Ga0164305_10891277 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300013296|Ga0157374_11883504 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300013297|Ga0157378_11955788 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300014969|Ga0157376_11668591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → unclassified Serratia → Serratia sp. M24T3 | 672 | Open in IMG/M |
| 3300015358|Ga0134089_10190417 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300015373|Ga0132257_102785193 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300015374|Ga0132255_104351462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300026304|Ga0209240_1000732 | All Organisms → cellular organisms → Bacteria | 13514 | Open in IMG/M |
| 3300027671|Ga0209588_1130014 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300031231|Ga0170824_111982415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1697 | Open in IMG/M |
| 3300031446|Ga0170820_15392993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1012 | Open in IMG/M |
| 3300031564|Ga0318573_10071384 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300032261|Ga0306920_100615141 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300032261|Ga0306920_104295947 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 41.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 35.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.13% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.13% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.71% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2PV_04307890 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | LIQAADGDARALSVEFLRCGQPDPAVAAGDKDILAR |
| Ga0066388_1005046751 | 3300005332 | Tropical Forest Soil | QRPLIQAADGDARALSVEFLRCGQPDPAVAAGDKDILVR* |
| Ga0099791_100662241 | 3300007255 | Vadose Zone Soil | RPLIQAADGDARALSVEFLRCGQPDPAVAAGDKDILVR* |
| Ga0099791_100875523 | 3300007255 | Vadose Zone Soil | IQAADGDARALSVEFLRCGQPDPAVAAGDKDILVR* |
| Ga0099791_103493622 | 3300007255 | Vadose Zone Soil | QAADGDARALSVEFLRCGQPDPAVTAGDKDILVR* |
| Ga0099791_103821452 | 3300007255 | Vadose Zone Soil | QAADGDARALSVEFLRRGQPDPAVAAGDKNILAR* |
| Ga0099794_105904231 | 3300007265 | Vadose Zone Soil | LIQAADGDARALSVEFLRCGQPDPAVAAGDKDILVR* |
| Ga0099794_106194552 | 3300007265 | Vadose Zone Soil | SRLQRPLIQAADGNARALSVEFLRCGQPDSAIAANDEDVLVR* |
| Ga0099829_112792011 | 3300009038 | Vadose Zone Soil | PLIQAADGDARALSVEFLRCGQPDPAVAACDKDILVR* |
| Ga0099830_104533731 | 3300009088 | Vadose Zone Soil | IQAADGDARALSVEFLRCGQPDPAVTAGDKDILVR* |
| Ga0099830_114138501 | 3300009088 | Vadose Zone Soil | LIQAADGDARALSVEFLRCGQPDPAVAAGDKDILAR* |
| Ga0099830_114189371 | 3300009088 | Vadose Zone Soil | LIQAADGNARALSVEFLRCGQPDPAVAARDKDILAR* |
| Ga0099828_111557762 | 3300009089 | Vadose Zone Soil | QAADGNARALSVEFLRCGQPDSAIAAGDEDVLVR* |
| Ga0099827_114040361 | 3300009090 | Vadose Zone Soil | QAADGDARALSVEFLRCGQPDPAVAACDKDILVR* |
| Ga0075418_107856142 | 3300009100 | Populus Rhizosphere | IQAADGDARALSVEFLRRGQPDPAVAAGDQDILFR* |
| Ga0105247_103864921 | 3300009101 | Switchgrass Rhizosphere | LIQAADGDARALSVEFLRCGQPDSAIAAGDEDVLVR* |
| Ga0066709_1016587902 | 3300009137 | Grasslands Soil | PLIQAADGDARSLSVEFLRRGQPDPAVAAGDQDILVR* |
| Ga0099792_100364684 | 3300009143 | Vadose Zone Soil | QAADGDARALSVEFLRCGQPDPAVAAGDKDILVR* |
| Ga0099792_100993911 | 3300009143 | Vadose Zone Soil | IQAADGNARALSVEFLRCGQPDSAIAAGYKDVLVR* |
| Ga0099792_102693202 | 3300009143 | Vadose Zone Soil | LQRPLIQAADGDTRALSVEFLRCGQPDPAVAAGDKDILVR* |
| Ga0099792_107880211 | 3300009143 | Vadose Zone Soil | LIQAADGDARALSVKFLRCGQPDPAVATGDKDILAR* |
| Ga0114129_107768752 | 3300009147 | Populus Rhizosphere | IQAADGDARALSVEFLRCGQPDPAVAAGDEDILAC* |
| Ga0114129_115823381 | 3300009147 | Populus Rhizosphere | IQAADGDARALSVEFLRGGQPDPAVAAGDEDILVS* |
| Ga0114129_128007372 | 3300009147 | Populus Rhizosphere | QRSLIQAADGDARALSVEFLRCGPPDSAVAACDQDILVR* |
| Ga0114129_134641172 | 3300009147 | Populus Rhizosphere | QAADGDARALSVEFLRCGQPNPAVAACDKDILVR* |
| Ga0075423_100256596 | 3300009162 | Populus Rhizosphere | PRIQAADGDARALSVEFLRCGQPDPAVAAGDKDIFAC* |
| Ga0075423_103948903 | 3300009162 | Populus Rhizosphere | RGIIQAADGDTRALSVEFLRCGPPDPAVAAGDKDILVR* |
| Ga0075423_107402991 | 3300009162 | Populus Rhizosphere | LIQAANGDARALSVEFLRCGQADPAIAAGDKDILVR* |
| Ga0075423_125633732 | 3300009162 | Populus Rhizosphere | QRPLIQPADGDARALSFEFLRSRQPDPAVAAGDKDILIR* |
| Ga0105248_105276321 | 3300009177 | Switchgrass Rhizosphere | LIQAADGDARALSVEFLRCGQPDPAVAACDKDILVR* |
| Ga0126374_102868601 | 3300009792 | Tropical Forest Soil | IQAADGNARALSVEFLRCSQPNPAVASGDEDILSH* |
| Ga0126380_100871753 | 3300010043 | Tropical Forest Soil | QRPLIQAADGDSRALLVEFLRCGKPDPAVAAGDKEILVC* |
| Ga0126380_102963793 | 3300010043 | Tropical Forest Soil | GRLQRPLIQAADGDARTLSVEFLGCRQPDPAVAAGDKDILVR* |
| Ga0126380_116802961 | 3300010043 | Tropical Forest Soil | RPLIQATDGDARALSVEFLRCGQPDPAIAACDKDILAG* |
| Ga0126380_119765851 | 3300010043 | Tropical Forest Soil | IQAADGDARALSIEFLRRGQPDPAVAAGDEDILVR* |
| Ga0126384_108923992 | 3300010046 | Tropical Forest Soil | PLIQAADGDARALSVEFLRCGQPDPAVAAGDKDILVR* |
| Ga0126384_109123071 | 3300010046 | Tropical Forest Soil | SRLQRPLIQAADGDARALSVEFLRCGQPDPAIAAGDKDILVR* |
| Ga0126384_114814292 | 3300010046 | Tropical Forest Soil | QRPLIQAADGDARALSVEFLRGGQPDPAVAAGDKDILVS* |
| Ga0126384_123122071 | 3300010046 | Tropical Forest Soil | IQAADGDARALSVEFLRCGQPDPAVAAGDKDVLAC* |
| Ga0126382_105494634 | 3300010047 | Tropical Forest Soil | IQAADGDPRALSVKFPRRGQPDPAVAAGDKDVLVR* |
| Ga0126382_107661071 | 3300010047 | Tropical Forest Soil | LSRLQRPLIQAADGDARALSVEFLRCGQPDPAVTAGDKDILVR* |
| Ga0126382_113184652 | 3300010047 | Tropical Forest Soil | LQRPLIQAADGDARALSVEFLGSSQPDPAVPAGDKNILVR* |
| Ga0126373_104880011 | 3300010048 | Tropical Forest Soil | IQAADGDARALSVEFLRCGQPDPAVAAGDKDILAG* |
| Ga0126373_129455442 | 3300010048 | Tropical Forest Soil | PLIQAADGDARALSVEFLRCGQPDPAVAAGDKEILVR* |
| Ga0126373_132367672 | 3300010048 | Tropical Forest Soil | LIQAADGDARALSVEFLRCGQPDPAVAAGDKNVLAR* |
| Ga0099796_101262301 | 3300010159 | Vadose Zone Soil | LQRPLIQAADGDARALSVEFLRCGQPDPAVAAGDKDILVR* |
| Ga0134088_100480974 | 3300010304 | Grasslands Soil | LIQAADGDARSLSVEFLRRGQPDPAVAAGDKDILVR* |
| Ga0134062_107122443 | 3300010337 | Grasslands Soil | QAADGDARSLSVEFLRRGQPDPAVAAGNKDILGR* |
| Ga0126370_111169921 | 3300010358 | Tropical Forest Soil | LIQAADGDARALSVEFLRCGQPDSAVAAGDKDMLVR* |
| Ga0126376_123742072 | 3300010359 | Tropical Forest Soil | QAADGDAGALSVEFLRCGQPDAAVAACDKDVLAR* |
| Ga0126376_128238942 | 3300010359 | Tropical Forest Soil | QAADGDARALSVEFLRGGQPDPAVAAGNKDIFAR* |
| Ga0126376_131751652 | 3300010359 | Tropical Forest Soil | RLQRPLIQAADGDARALSVEFLRRGQPDPAVAAGDEDILAC* |
| Ga0126372_120953371 | 3300010360 | Tropical Forest Soil | FIQAADGDARALSVEFLRCGQPDPAVAAGDEDIFAR* |
| Ga0126372_124139291 | 3300010360 | Tropical Forest Soil | LIQAADGDARALSVEFLRRGQPDSAVAAGDKDILVR* |
| Ga0126378_100525065 | 3300010361 | Tropical Forest Soil | RLQRPLIQAADGDVRTLSVEFLRCGQPDAAVAACDKDILAR* |
| Ga0126378_101094211 | 3300010361 | Tropical Forest Soil | LIQAADGDARALSVEFLRCGQPDPAVAACDKDILAR* |
| Ga0126378_110405183 | 3300010361 | Tropical Forest Soil | SRLQRPLIQAADGDARALSVEFLRCGQPDPAVAASDKDILAR* |
| Ga0126378_110789992 | 3300010361 | Tropical Forest Soil | LIQAADGDARALSVEFLRCGQPDPAVAAGDKEILAR* |
| Ga0126378_126664132 | 3300010361 | Tropical Forest Soil | RCLQRPLIQPADGDARTLSVKFLRCGQPDSAIAACDEDVLSA* |
| Ga0126378_126941052 | 3300010361 | Tropical Forest Soil | QAADGDAGAFSVEFLSCGQPDPAVAAGDKNVLAR* |
| Ga0126378_130266872 | 3300010361 | Tropical Forest Soil | LIQAADGDTRALSVEFLRCGQPDPAVTAGDKEILAR* |
| Ga0126377_105301191 | 3300010362 | Tropical Forest Soil | PLIQAADGDARALSVEFLRCGQPDPAVAACDKDILAG* |
| Ga0126377_125442362 | 3300010362 | Tropical Forest Soil | DMIQLHCDARALAVDFRRGGRPDPAVAAGDKDILVR* |
| Ga0126377_127176762 | 3300010362 | Tropical Forest Soil | QRPRIQPANGDARALSVEFLRCGQSDPAVTAGDEDILAC* |
| Ga0126379_112574481 | 3300010366 | Tropical Forest Soil | IQAADGDVRTLSVEFLRCGQPDAAVAACDKDILAR* |
| Ga0126379_123908173 | 3300010366 | Tropical Forest Soil | KRLLGRSQRPLIQAADGDARALSVEFLRCGQANPAVAAGDKDILAR* |
| Ga0126379_130280531 | 3300010366 | Tropical Forest Soil | LIQAADGDARALAVEFLRGGQPNPAVAAGDKDILVR* |
| Ga0126381_1034461781 | 3300010376 | Tropical Forest Soil | IQAANGDACALSVEFLRCGQPDSTIAACDEDVLVR* |
| Ga0134126_113422073 | 3300010396 | Terrestrial Soil | RLQRPFIQAADGDARALSVEFLRCGQPDPAVAASDKNILVR* |
| Ga0126383_113670812 | 3300010398 | Tropical Forest Soil | LLSRLQRPLIQAADGDVRALSVEFLRCGQPDPAVAAGDKDIFVR* |
| Ga0126383_121533821 | 3300010398 | Tropical Forest Soil | RPLIQAADGDARALSVEFLRCGQPDPAVAAGDKDILAR* |
| Ga0126383_122107041 | 3300010398 | Tropical Forest Soil | QAADGDARAFFIEFLCCGQPNPAVAACDKDILVR* |
| Ga0126383_124073251 | 3300010398 | Tropical Forest Soil | LSRLQRPLIQAADGDTRAFSVEFLRCGQPDPAVAAGDKDILAR* |
| Ga0134123_132353252 | 3300010403 | Terrestrial Soil | QAADGDARALSVEFLRRGQPDPAVATCDKDILVR* |
| Ga0137392_100803581 | 3300011269 | Vadose Zone Soil | RPLIQAADGDARALSVEFLRCGQPDPAVAAGDKDIFAC* |
| Ga0137393_103177051 | 3300011271 | Vadose Zone Soil | IQAANRDARALSVEFLRCGQPDPAVAAGDKDILVR* |
| Ga0137389_108531073 | 3300012096 | Vadose Zone Soil | SRLQRPLIQAADGDARALSVEFLRCGQPDPAVAAGDKDILVR* |
| Ga0137388_114649002 | 3300012189 | Vadose Zone Soil | PLIQAADGDARALSVEFLRCGQPDPAVAAGDKDIFAC* |
| Ga0137388_115951311 | 3300012189 | Vadose Zone Soil | LIQAADGDARALSVKFLRRGQPDPAVAAGDKDILAR* |
| Ga0137388_119153992 | 3300012189 | Vadose Zone Soil | MIQPYCDARALSIEFLRCGQPDPAVAAGDKDILVR* |
| Ga0137388_119647532 | 3300012189 | Vadose Zone Soil | QAADGDARALSVEFLRRGQPDPAVAAGDKDILVR* |
| Ga0137364_110374742 | 3300012198 | Vadose Zone Soil | LIQAADGDARALSVEFLRCGQPDPAVAAGNKDVFAC* |
| Ga0137382_111658021 | 3300012200 | Vadose Zone Soil | PPIQAAYGDASTLSVEFLRCRQSDPAVAAGDKDILVC* |
| Ga0137363_102399391 | 3300012202 | Vadose Zone Soil | IQAADGDPRALSVEFLRCGQPDPAVAAGDKDLLSR* |
| Ga0137363_109355252 | 3300012202 | Vadose Zone Soil | IQAADGDARALSVEFLRCGQPDPAVAAGDKNILVR* |
| Ga0137399_103276081 | 3300012203 | Vadose Zone Soil | SRLQRPRIQAADGDARARSVEFLRCGQPDPAVAAGDKDIFAC* |
| Ga0137399_109552811 | 3300012203 | Vadose Zone Soil | RLQRPLIQAADGDARALSAEFLRCGQPDPAVTAGDKDILVR* |
| Ga0137362_108876732 | 3300012205 | Vadose Zone Soil | SRLQRPLIQAADGDARALSVEFLRCGQPDPAVAAGNKDILVR* |
| Ga0137376_112249302 | 3300012208 | Vadose Zone Soil | LQGPLIQAADGDTRALSVEFLRCGQPDPAVAAGDKDIFAC* |
| Ga0137376_116166511 | 3300012208 | Vadose Zone Soil | IQAADGNARALSVEFLRCGQPDSAIAAGDEDVLVR* |
| Ga0137379_113635662 | 3300012209 | Vadose Zone Soil | LIQAADGDARALSVEFLRCGQPDPAVTAGDKDILVR* |
| Ga0137378_117408791 | 3300012210 | Vadose Zone Soil | LIQAADGDARALSVEFLRCGQPDPAVAAGDKNILVR* |
| Ga0137377_105002122 | 3300012211 | Vadose Zone Soil | SRLQRPLIQAADGDARALSVKFLRRGQPDPAVAAGDKDILVR* |
| Ga0137377_119375072 | 3300012211 | Vadose Zone Soil | RRLKRRLIQAADGDARALSVEFLRCGQPDPTVAAGDKDILVR* |
| Ga0137370_106797862 | 3300012285 | Vadose Zone Soil | LIQAADGDARALSVEFLRCGQPDPAVAAGDKYILVC* |
| Ga0137387_102664523 | 3300012349 | Vadose Zone Soil | PLIQAADGDARALSFEFLRRGQPDPAVAAGDKDILVR* |
| Ga0137387_106456581 | 3300012349 | Vadose Zone Soil | LIQAADGDARALSIEFLRCGQPDPAVAAGDKDILVR* |
| Ga0137386_103384872 | 3300012351 | Vadose Zone Soil | RPLIQAADGDARALSVEFLRCGQPDPAVTAGDKDILVR* |
| Ga0137366_103722081 | 3300012354 | Vadose Zone Soil | IQAADGDARALSVEFLRCGQPDPAVAAGDKDILAR* |
| Ga0137369_111483582 | 3300012355 | Vadose Zone Soil | LIQAADGDSRALSVEFLRCGQPDPAVAAGDKNILVR* |
| Ga0137371_112497931 | 3300012356 | Vadose Zone Soil | LIQAADGDARALSVEFLRCGQPDPAVAAGDKDILPR* |
| Ga0137360_100238271 | 3300012361 | Vadose Zone Soil | SRLQRPLIQAADGNARALSVEFLRCGQPDSAIAAGDEDILVR* |
| Ga0137360_109970223 | 3300012361 | Vadose Zone Soil | QAADGDARALSVEFLRCGQPDPAVAAGNKDILGR* |
| Ga0137361_112114961 | 3300012362 | Vadose Zone Soil | MIQLHSDARALSVEFLRCGQPDPAVAAGDKDILVR* |
| Ga0137390_107973272 | 3300012363 | Vadose Zone Soil | QAADGNARALSVKFLRCGQPDPAVAAGDEDVLVR* |
| Ga0137358_104031001 | 3300012582 | Vadose Zone Soil | PLIQAADGDGRALSVEFLRCGQPDPAVAAGDKDILAR* |
| Ga0137397_101403811 | 3300012685 | Vadose Zone Soil | LIQAADGDARALSVEFLRCGQPDPAVAARDEDILVR* |
| Ga0157303_100768911 | 3300012896 | Soil | RPLIQAADGDPRALSVEFLRCGQPDPAVAAGDKDILAR* |
| Ga0137395_100476991 | 3300012917 | Vadose Zone Soil | LIQAADGDARALSVEFLRCGQADAAVAAGDKNILVR* |
| Ga0137359_100439535 | 3300012923 | Vadose Zone Soil | LQRPLIHAADGDARALSGEFPRCGQPDPAVAAGDKDILVR* |
| Ga0137359_102073781 | 3300012923 | Vadose Zone Soil | IQAADGDARALSVEFLRCGQPDPAVAARDEDILVR* |
| Ga0137413_100181957 | 3300012924 | Vadose Zone Soil | SRPQRSLIQAADGDARALSVKFLSCGQPDPAVTAGDKDILVR* |
| Ga0137419_101905971 | 3300012925 | Vadose Zone Soil | LQRPLIQAADGDARALSVKFLSRGQPDPAVAAGDKDILVR* |
| Ga0137404_120757391 | 3300012929 | Vadose Zone Soil | IQAADGNARALSVEFLRCGEPDSAIAACDEDVLVR* |
| Ga0137407_101674794 | 3300012930 | Vadose Zone Soil | PLIQAADGDARALSVEFLRCGQPDPAVAAGNKDILGR* |
| Ga0126375_101458032 | 3300012948 | Tropical Forest Soil | IQAADGNACALSVEFMRCGQPDPAIAAGDKDILVR* |
| Ga0126375_101482092 | 3300012948 | Tropical Forest Soil | LLGRLQRPLIQAADGDARALSVEFLRRGQPNPAVAAGDKDILAL* |
| Ga0126375_109079963 | 3300012948 | Tropical Forest Soil | LLSRLQRPFIQAADGDARALSVEFLRCGQPDPAVAAGDKDILVR* |
| Ga0126375_110787112 | 3300012948 | Tropical Forest Soil | QAADGDARALSVEFLRCGQPDPAVAAGNKDIFAR* |
| Ga0126375_113664581 | 3300012948 | Tropical Forest Soil | RSLIQAADGNARALSVEFLRCGQPDSAIAACDEDVLVR* |
| Ga0164302_100009791 | 3300012961 | Soil | LRRLQRPLIQAADGDARALSAEFLRCGPPDPAVTAGDEDILVR* |
| Ga0126369_104304633 | 3300012971 | Tropical Forest Soil | RIQAADGNARALSVEFLRGGKPDPAVAAGDENILAC* |
| Ga0126369_105454211 | 3300012971 | Tropical Forest Soil | RPLIQAADGDARALSVEFLRCGQPDPAVAAGNKDIFAR* |
| Ga0126369_114617341 | 3300012971 | Tropical Forest Soil | RLQRPFIQAADGNARSMSVEFLRCGQPDPAVAAGDKDILVR* |
| Ga0126369_115334463 | 3300012971 | Tropical Forest Soil | MIQLHCDARALSVEILPRCQTDPSVAAGDKDILVR* |
| Ga0126369_116370952 | 3300012971 | Tropical Forest Soil | KGLLGRLQRPLIQAADGDARALSVEFLRCGQPDPAIAASDKDILVR* |
| Ga0126369_126748611 | 3300012971 | Tropical Forest Soil | RPLIQAADGDARALSVEFLRRGQPDPAVAAGDKDILVH* |
| Ga0164305_108912773 | 3300012989 | Soil | QAADGDARALSVEFLRCGQPDPAVAAGDKNILAR* |
| Ga0157374_118835041 | 3300013296 | Miscanthus Rhizosphere | PLIQAADGNARALSVEFLRCGQPDSAIAAGDEDVLVR* |
| Ga0157378_119557882 | 3300013297 | Miscanthus Rhizosphere | VQRPLIQAADGDARALSVEFLRRGQPDPAIATGDEDILVR* |
| Ga0157376_116685912 | 3300014969 | Miscanthus Rhizosphere | LIQAADGDARALSVEFLRCGQPDPAVTAGDEDILVR* |
| Ga0134089_101904172 | 3300015358 | Grasslands Soil | IQAADGDARALSVEFLRCGQPDPTVAAGDKDILAR* |
| Ga0132257_1027851931 | 3300015373 | Arabidopsis Rhizosphere | IQAADGDARALSVEFLRCGQPNPAVAACDKDILVR* |
| Ga0132255_1043514622 | 3300015374 | Arabidopsis Rhizosphere | LQRPLIQAADGDARALSVEFLRCGQPDAAVAAGDKEILVR* |
| Ga0209240_10007321 | 3300026304 | Grasslands Soil | PLIQAADGDARALLVEFLRCGKPDPAVAAGDKDILAR |
| Ga0209588_11300141 | 3300027671 | Vadose Zone Soil | SPLQRPRIQAADGDARALSVEFLRRGQPDPAVAAGDKDILVR |
| Ga0170824_1119824155 | 3300031231 | Forest Soil | QRPLIQAADGDARALSVEFLRRGQPDPAVATCDKDILVR |
| Ga0170820_153929933 | 3300031446 | Forest Soil | LIQAADGDARALSVEFLGCSQPDPAVAAGDEDILVR |
| Ga0318573_100713841 | 3300031564 | Soil | LGRLQRPLIQAADGDARTLSVELLRRGQPNPAVAAGD |
| Ga0306920_1006151413 | 3300032261 | Soil | PLIQAADGDARTLSLELLRRGQPDPAVAAGDKDILVR |
| Ga0306920_1042959472 | 3300032261 | Soil | LQRPLIKAADGDARALSVELLRCSQADPAIAAGDKDILVR |
| ⦗Top⦘ |