


| Basic Information | |
|---|---|
| Family ID | F052879 |
| Family Type | Metagenome |
| Number of Sequences | 142 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MRHWSKFKSDWIADAMQWGKMTREEAEDYWDKQEYRDS |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 142 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 78.17 % |
| % of genes near scaffold ends (potentially truncated) | 11.97 % |
| % of genes from short scaffolds (< 2000 bps) | 76.06 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.197 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (28.169 % of family members) |
| Environment Ontology (ENVO) | Unclassified (87.324 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.915 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.94% β-sheet: 0.00% Coil/Unstructured: 56.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 142 Family Scaffolds |
|---|---|---|
| PF12224 | Amidoligase_2 | 11.27 |
| PF00145 | DNA_methylase | 4.93 |
| PF13155 | Toprim_2 | 2.82 |
| PF06094 | GGACT | 2.11 |
| PF12708 | Pectate_lyase_3 | 1.41 |
| PF03592 | Terminase_2 | 1.41 |
| PF14090 | HTH_39 | 0.70 |
| PF01555 | N6_N4_Mtase | 0.70 |
| PF13392 | HNH_3 | 0.70 |
| PF03237 | Terminase_6N | 0.70 |
| PF02794 | HlyC | 0.70 |
| PF01464 | SLT | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 4.93 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 1.41 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.70 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.70 |
| COG2994 | ACP:hemolysin acyltransferase (hemolysin-activating protein) | Posttranslational modification, protein turnover, chaperones [O] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.20 % |
| All Organisms | root | All Organisms | 33.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 28.17% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 11.27% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 10.56% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.86% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.45% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 5.63% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 4.23% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 4.23% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.52% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.82% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 2.11% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.41% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.41% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.41% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.41% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.41% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.70% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.70% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001853 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 | Environmental | Open in IMG/M |
| 3300001952 | Marine microbial communities from Newport Harbor, Rhode Island, USA - GS008 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009601 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031608 | Marine microbial communities from water near the shore, Antarctic Ocean - #1 | Environmental | Open in IMG/M |
| 3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031694 | Marine microbial communities from water near the shore, Antarctic Ocean - #231 | Environmental | Open in IMG/M |
| 3300031706 | Marine microbial communities from David Island wharf, Antarctic Ocean - #36 | Environmental | Open in IMG/M |
| 3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100330663 | 3300000101 | Marine | MRHWSKFKSDWIADAMQWGKMTREEAEDYWDKQEYRDS* |
| DelMOSum2010_100348706 | 3300000101 | Marine | MDSERHWSKFKRQWIEDAMHWCDMTKAEALDYWDKQEYRGE* |
| DelMOSum2010_101006305 | 3300000101 | Marine | MNSERHWSKFKRQWIEDAMRWGDMTKAEALNYWEQQEYRDE* |
| DelMOSum2010_101058147 | 3300000101 | Marine | ENKMNSERHWSKFKRQWIEDAMRWGDMTKAEALNYWEQQEYRDK* |
| DelMOSum2010_101128882 | 3300000101 | Marine | MNSERHWSKFKRQWIEDAMRWGDMTKAEALNYWEQQEYRDK* |
| DelMOSum2010_101250111 | 3300000101 | Marine | MEYWSKFKSDWIADAMQWGKMTREEAEDYWDKQEYRDS* |
| DelMOSum2010_102357802 | 3300000101 | Marine | MDSERHWSKFKRQWIEDAMRWGDMTKAEALNHWEQQEYRDE* |
| DelMOSum2010_102365473 | 3300000101 | Marine | MANEKYWSEFKRQWIEDAMHWCNMNKIEALDYWDKQEYRDE* |
| DelMOSum2010_102625792 | 3300000101 | Marine | MDSEKHWSKFKKQWIEDAMRWGHMTKAEALECWDQQEYRDE* |
| DelMOSum2011_100257906 | 3300000115 | Marine | MTNFKRDWIADAMEHGKMTREQAEHCWQQQEYREG* |
| DelMOSum2011_100711561 | 3300000115 | Marine | MKHWSKFKRDWIADAMEHGKMTREQAKDCWDKQDYRDS* |
| DelMOSum2011_101728612 | 3300000115 | Marine | MDNFKRDWILDAMEHGKMTKEEAEHCWQQQEYREG* |
| DelMOSpr2010_100179652 | 3300000116 | Marine | MKNFPSHWSKFKSDWIADAMEHGKMTREEAEDSWDKQEYRDS* |
| DelMOSpr2010_100268753 | 3300000116 | Marine | MKHWSKFKRDWIADAMEHGKMTREQAKDCWDKQEYRDS* |
| DelMOSpr2010_100685483 | 3300000116 | Marine | MKHWSKFKTDWIADAMQWGKMNRAEAEDCWDKQEYRDE* |
| DelMOSpr2010_102268462 | 3300000116 | Marine | MNSERHWSKFKRQWIEDAMRWCDMTKAEALDYWEQQEYRGE* |
| JGI24006J15134_100257782 | 3300001450 | Marine | MRHWSKFKADWIADAMEHGKMTREQAKDYWDKQEYRDE* |
| JGI24006J15134_100570322 | 3300001450 | Marine | MKHWSKFKSDWIADAMQWGKMSRAEAEDFWDKQEYRDS* |
| JGI24006J15134_101295392 | 3300001450 | Marine | MKNFPSHWSKFKSDWIADAMQWGKMNRAEAEDCWDKQEYRDS* |
| JGI24006J15134_101570382 | 3300001450 | Marine | MKNFPSHWSKFKSDWIADAMEHGKMTREEAEDDLDKQEYRDS* |
| JGI24006J15134_101584803 | 3300001450 | Marine | MKNFPSHWSKFKSDWIADAMEHGKMNREEAEDSWDKQEYRDS* |
| JGI24006J15134_102268122 | 3300001450 | Marine | MRYWSKFKSDWIADAMQWGKMNRAEAEDYWDKQEYRDS* |
| JGI24004J15324_100302852 | 3300001472 | Marine | MKHWSKFKSDWIADAMEHGKMTREEAEDYWDKQEYRES* |
| JGI24004J15324_101022411 | 3300001472 | Marine | MRHWSKFKSDWIADAMQWGKMNRAEAEDYWDKQEYR |
| JGI24524J20080_10057672 | 3300001853 | Marine | MKHWSKFKSDWIADAMQWGKMSRAEAEDYWDKQEYRDS* |
| GOS2224_10265153 | 3300001952 | Marine | MYNFKRDWILDAMEHGKMTREEAEHCWQQQEYREG* |
| Ga0075462_100106495 | 3300006027 | Aqueous | MKHWSKFKSDWIADAMQWGKMNRAEAEDYWDKQEYRDS* |
| Ga0075441_101655483 | 3300006164 | Marine | MENFPSHWSKFKSDWIADAMQSGSMTRQEAEDYWDKQEYRDA* |
| Ga0075441_102031941 | 3300006164 | Marine | MSKFKSDWIADAMEHGKMNRAEAEDCWDKQEYRDE* |
| Ga0075441_103219493 | 3300006164 | Marine | MRHWSKFKSDWIADAMEHGKMNRAEAEDCWDKQEYRDEYLVNEDY* |
| Ga0075441_103943542 | 3300006164 | Marine | MKHWSKFKSDWIADAMEHGKMNRAEAEDFWDKQEYRDS* |
| Ga0075446_100629152 | 3300006190 | Marine | MKHWSKFKSDWIADAMQWGSMTREEAEDYWDKQEYRDA* |
| Ga0075446_100689063 | 3300006190 | Marine | MRHWSKFKSDWIADAMQWGKMNRAEAEDCWYKQEYRDS* |
| Ga0075446_101086661 | 3300006190 | Marine | WSKFKSDWIADAMEHGKMNRAEAEDCWDKQEYRDEYLVNEDY* |
| Ga0075447_100504723 | 3300006191 | Marine | MKHWSKFKKDWIADAMEHGNMTREQAKDCWDKQEYRDA* |
| Ga0075447_101679812 | 3300006191 | Marine | MRHWSKFKTDWIADAMEHGKMTREQAEDYWDKQEYRD* |
| Ga0098048_10407882 | 3300006752 | Marine | MDSERHWSKFKRQWIEDAMRWGHMTKAEALDYWDKQEYRGK* |
| Ga0098048_11615491 | 3300006752 | Marine | MNSKRHWSKFKRQWIEDAMRWGDMTKAEALDYWDKQEYRGE* |
| Ga0070754_104469263 | 3300006810 | Aqueous | MSKFKSDWIADAMEHGKMNRAEAEDCWDKQEYRDS* |
| Ga0070748_10208672 | 3300006920 | Aqueous | MDNFKRDWILDAMEHGKMTREEAEHCWQQQEYREG* |
| Ga0075469_101066311 | 3300007231 | Aqueous | ETMSKFKRDWIADAMEHGKMTREQAEHCWQQQEYREG* |
| Ga0114916_10881341 | 3300008221 | Deep Ocean | MRHWSKFKTDWIADAMEHGKMTREQAEDCWDKQEYRD* |
| Ga0115566_101753653 | 3300009071 | Pelagic Marine | MRHWSKFKSDWIADAMQSGNMTREEAEDCWDKQEYRDA* |
| Ga0114995_102467492 | 3300009172 | Marine | MKHWSKFKSDWIADAMEHGKMNRAEAEDCWDKQEYRDS* |
| Ga0114995_103347301 | 3300009172 | Marine | MKNFPSYWSKFKSDWIADAMQWGKMNRAEAEDCWDKQEYRDS* |
| Ga0114915_10143475 | 3300009428 | Deep Ocean | MENFPSHWSKFKSDWIADAMQSGRMTRAEAEDDWDKQEYRDQ* |
| Ga0115005_100469444 | 3300009432 | Marine | MTQFKKDWIADAMEHGGMTREQALHSWEQQEYRDC* |
| Ga0115559_10402474 | 3300009438 | Pelagic Marine | MRQWSKFKSDWISDAMEHGKMNRAEAERLWNQQEYRDE* |
| Ga0115565_101080623 | 3300009467 | Pelagic Marine | MTDFKRDWIADAMEHGKMTREQAEHCWEQQDYREG* |
| Ga0115565_104253032 | 3300009467 | Pelagic Marine | MKENTMTSFKRDWIADAMEHGKMTREQAENCWEQQEYRNG* |
| Ga0115571_10435125 | 3300009495 | Pelagic Marine | MKGLNKMNSKRHWSKFKRQWIEDAMRWGAMTKAEALDYWDKQEYRDE* |
| Ga0115571_11401072 | 3300009495 | Pelagic Marine | MNSERHWSKFKRQWIEDAMRWGAMTKAEALDYWDKQEYRGE* |
| Ga0115570_104992712 | 3300009496 | Pelagic Marine | MLKRRENKMNSERHWSKFKRQWIEDAMRWGAMTKAEALDYWDKQEYRGE* |
| Ga0115564_101354563 | 3300009505 | Pelagic Marine | MDSERHWSKFKRQWIEDAMRWGDMTKAEALDYWDKQEYKGE* |
| Ga0115564_106326962 | 3300009505 | Pelagic Marine | VKENKMDSERHWSKFKRQWIEDAMRWGAMTKAEALNYWEQQEYRDK* |
| Ga0115572_106520272 | 3300009507 | Pelagic Marine | MNSERHWSKFKRQWIEDAMHWGDMTKAEALDYWDKQEYRDE* |
| Ga0115003_104410541 | 3300009512 | Marine | MENFPSHWSKFKSDWIADAMQWGRMTRAEAEDAWDKQEYRDQ* |
| Ga0115003_107882063 | 3300009512 | Marine | MKHWSKFKSDWIADAMQWGKMTREEAEDYWDQQEYRDS* |
| Ga0114914_10163925 | 3300009601 | Deep Ocean | MRHWSKFKTDWIADAMEHGKITRKQAEDDWDKQEYRDE* |
| Ga0115001_101741914 | 3300009785 | Marine | MGNFPSYWSKFKSDWIADAMEHCKMTREEAEDSWDKQEYRDS* |
| Ga0151674_10663723 | 3300011252 | Marine | VSLNNIKTKKGLNKMDSERHWSKFKRQWIEDAMRWGDMTKAEALNYWQQQEYRDE* |
| Ga0151671_10808472 | 3300011253 | Marine | VSLNNIKTKKGLNKMDSERHWSKFKRQWIEDAMRWGYMTKAEALNHWEQQEYRDE* |
| Ga0180120_100181088 | 3300017697 | Freshwater To Marine Saline Gradient | MYNFKRDWILDAMEHGKMTREEAEHCWQQQEYREG |
| Ga0180120_101812172 | 3300017697 | Freshwater To Marine Saline Gradient | MNSERHWSKFKRQWIEDAMRWCDMTKAEALDYWDKQEYRGK |
| Ga0181398_10327631 | 3300017725 | Seawater | MKNFPSYWSKFKSDWIADAMQSGNMTREEAEDCWDKQEYRDA |
| Ga0181419_10546542 | 3300017728 | Seawater | MDTEKHWSKFKKQWIEDAMRWGHMTKAEALDCWDQQEYRDE |
| Ga0181424_104271931 | 3300017786 | Seawater | MRHWSKFKSDWIADAMQWGKMNRAEAEDYCDKQEYRDS |
| Ga0206125_1000351932 | 3300020165 | Seawater | VSLDNIKLKQKENKMNSKRHWSKFKRQWIEDAMHWGDMTKAEALDYWDKQEYRDE |
| Ga0206125_100888884 | 3300020165 | Seawater | MNNEKYWSKFKRQWIEDAMHWCNMNKAEALDYWDKQEYKGE |
| Ga0206124_102686361 | 3300020175 | Seawater | MNSKRHWSKFKRQWIEDAMHWGDMTKAEALDYWDKQEYRDE |
| Ga0206126_100185584 | 3300020595 | Seawater | MNSKRHWSKFKRQWIEDAMRWGAMTKAEALDYWDKQEYRDE |
| Ga0206126_102662201 | 3300020595 | Seawater | MNSERHWSKFKRQWIEDAMHWGDMTKAEALDYWDKQEYRDE |
| Ga0206126_104917102 | 3300020595 | Seawater | MKHWSKFKSDWIADAMEHGNMTREEAEDYWDKQEYRDS |
| Ga0213861_103888882 | 3300021378 | Seawater | MKNFPSHWSKFKSDWIADAMEHGKMTREEAEDSWDKQEYRDS |
| Ga0222717_100663221 | 3300021957 | Estuarine Water | MKNFPSHWSKFKSDWIADAMQSGDMTREEAEDCWDKQEYRDA |
| Ga0222717_100873272 | 3300021957 | Estuarine Water | MTNEKYWSEFKKQWIEDAMQWGNMNKTEALNYWDKQEYRDK |
| Ga0212030_10299451 | 3300022053 | Aqueous | MTQFKRDWIADAMEHGGMTREQALHSWEQQEYRDC |
| Ga0212023_10035155 | 3300022061 | Aqueous | MSKFKRDWIADAMEHGKMTREQAEHCWQQQEYREG |
| Ga0224906_11912723 | 3300022074 | Seawater | MRHWSKFKSDWIADAMQWGKMNRAEAEDYWDKQEYRDS |
| (restricted) Ga0255040_100075031 | 3300024059 | Seawater | MSKFKSDWIADAMEHGKMTKEQAEHSWTQQEYWRAN |
| Ga0207905_10007017 | 3300025048 | Marine | MRHWSKFKADWIADAMEHGKMTREQAKDYWDKQEYRDE |
| Ga0207905_10022702 | 3300025048 | Marine | MKNFPSHWSKFKSDWIADAMEHGKMNREEAEDSWDKQEYRDS |
| Ga0207905_10064972 | 3300025048 | Marine | MKHWSKFKSDWIADAMQWGKMSRAEAEDYWDKQEYRDS |
| Ga0207905_10078375 | 3300025048 | Marine | MKHWSKFKSDWIADAMEHGKMTREEAEDAWDKQEYRDS |
| Ga0208667_10009416 | 3300025070 | Marine | MDSERHWSKFKRQWIEDAMRWGHMTKAEALDYWDKQEYRGK |
| Ga0207896_10053863 | 3300025071 | Marine | HWSKFKRDWIADAMEHGKMTREQAKDCWDKQEYRDS |
| Ga0207896_10130413 | 3300025071 | Marine | MKNFPSHWSKFKSDWIADAMEHGKMTREEAEDDLDKQEYRDS |
| Ga0207896_10514242 | 3300025071 | Marine | MRYWSKFKSDWIADAMQWGKMNRAEAEDYWDKQEYRDS |
| Ga0207896_10636653 | 3300025071 | Marine | MKHWSKFKSDWIADAMEHGKMTREEAEDYWDKQEYRES |
| Ga0207890_10499102 | 3300025079 | Marine | MKHWSKFKSDWIADAMQWGKMNRAEAEDYWDKQEYRDS |
| Ga0208298_10034072 | 3300025084 | Marine | MDNFKRDWILDAMEHGKMTREEAEHCWQQQEYREG |
| Ga0208298_11008561 | 3300025084 | Marine | MNSKRHWSKFKRQWIEDAMRWGDMTKAEALDYWDKQEYRGE |
| Ga0208793_11146491 | 3300025108 | Marine | KRKDKTMDNFKRDWILDAMEHGKMTREEAEHCWQQQEYREG |
| Ga0209634_10198494 | 3300025138 | Marine | MKHWSKFKRDWIADAMEHGKMTREQAKDCWDKQEYRDS |
| Ga0209337_10101502 | 3300025168 | Marine | MGAGIMRHWSKFKSDWIADAMKHGKMTREEAEDYWDKQEYRDS |
| Ga0209337_12634273 | 3300025168 | Marine | MKHWSKFKSDWIADAMQWGKMSRAEAEDFWDKQEYRDS |
| Ga0208032_10211283 | 3300025266 | Deep Ocean | MRHWSKFKSDWISDAMEHGKMNRAEAERLWSQQEYRDE |
| Ga0208032_10641022 | 3300025266 | Deep Ocean | MGAGMMGHWSKFKSDWIADAMRHGKMTREEAEDYWDKQEYRDA |
| Ga0208814_10034035 | 3300025276 | Deep Ocean | MKHWSKFKSDWIADAMRWGKMTRAEAEDCWDKQDYRDS |
| Ga0208814_10382401 | 3300025276 | Deep Ocean | MKHWSKFKKDWIADAMEHGNMTREQAKDCWDKQEYRDA |
| Ga0208814_10589943 | 3300025276 | Deep Ocean | MRHWSKFKTDWIADAMEHGKMTREQAEDYWDKQEYRD |
| Ga0208148_10314074 | 3300025508 | Aqueous | MEYWSKFKSDWIADAMQWGKMTREEAEDYWDKQEYRDS |
| Ga0208303_10168403 | 3300025543 | Aqueous | MNSERHWSKFKRQWIEDAMRWGDMTKAEALNYWEQQEYRDK |
| Ga0209654_10070183 | 3300025608 | Marine | MSKFKSDWIADAMEHGKMTREQAEHSWAQQEYRREN |
| Ga0209716_10149615 | 3300025626 | Pelagic Marine | MKNFPSHWSKFKSDWIADAMQSGNMTREEAEDCWDKQEYRDA |
| Ga0209716_10827523 | 3300025626 | Pelagic Marine | MKGLNKMNSKRHWSKFKRQWIEDAMHWGDMTKAEALDYWDKQEYRDE |
| Ga0209833_10425235 | 3300025641 | Pelagic Marine | MRQWSKFKSDWISDAMEHGKMNRAEAERLWNQQEYRDE |
| Ga0208134_10825181 | 3300025652 | Aqueous | MRHWSKFKSDWIADAMQWGKMTREEAEDYWDKQEYRDS |
| Ga0208898_10092639 | 3300025671 | Aqueous | MKHWSKFKSDWIADAMQWGKMNRAEAEDYWDKQEYRDL |
| Ga0209602_10755654 | 3300025704 | Pelagic Marine | MKGLNKMNSKRHWSKFKRQWIEDAMRWGAMTKAEALDYWDKQEYRDE |
| Ga0208547_11733083 | 3300025828 | Aqueous | MKHWSKFKSDWIADAMQWGKMNRAEAEDYWDKQEYRD |
| Ga0209307_11901512 | 3300025832 | Pelagic Marine | MTDFKRDWIADAMEHGKMTREQAEHCWEQQDYREG |
| Ga0209632_102624851 | 3300025886 | Pelagic Marine | MKNFPSHWSKFKSDWIADAMQSGNMTREEAEDCWDKQ |
| Ga0208544_102780551 | 3300025887 | Aqueous | MKNFPSHWSKFKSDWIADAMEHGKMTREEAEDSWDKQEYR |
| Ga0209384_11544262 | 3300027522 | Marine | MENFPSHWSKFKSDWIADAMQSGSMTRQEAEDYWDKQEYRDA |
| Ga0209710_10764214 | 3300027687 | Marine | MGNFPSYWSKFKSDWIADAMEHCKMTREEAEDSWDKQEYRDS |
| Ga0209816_11226411 | 3300027704 | Marine | MGAGVMGHWSKFKSDWIADAMKHGKMTREEAEDYWDKQEYRDA |
| Ga0209816_11227982 | 3300027704 | Marine | MRHWSKFKTDWIADAMEHGKITRKQAEDDWDKQEYRDE |
| Ga0209815_10295791 | 3300027714 | Marine | MGHWSKFKSDWIADAMKHGRMTREEAEDYWDKQEYRDA |
| Ga0209815_10650424 | 3300027714 | Marine | MRHWSKFKSDWIADAMEHGKMNRAEAEDCWDKQEYRDEYLVNEDY |
| Ga0209192_102528291 | 3300027752 | Marine | MKNFPSYWSKFKSDWIADAMQWGKMNRAEAEDCWDKQEYRDS |
| Ga0209711_100809062 | 3300027788 | Marine | MKHWSKFKSDWIADAMEHGKMNRAEAEDCWDKQEYRDS |
| Ga0209712_1000459314 | 3300027849 | Marine | MTQFKKDWIADAMEHGGMTREQALHSWEQQEYRDC |
| (restricted) Ga0233415_102270781 | 3300027861 | Seawater | MKNFPSHWSKFKSDWIADAMQSGNMTREQAEDCWDKQEYRDA |
| Ga0256368_10084622 | 3300028125 | Sea-Ice Brine | MKYFPSHWSKFKSDWIADAMQSGNMTREEAENYWDKQEYRDA |
| Ga0256368_10211127 | 3300028125 | Sea-Ice Brine | HWSKFKRQWIEDAMRWCDMTKTEALNYWEQQEYRGE |
| Ga0256368_10679921 | 3300028125 | Sea-Ice Brine | MNSERHWSKFKRQWIEDAMRWGDMTKAEALNYWEQQEYRGE |
| Ga0307488_101893604 | 3300031519 | Sackhole Brine | MSKFKSDWIADAMEHGKMNRAEAEDCWDKQEYRDS |
| Ga0307488_101935242 | 3300031519 | Sackhole Brine | MDSERHWSKFKRQWIEDAMRWGDMTKAEALNYWEQQEYRDK |
| Ga0307488_104545482 | 3300031519 | Sackhole Brine | MINEKCWSEFKKQWIEDAMRWGNMNKIEALDYWDKQEYRDE |
| Ga0307488_104688412 | 3300031519 | Sackhole Brine | MANEKYWSEFKRQWIEDAMRWGNMNKIEALDYWDKQEYRDE |
| Ga0307488_105732943 | 3300031519 | Sackhole Brine | MKHFPSHWSKFKLDWIADAMQSGDMTREEAEDCWDKQEYRDA |
| Ga0307488_107351771 | 3300031519 | Sackhole Brine | IHHYRMGAGIMRHWSKFKLDWIADAMKHGKMTREEAEDYWDKQEYRDS |
| Ga0307999_10467471 | 3300031608 | Marine | LIMGGSNMKHWSKFKSDWIADAMEHGKMNRAEAEDCWDKQEYRDS |
| Ga0302126_101593621 | 3300031622 | Marine | MKHWSKFKSDWIADAMEHGKMNRAEAEDCWDKQEYR |
| Ga0302121_100076528 | 3300031626 | Marine | GSIMGNFPSYWSKFKSDWIADAMEHCKMTREEAEDSWDKQEYRDS |
| Ga0302121_100485894 | 3300031626 | Marine | MKHWSKFKSDWIADAMQSGKMNRAEAEDCWDKQEYRDS |
| Ga0308015_101762611 | 3300031694 | Marine | NMKHWSKFKKDWIADAMEHGNMTREQAKDCWDKQEYRDA |
| Ga0307997_100342314 | 3300031706 | Marine | MRHWSKFKSDWIADAMEHGKMNRAEAEDFWDKQEYRDS |
| Ga0308013_102617852 | 3300031721 | Marine | MKHWSKFKKDWIADAMEQGNMTREQAKDCWDKQEYRDA |
| Ga0316203_10391033 | 3300032274 | Microbial Mat | MRHWSKFKSDWIADAMQWGKMNRAEAEDYWDKQEYRDE |
| Ga0316202_104117781 | 3300032277 | Microbial Mat | MSKFKSDWIADAMEHGKMNRAEAEDGWDKQEYRDS |
| ⦗Top⦘ |