


| Basic Information | |
|---|---|
| Family ID | F053026 |
| Family Type | Metagenome |
| Number of Sequences | 141 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKASLAVHLLIAMGMDEHLFMKWQAGKNPKSTKKGPGRKHKQGK |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 9.22 % |
| % of genes near scaffold ends (potentially truncated) | 20.57 % |
| % of genes from short scaffolds (< 2000 bps) | 72.34 % |
| Associated GOLD sequencing projects | 64 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (34.752 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (64.539 % of family members) |
| Environment Ontology (ENVO) | Unclassified (93.617 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (95.035 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.64% β-sheet: 0.00% Coil/Unstructured: 61.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF04466 | Terminase_3 | 21.28 |
| PF00166 | Cpn10 | 17.73 |
| PF02195 | ParBc | 6.38 |
| PF07460 | NUMOD3 | 4.96 |
| PF02945 | Endonuclease_7 | 4.96 |
| PF13392 | HNH_3 | 3.55 |
| PF16510 | P22_portal | 2.13 |
| PF00145 | DNA_methylase | 0.71 |
| PF13539 | Peptidase_M15_4 | 0.71 |
| PF03245 | Phage_lysis | 0.71 |
| PF09374 | PG_binding_3 | 0.71 |
| PF11134 | Phage_stabilise | 0.71 |
| PF15943 | YdaS_antitoxin | 0.71 |
| PF01467 | CTP_transf_like | 0.71 |
| PF11651 | P22_CoatProtein | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 21.28 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 17.73 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.25 % |
| Unclassified | root | N/A | 34.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000162|TB03JUN2009H_c006331 | Not Available | 1928 | Open in IMG/M |
| 3300002933|G310J44882_10022004 | Not Available | 1629 | Open in IMG/M |
| 3300002933|G310J44882_10085758 | Not Available | 668 | Open in IMG/M |
| 3300002933|G310J44882_10107121 | Not Available | 586 | Open in IMG/M |
| 3300003375|JGI26470J50227_1000241 | All Organisms → cellular organisms → Bacteria | 24816 | Open in IMG/M |
| 3300003375|JGI26470J50227_1014725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1846 | Open in IMG/M |
| 3300003375|JGI26470J50227_1019465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1513 | Open in IMG/M |
| 3300003375|JGI26470J50227_1022555 | Not Available | 1357 | Open in IMG/M |
| 3300003375|JGI26470J50227_1036949 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300003375|JGI26470J50227_1040432 | Not Available | 868 | Open in IMG/M |
| 3300003375|JGI26470J50227_1072067 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300003783|Ga0007850_1000003 | All Organisms → Viruses | 35507 | Open in IMG/M |
| 3300003789|Ga0007835_1001909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2599 | Open in IMG/M |
| 3300003789|Ga0007835_1015951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300003797|Ga0007846_1000736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4996 | Open in IMG/M |
| 3300003797|Ga0007846_1005406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1442 | Open in IMG/M |
| 3300003804|Ga0007817_1003139 | Not Available | 1274 | Open in IMG/M |
| 3300003804|Ga0007817_1003731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Straboviridae | 1145 | Open in IMG/M |
| 3300003809|Ga0007869_1010838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 889 | Open in IMG/M |
| 3300003812|Ga0007861_1005634 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
| 3300004095|Ga0007829_10018585 | Not Available | 1335 | Open in IMG/M |
| 3300004684|Ga0065168_1036193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300004686|Ga0065173_1068663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300004687|Ga0065174_1040069 | Not Available | 887 | Open in IMG/M |
| 3300004692|Ga0065171_1018766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1110 | Open in IMG/M |
| 3300004694|Ga0065170_1003080 | Not Available | 2287 | Open in IMG/M |
| 3300004694|Ga0065170_1035712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300004694|Ga0065170_1042801 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300004777|Ga0007827_10024902 | Not Available | 1451 | Open in IMG/M |
| 3300004806|Ga0007854_10058497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1874 | Open in IMG/M |
| 3300004806|Ga0007854_10061683 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300004806|Ga0007854_10086663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1457 | Open in IMG/M |
| 3300004806|Ga0007854_10130061 | Not Available | 1122 | Open in IMG/M |
| 3300004807|Ga0007809_10084352 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 984 | Open in IMG/M |
| 3300004807|Ga0007809_10087161 | Not Available | 964 | Open in IMG/M |
| 3300004807|Ga0007809_10139428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 720 | Open in IMG/M |
| 3300006071|Ga0007876_1017676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2018 | Open in IMG/M |
| 3300006071|Ga0007876_1018429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1974 | Open in IMG/M |
| 3300006071|Ga0007876_1124827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300006072|Ga0007881_1022687 | All Organisms → Viruses → Predicted Viral | 1740 | Open in IMG/M |
| 3300006100|Ga0007806_1004051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3956 | Open in IMG/M |
| 3300006100|Ga0007806_1016306 | All Organisms → Viruses → Predicted Viral | 1618 | Open in IMG/M |
| 3300006100|Ga0007806_1018092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1504 | Open in IMG/M |
| 3300006103|Ga0007813_1075950 | Not Available | 663 | Open in IMG/M |
| 3300006104|Ga0007882_10201004 | Not Available | 677 | Open in IMG/M |
| 3300006105|Ga0007819_1029146 | Not Available | 1270 | Open in IMG/M |
| 3300006106|Ga0007833_1006651 | Not Available | 2442 | Open in IMG/M |
| 3300006106|Ga0007833_1010156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1927 | Open in IMG/M |
| 3300006107|Ga0007836_1043730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 990 | Open in IMG/M |
| 3300006108|Ga0007862_1000929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8612 | Open in IMG/M |
| 3300006108|Ga0007862_1018339 | Not Available | 1570 | Open in IMG/M |
| 3300006108|Ga0007862_1019515 | Not Available | 1513 | Open in IMG/M |
| 3300006108|Ga0007862_1038166 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300006112|Ga0007857_1098174 | Not Available | 530 | Open in IMG/M |
| 3300006115|Ga0007816_1056674 | Not Available | 880 | Open in IMG/M |
| 3300006117|Ga0007818_1032620 | Not Available | 1015 | Open in IMG/M |
| 3300006119|Ga0007866_1000040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 34277 | Open in IMG/M |
| 3300006126|Ga0007855_1003623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4162 | Open in IMG/M |
| 3300006127|Ga0007805_1087420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300006128|Ga0007828_1017001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1532 | Open in IMG/M |
| 3300006129|Ga0007834_1050197 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300009175|Ga0073936_10134339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1906 | Open in IMG/M |
| 3300009502|Ga0114951_10014786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5645 | Open in IMG/M |
| 3300009502|Ga0114951_10227453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
| 3300009502|Ga0114951_10401389 | Not Available | 683 | Open in IMG/M |
| 3300013093|Ga0164296_1000824 | Not Available | 35236 | Open in IMG/M |
| 3300013093|Ga0164296_1017221 | All Organisms → cellular organisms → Bacteria | 4780 | Open in IMG/M |
| 3300013093|Ga0164296_1018639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 4483 | Open in IMG/M |
| 3300013093|Ga0164296_1211040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300013093|Ga0164296_1385529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300013094|Ga0164297_10039478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2464 | Open in IMG/M |
| 3300013094|Ga0164297_10095344 | Not Available | 1272 | Open in IMG/M |
| 3300013094|Ga0164297_10108716 | Not Available | 1160 | Open in IMG/M |
| 3300013094|Ga0164297_10285102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300020725|Ga0214200_1035045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300020731|Ga0214170_1012056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1665 | Open in IMG/M |
| 3300020735|Ga0214219_1025087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 949 | Open in IMG/M |
| 3300020735|Ga0214219_1042536 | Not Available | 671 | Open in IMG/M |
| 3300020735|Ga0214219_1068141 | Not Available | 500 | Open in IMG/M |
| 3300021127|Ga0214193_1028962 | Not Available | 651 | Open in IMG/M |
| 3300021131|Ga0214206_1004062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2678 | Open in IMG/M |
| 3300021131|Ga0214206_1005002 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2295 | Open in IMG/M |
| 3300021135|Ga0214247_1007548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2527 | Open in IMG/M |
| 3300021138|Ga0214164_1036179 | Not Available | 1186 | Open in IMG/M |
| 3300021138|Ga0214164_1065053 | Not Available | 752 | Open in IMG/M |
| 3300021139|Ga0214166_1028406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1342 | Open in IMG/M |
| 3300021139|Ga0214166_1040216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1060 | Open in IMG/M |
| 3300021142|Ga0214192_1009219 | Not Available | 4094 | Open in IMG/M |
| 3300021142|Ga0214192_1026591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1992 | Open in IMG/M |
| 3300021142|Ga0214192_1072373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1002 | Open in IMG/M |
| 3300022555|Ga0212088_10084540 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3032 | Open in IMG/M |
| 3300022555|Ga0212088_10104846 | Not Available | 2577 | Open in IMG/M |
| 3300022555|Ga0212088_10150991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1962 | Open in IMG/M |
| 3300022591|Ga0236341_1000215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36438 | Open in IMG/M |
| 3300025162|Ga0209083_1019256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 3481 | Open in IMG/M |
| 3300025162|Ga0209083_1106021 | Not Available | 1114 | Open in IMG/M |
| 3300025316|Ga0209697_10056197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2963 | Open in IMG/M |
| 3300025339|Ga0208502_1003917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1305 | Open in IMG/M |
| 3300025358|Ga0208504_1017037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1001 | Open in IMG/M |
| 3300025372|Ga0207957_1005841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1913 | Open in IMG/M |
| 3300025372|Ga0207957_1014886 | Not Available | 1002 | Open in IMG/M |
| 3300025381|Ga0208871_1005425 | All Organisms → Viruses → Predicted Viral | 2397 | Open in IMG/M |
| 3300025382|Ga0208256_1004405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2486 | Open in IMG/M |
| 3300025383|Ga0208250_1000084 | Not Available | 33730 | Open in IMG/M |
| 3300025383|Ga0208250_1019305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1162 | Open in IMG/M |
| 3300025385|Ga0207956_1005986 | Not Available | 2048 | Open in IMG/M |
| 3300025385|Ga0207956_1042952 | Not Available | 568 | Open in IMG/M |
| 3300025387|Ga0207959_1000053 | Not Available | 34653 | Open in IMG/M |
| 3300025387|Ga0207959_1004611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2716 | Open in IMG/M |
| 3300025387|Ga0207959_1005788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2372 | Open in IMG/M |
| 3300025387|Ga0207959_1012665 | Not Available | 1473 | Open in IMG/M |
| 3300025387|Ga0207959_1036790 | Not Available | 765 | Open in IMG/M |
| 3300025389|Ga0208257_1002312 | All Organisms → Viruses → Predicted Viral | 4126 | Open in IMG/M |
| 3300025389|Ga0208257_1050277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300025392|Ga0208380_1001997 | Not Available | 4540 | Open in IMG/M |
| 3300025400|Ga0208387_1002703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4116 | Open in IMG/M |
| 3300025403|Ga0208745_1041685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300025407|Ga0208378_1062657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300025411|Ga0208865_1009181 | All Organisms → Viruses → Predicted Viral | 1980 | Open in IMG/M |
| 3300025417|Ga0208616_1002191 | All Organisms → Viruses → Predicted Viral | 3890 | Open in IMG/M |
| 3300025417|Ga0208616_1010506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1536 | Open in IMG/M |
| 3300025421|Ga0207958_1022548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1025 | Open in IMG/M |
| 3300025421|Ga0207958_1065341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300025424|Ga0208617_1062859 | Not Available | 661 | Open in IMG/M |
| 3300025426|Ga0208739_1054257 | Not Available | 646 | Open in IMG/M |
| 3300025429|Ga0208500_1017656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300025429|Ga0208500_1038173 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300025430|Ga0208622_1005835 | All Organisms → Viruses → Predicted Viral | 3142 | Open in IMG/M |
| 3300025430|Ga0208622_1072273 | Not Available | 583 | Open in IMG/M |
| 3300025487|Ga0208105_1005488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2938 | Open in IMG/M |
| 3300025487|Ga0208105_1029673 | Not Available | 1034 | Open in IMG/M |
| 3300025598|Ga0208379_1080236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300025648|Ga0208507_1126896 | Not Available | 725 | Open in IMG/M |
| 3300025782|Ga0208867_1036150 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300031759|Ga0316219_1001043 | Not Available | 32794 | Open in IMG/M |
| 3300031759|Ga0316219_1135807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
| 3300032117|Ga0316218_1152177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300032560|Ga0316223_1103330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
| 3300032562|Ga0316226_1068307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1765 | Open in IMG/M |
| 3300032665|Ga0316221_1290718 | Not Available | 513 | Open in IMG/M |
| 3300032676|Ga0316229_1210300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 64.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 10.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 8.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.26% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 3.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 2.13% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000162 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 | Environmental | Open in IMG/M |
| 3300003789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 | Environmental | Open in IMG/M |
| 3300003797 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 | Environmental | Open in IMG/M |
| 3300003804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 | Environmental | Open in IMG/M |
| 3300003809 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 | Environmental | Open in IMG/M |
| 3300003812 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004687 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
| 3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
| 3300004777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 | Environmental | Open in IMG/M |
| 3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
| 3300006106 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07 | Environmental | Open in IMG/M |
| 3300006107 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07 | Environmental | Open in IMG/M |
| 3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
| 3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
| 3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
| 3300006117 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 | Environmental | Open in IMG/M |
| 3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
| 3300006126 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH01Aug08 | Environmental | Open in IMG/M |
| 3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300006129 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300020725 | Freshwater microbial communities from Trout Bog Lake, WI - 23OCT2008 epilimnion | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300020735 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021127 | Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021135 | Freshwater microbial communities from Trout Bog Lake, WI - 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300025162 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025339 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025381 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025385 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025403 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025411 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025424 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025429 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025487 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025648 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025782 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
| 3300032560 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| 3300032676 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009H_0063313 | 3300000162 | Freshwater | MKASLAVHLLIALGFDEHLFMKWKVGKNPSYTKKGPGRTHKQGKKNDI* |
| G310J44882_100220042 | 3300002933 | Freshwater | MRASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHRQGKKNDI* |
| G310J44882_100857582 | 3300002933 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNFKFTKKGPGRKHKQCKK* |
| G310J44882_101071213 | 3300002933 | Freshwater | MTTLAVHLYIALGVDEHLFMKWKSGKNPHSTKSGPGRKHKQGKKNV* |
| JGI26470J50227_10002414 | 3300003375 | Freshwater | MTTXAVHLYIALGVDXHLFMKWKSGKNPHSTKSGPGRKHXQGKKNV* |
| JGI26470J50227_10147254 | 3300003375 | Freshwater | MKANLAVHLLIAMGVDEYVFMKWQAGANPHSTKKGPGRKHKQGNK* |
| JGI26470J50227_10194651 | 3300003375 | Freshwater | MRASLAVHLLIALGFDEHLFMKWQVGKNPSYTKKGTGRKHRQGKQNDI* |
| JGI26470J50227_10225556 | 3300003375 | Freshwater | MKTTLAVHIYVALGLDEHLFMKWKSGKNPKSTKKGPGRKHKQGA* |
| JGI26470J50227_10369494 | 3300003375 | Freshwater | MRASLAVHLLIALGFDEHLFMKWQVGKNPSYTKKGPGRTHKQGNK* |
| JGI26470J50227_10404322 | 3300003375 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHXQGKKK* |
| JGI26470J50227_10720673 | 3300003375 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNFKSTKKGPGRKHKQGNK* |
| Ga0007850_100000331 | 3300003783 | Freshwater | MSNLAVHLLVAMGVDEHLFMKWRSGKNPKATKKGPGRRHKQG* |
| Ga0007835_10019094 | 3300003789 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNPKSTKKGPGRKHKQGK* |
| Ga0007835_10159512 | 3300003789 | Freshwater | MRASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHQQGKRK* |
| Ga0007846_10007365 | 3300003797 | Freshwater | MKASLAVHLLIAMGVDEYVFMKWQAGANPHSTKKGPGRKHKQGKK* |
| Ga0007846_10054062 | 3300003797 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHRQGKQNDI* |
| Ga0007817_10031392 | 3300003804 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQSGANPHSTKKGPGRKHKQGKK* |
| Ga0007817_10037313 | 3300003804 | Freshwater | MRASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHRQGKQNDI* |
| Ga0007869_10108383 | 3300003809 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHRQGKQNDI |
| Ga0007861_10056345 | 3300003812 | Freshwater | MSTLAVHLLIAMGVDEHLFMKWRSGKNFHSTKKGPGRRHKQGKK* |
| Ga0007829_100185851 | 3300004095 | Freshwater | MKASLAVHLLIAMGMDENLFMKWQAGKNFKSTKKGPGRKHKQCNK* |
| Ga0065168_10361931 | 3300004684 | Freshwater | MKASLAVHLLIALGFDEHLFMKWKVGKNPSYTKKGPGRTHKQGKQNDI* |
| Ga0065173_10686632 | 3300004686 | Freshwater | MKASLAVHLLIAMGVDEYVFMKWQAGANPYSTKKGPGRKHKQGKK*LN* |
| Ga0065174_10400693 | 3300004687 | Freshwater | MKASLAVHLLIAMGVDEYVFMKWQAGANPYSTKKGPGRKHKQGKK* |
| Ga0065171_10187664 | 3300004692 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQSGANPHSTKKGPGRKHSQGKK* |
| Ga0065170_10030803 | 3300004694 | Freshwater | MKNVAVPLLIYLGVDKDTFMYWRSSKNLKFTKKGPGRKHKQGK* |
| Ga0065170_10357121 | 3300004694 | Freshwater | MTTLAVHLYIALGVDEHLFMKWKSGKNPHSTKSGPGRKHQQGKKNV* |
| Ga0065170_10428011 | 3300004694 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQVGKNPSYTKKGTGRKHRQGKQNDI* |
| Ga0007827_100249022 | 3300004777 | Freshwater | MSNLAVHIYVALGLDEHLFMKWKSGKNPKSTKKGPGRKHKQGA* |
| Ga0007854_100584973 | 3300004806 | Freshwater | MRASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHQQGKKK* |
| Ga0007854_100616832 | 3300004806 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQASKNSSYTKKGTGRKHRQGKKK* |
| Ga0007854_100866635 | 3300004806 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPCYTKKGPGRAHKQGKKNDI* |
| Ga0007854_101300612 | 3300004806 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHRQGKKNDI* |
| Ga0007809_100843523 | 3300004807 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHKQGKQNDI* |
| Ga0007809_100871611 | 3300004807 | Freshwater | MKANLAVHIYVALGLDEHLFMKWKSGKNPKSTKKGPGRKHKQGA* |
| Ga0007809_101394281 | 3300004807 | Freshwater | MRASLAVHLLIALGFDEHLFMKWQAGKNSSYTKKGTGRKHKQGKKK* |
| Ga0007876_10176763 | 3300006071 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQVGKNPSYTKKGPGRTHKQGKKNDI* |
| Ga0007876_10184293 | 3300006071 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQSGANPHSTKKGPGRKHAQGKK* |
| Ga0007876_11248272 | 3300006071 | Freshwater | MKASLAVHLLIAMGVDEYVFMKWQAGANPHSTKKGPGRKHKQGKK*LN* |
| Ga0007881_10226874 | 3300006072 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNFKFTKKGPGRKHKQVNK* |
| Ga0007806_10040515 | 3300006100 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQAGANPHSTKKGPGRKHKQGKK* |
| Ga0007806_10163061 | 3300006100 | Freshwater | FDEHLFMKWQAGKNPSYTKKGTGRKHRQGKQNDI* |
| Ga0007806_10180921 | 3300006100 | Freshwater | MKASLAVHLLIAMGVDEYVFMKWQAGANPHSTKKGPG |
| Ga0007813_10759503 | 3300006103 | Freshwater | LIAMGMDEHLFMKWQAGKNFKSTKKGPGRKHKQCNK* |
| Ga0007882_102010043 | 3300006104 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHQQGKKK* |
| Ga0007819_10291466 | 3300006105 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNFKSTKKGPGRKHKQCNK* |
| Ga0007833_10066518 | 3300006106 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNFKSTKKGPGRKHKQGKKELNRVTNEL* |
| Ga0007833_10101561 | 3300006106 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTG |
| Ga0007836_10437303 | 3300006107 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQASKNPKSTKKGPGRKHKQGK* |
| Ga0007862_10009299 | 3300006108 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNFKSTKKGPGRKHKQGKK* |
| Ga0007862_10183396 | 3300006108 | Freshwater | MSNLVVHLLIAMGMDEHLFMKWQAGKNFKSTKKGPGRKHKQGK* |
| Ga0007862_10195153 | 3300006108 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQSGKNPKSTKKGPGRKHKQGK* |
| Ga0007862_10381662 | 3300006108 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQSGANPHSTKKGPGRKHAQGKKK* |
| Ga0007857_10981742 | 3300006112 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNFKFTKKGPGRKHKQCNK* |
| Ga0007816_10566743 | 3300006115 | Freshwater | IAMGMDEHLFMKWQAGKNFKSTKKGPGRKHKQCNK* |
| Ga0007818_10326205 | 3300006117 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQAGANPHSTKKGPG |
| Ga0007866_100004057 | 3300006119 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNPKSTKKGPGRKHQQGKKNV* |
| Ga0007855_10036233 | 3300006126 | Freshwater | MRASLAVHLLIALGFDEHLFMKWQAGKNPCYTKKGPGRAHKQGKKNDI* |
| Ga0007805_10874201 | 3300006127 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHQQGKRK* |
| Ga0007828_10170011 | 3300006128 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQSGANPHSTKKGPGRKHSQGRK* |
| Ga0007834_10501973 | 3300006129 | Freshwater | MKASLAVHLLIALGFDEHLFMKWKIGKNPSYTKKGPGRTHKQGKQNDI* |
| Ga0073936_101343394 | 3300009175 | Freshwater Lake Hypolimnion | MSTLAVHLLIAMGVDEHVFMKWQAGANPHSTKKGPGRKHKQGNK* |
| Ga0114951_100147862 | 3300009502 | Freshwater | MKASLAVHLLIAMGVDEHLFLKWQAGANPHSTKKGPGRKHKQGKK* |
| Ga0114951_102274532 | 3300009502 | Freshwater | MKANLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHKEGKK* |
| Ga0114951_104013892 | 3300009502 | Freshwater | MKANLAVHLLIAMGVDEHVFMKWQAGANPHSTKKGPGRKHKQGKK* |
| Ga0164296_100082419 | 3300013093 | Freshwater | MKATLAVHLLIAMGMDEHLFMKWKSGKNPHSTKSGPGRKHQQGKKNV* |
| Ga0164296_10172217 | 3300013093 | Freshwater | MRASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHKQGKQNDI* |
| Ga0164296_10186393 | 3300013093 | Freshwater | MKTTLAVHLLVAMGVDEHLFMKWRSGKNFHSTKKGPGRKHKGK* |
| Ga0164296_12110401 | 3300013093 | Freshwater | LLIALGFDEHLFMKWQVGKNPSYTKKGTGRKHRQGKQNDI* |
| Ga0164296_13855292 | 3300013093 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQVGKNPSYTKKGPGRAHKQGKKK* |
| Ga0164297_100394784 | 3300013094 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQVGKNPSYTKKGTGRKHQQGKKK* |
| Ga0164297_100953441 | 3300013094 | Freshwater | MRASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHQQGK |
| Ga0164297_101087164 | 3300013094 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGPGRAHKQGKQNDI* |
| Ga0164297_102851023 | 3300013094 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKH |
| Ga0214200_10350455 | 3300020725 | Freshwater | GFDEHLFMKWKVGKNPSYTKKGPGRTHKQGKKNDI |
| Ga0214170_10120563 | 3300020731 | Freshwater | MRASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHRQGKKNDI |
| Ga0214219_10250872 | 3300020735 | Freshwater | MTTLAVHLYIALGVDEHLFMKWKSGKNPHSTKSGPGRKHKQGKKNV |
| Ga0214219_10425363 | 3300020735 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNFKFTKKGPGRKHKQCKK |
| Ga0214219_10681412 | 3300020735 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNPKSTKKGPGRKHKQGK |
| Ga0214193_10289622 | 3300021127 | Freshwater | MKASLAVHLLIAMGVDEYVFMKWQAGANPHSTKKGPGRKHKQGKK |
| Ga0214206_10040622 | 3300021131 | Freshwater | MKANLAVHLLIAMGVDEYVFMKWQAGANPHSTKKGPGRKHKQGNK |
| Ga0214206_10050024 | 3300021131 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQSGANPHSTKKGPGRKHAQGKK |
| Ga0214247_10075489 | 3300021135 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHKQGKKK |
| Ga0214164_10361792 | 3300021138 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHQQGKKK |
| Ga0214164_10650531 | 3300021138 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQVGKNPSYTKKGTGRKHRQGKQNDI |
| Ga0214166_10284064 | 3300021139 | Freshwater | MRASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHQQGKKK |
| Ga0214166_10402163 | 3300021139 | Freshwater | MKASLAVHLLIALGFDEHLFMKLQAGKNPSYTKKGTGRKHQQGKKNDI |
| Ga0214192_10092195 | 3300021142 | Freshwater | MSNLAVHLLVAMGVDEHLFMKWRSGKNPKATKKGPGRRHKQG |
| Ga0214192_10265911 | 3300021142 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPCYTKKGTGRKHQQGKKK |
| Ga0214192_10723734 | 3300021142 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQAGANPHSTKKGPGRKHKQGKK |
| Ga0212088_100845403 | 3300022555 | Freshwater Lake Hypolimnion | MKASLAVHLLIAMGVDEHLFLKWQAGANPHSTKKGPGRKHKQGKK |
| Ga0212088_101048462 | 3300022555 | Freshwater Lake Hypolimnion | MSTLAVHLLIAMGVDEHVFMKWQAGANPHSTKKGPGRKHKQGNK |
| Ga0212088_101509912 | 3300022555 | Freshwater Lake Hypolimnion | MKANLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHKEGKK |
| Ga0236341_100021539 | 3300022591 | Freshwater | MKATLAVHLLIAMGMDEHLFMKWQAGKNSKSTKKGPGRKHKQGR |
| Ga0209083_10192566 | 3300025162 | Freshwater | MKANLAVHLLIAMGVDEHVFMKWQAGANPHSTKKGPGRKHKQGKK |
| Ga0209083_11060216 | 3300025162 | Freshwater | MKASLAVHLLIALGFDEHLFMKWRSGKNFHSTKKGPGRRHKGK |
| Ga0209697_100561975 | 3300025316 | Freshwater Lake Hypolimnion | KGQEKKMSTLAVHLLIAMGVDEHVFMKWQAGANPHSTKKGPGRKHKQGNK |
| Ga0208502_10039172 | 3300025339 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNPKSTKKGPGRKHQQGKKNV |
| Ga0208504_10170373 | 3300025358 | Freshwater | MRASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHQQGKRK |
| Ga0207957_10058413 | 3300025372 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQSGANPHSTKKGPGRKHSQGKK |
| Ga0207957_10148863 | 3300025372 | Freshwater | MSNLAVHIYVALGLDEHLFMKWKSGKNPKSTKKGPGRKHKQGA |
| Ga0208871_10054254 | 3300025381 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNFKFTKKGPGRKHKQVNK |
| Ga0208256_10044055 | 3300025382 | Freshwater | MSNLVVHLLIAMGMDEHLFMKWQAGKNFKSTKKGPGRKHKQGK |
| Ga0208250_100008425 | 3300025383 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQVGKNPSYTKKGPGRTHKQGKKNDI |
| Ga0208250_10193055 | 3300025383 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQAGANPHSTKKGPGRKHAQGKK |
| Ga0207956_10059861 | 3300025385 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNFKSTKKGPGRKHK |
| Ga0207956_10429523 | 3300025385 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQAGKNPKSTKKGPGR |
| Ga0207959_100005351 | 3300025387 | Freshwater | MSTLAVHLLIAMGVDEHLFMKWRSGKNFHSTKKGPGRRHKQGKK |
| Ga0207959_10046115 | 3300025387 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHKQGKQNDI |
| Ga0207959_10057881 | 3300025387 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQSGKNPKSTKKGPGRKHKQGK |
| Ga0207959_10126652 | 3300025387 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQSGANPHSTKKGPGRKHAQGKKK |
| Ga0207959_10367901 | 3300025387 | Freshwater | MTTLAVHLYIALGVDEHLFMKWKSGKNPHSTKSGPGRKH |
| Ga0208257_10023125 | 3300025389 | Freshwater | MKATLAVHLLIAMGMDEHLFMKWQAGKNSKSTKKGPGRKHKQGK |
| Ga0208257_10502771 | 3300025389 | Freshwater | VHLYIALGVDEHLFMKWKSGKNPHSTKSGPGRKHQQGKKNV |
| Ga0208380_10019976 | 3300025392 | Freshwater | SLAVHLLIAMGMDEHLFMKWQAGKNPKSTKKGPGRKHKQGK |
| Ga0208387_10027035 | 3300025400 | Freshwater | LAVHLLIALGFDEHLFMKWQVGKNPSYTKKGPGRTHKQGKKNDI |
| Ga0208745_10416853 | 3300025403 | Freshwater | MKASLAVHLLIAMGVDEYVFMKWQAGANPHSTKKGPGRKHKQGKKXLN |
| Ga0208378_10626571 | 3300025407 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQSGANPHSTKKGPGRKHA |
| Ga0208865_10091815 | 3300025411 | Freshwater | GFDEHLFMKWQAGKNPSYTKKGTGRKHRQGKQNDI |
| Ga0208616_10021912 | 3300025417 | Freshwater | MKASLAVHLLIAMGMDEHLFMKWQASKNPKSTKKGPGRKHKQGK |
| Ga0208616_10105061 | 3300025417 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQSGANPHSTKKGPGRKHSQGRK |
| Ga0207958_10225484 | 3300025421 | Freshwater | EEMKASLAVHLLIAMGMDEHLFMKWQAGKNPKSTKKGPGRKHKQGK |
| Ga0207958_10653413 | 3300025421 | Freshwater | VHLLIAMGVDEYVFMKWQAGANPHSTKKGPGRKHKQGKK |
| Ga0208617_10628592 | 3300025424 | Freshwater | MKASLAVHLLIALGFDEHLFMKWKIGKNPSYTKKGPGRTHKQGKQNDI |
| Ga0208739_10542571 | 3300025426 | Freshwater | LIAMGMDEHLFMKWQAGKNFKFTKKGPGRKHKQGKK |
| Ga0208500_10176562 | 3300025429 | Freshwater | MTTLAVHLYIALGVDEHLFMKWKSGKNPHSTKSGPGRKHQQGKKNV |
| Ga0208500_10381731 | 3300025429 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQSGANPHSTKKG |
| Ga0208622_10058355 | 3300025430 | Freshwater | IALGFDEHLFMKWQAGKNPSYTKKGTGRKHRQGKQNDI |
| Ga0208622_10722733 | 3300025430 | Freshwater | MKASLAVHLLIAMGMDENLFMKWQAGKNFKFTKKGPGRKHKQVNK |
| Ga0208105_10054885 | 3300025487 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNFKSTKKGPGRKHKQGKK |
| Ga0208105_10296733 | 3300025487 | Freshwater | MKASLAVHLLIAMGVDEYVFMKWQAGANPHSTKKGPGRKHKQGK |
| Ga0208379_10802363 | 3300025598 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHRQGKKNDI |
| Ga0208507_11268961 | 3300025648 | Freshwater | AVHLLIAMGMDEHLFMKWQAGKNFKFTKKGPGRKHKQVNK |
| Ga0208867_10361503 | 3300025782 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQAGKNPCYTKKGPGR |
| Ga0316219_100104341 | 3300031759 | Freshwater | MKASLAVHLLIAMGIDEHLFMKWQAGKNFKSTKKGPGRKHKQGNK |
| Ga0316219_11358073 | 3300031759 | Freshwater | MKASLAVHLLIAMGVDEHLFMKWQSGANPHSTKKGPGRKHKQGKK |
| Ga0316218_11521774 | 3300032117 | Freshwater | KSQEKEMKASLAVHLLIALGFDEHLFMKWQVGKNPSYTKKGPGRTHKQGKKK |
| Ga0316223_11033303 | 3300032560 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQVGKNPSYTKKGPGRTHKQGKKK |
| Ga0316226_10683073 | 3300032562 | Freshwater | MKASLAVHLLIALGFDEHLFMKWQVGKNPSYTKKGPGRAHKQGKQNDI |
| Ga0316221_12907182 | 3300032665 | Freshwater | MRASLAVHLLIALGFDEHLFMKWQAGKNPSYTKKGTGRKHRQGKKK |
| Ga0316229_12103004 | 3300032676 | Freshwater | LLIALGFDEHLFMKWKVGKNPSYTKKGPGRAHKQGKQNDI |
| ⦗Top⦘ |