


| Basic Information | |
|---|---|
| Family ID | F052858 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 142 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MQRIGSIFHHRPRDDFGEGDHQEYVESGVRDILLIGGAAVVLVGAFVVSLF |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 142 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.69 % |
| % of genes near scaffold ends (potentially truncated) | 26.76 % |
| % of genes from short scaffolds (< 2000 bps) | 80.99 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.803 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (20.422 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.775 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (65.493 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.38% β-sheet: 0.00% Coil/Unstructured: 69.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 142 Family Scaffolds |
|---|---|---|
| PF08818 | DUF1801 | 11.97 |
| PF13645 | YkuD_2 | 11.27 |
| PF13411 | MerR_1 | 8.45 |
| PF13650 | Asp_protease_2 | 6.34 |
| PF09278 | MerR-DNA-bind | 4.23 |
| PF03795 | YCII | 3.52 |
| PF12915 | DUF3833 | 2.82 |
| PF00578 | AhpC-TSA | 2.11 |
| PF06127 | Mpo1-like | 2.11 |
| PF02639 | DUF188 | 2.11 |
| PF04577 | Glyco_transf_61 | 1.41 |
| PF01165 | Ribosomal_S21 | 1.41 |
| PF06172 | Cupin_5 | 1.41 |
| PF00756 | Esterase | 0.70 |
| PF07568 | HisKA_2 | 0.70 |
| PF08837 | DUF1810 | 0.70 |
| PF13302 | Acetyltransf_3 | 0.70 |
| PF00115 | COX1 | 0.70 |
| PF10672 | Methyltrans_SAM | 0.70 |
| PF12146 | Hydrolase_4 | 0.70 |
| PF06035 | Peptidase_C93 | 0.70 |
| PF01161 | PBP | 0.70 |
| PF02738 | MoCoBD_1 | 0.70 |
| PF03717 | PBP_dimer | 0.70 |
| PF02790 | COX2_TM | 0.70 |
| PF12120 | Arr-ms | 0.70 |
| PF00717 | Peptidase_S24 | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
|---|---|---|---|
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 11.97 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 11.97 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 11.97 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 4.23 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.52 |
| COG1671 | Uncharacterized conserved protein YaiI, UPF0178 family | Function unknown [S] | 2.11 |
| COG4539 | 2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids) | Lipid transport and metabolism [I] | 2.11 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 1.41 |
| COG3542 | Predicted sugar epimerase, cupin superfamily | General function prediction only [R] | 1.41 |
| COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 0.70 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.70 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.70 |
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 0.70 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.70 |
| COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.80 % |
| Unclassified | root | N/A | 16.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918013|NODE_5838_length_1112_cov_10.121403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RG327 | 1144 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2354056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RG327 | 2410 | Open in IMG/M |
| 3300001904|JGI24736J21556_1060012 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300002075|JGI24738J21930_10054653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 816 | Open in IMG/M |
| 3300003267|soilL1_10048311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1946 | Open in IMG/M |
| 3300003312|P12013IDBA_1000345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 32486 | Open in IMG/M |
| 3300003312|P12013IDBA_1010936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 4290 | Open in IMG/M |
| 3300003312|P12013IDBA_1018201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2778 | Open in IMG/M |
| 3300003315|P22013IDBA_10060928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1071 | Open in IMG/M |
| 3300003321|soilH1_10044758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1609 | Open in IMG/M |
| 3300003321|soilH1_10113418 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300003324|soilH2_10029293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2705 | Open in IMG/M |
| 3300003324|soilH2_10135146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1230 | Open in IMG/M |
| 3300003324|soilH2_10211373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1568 | Open in IMG/M |
| 3300003324|soilH2_10257937 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300003461|P42013CM_1036609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1151 | Open in IMG/M |
| 3300003848|Ga0058694_1013589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1626 | Open in IMG/M |
| 3300004081|Ga0063454_101355263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RG327 | 599 | Open in IMG/M |
| 3300004114|Ga0062593_100033138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2976 | Open in IMG/M |
| 3300004114|Ga0062593_100132593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 1845 | Open in IMG/M |
| 3300004156|Ga0062589_100467898 | Not Available | 1050 | Open in IMG/M |
| 3300004156|Ga0062589_101071434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 760 | Open in IMG/M |
| 3300004156|Ga0062589_102162966 | Not Available | 568 | Open in IMG/M |
| 3300004463|Ga0063356_104092436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RG327 | 628 | Open in IMG/M |
| 3300004643|Ga0062591_101043909 | Not Available | 782 | Open in IMG/M |
| 3300005093|Ga0062594_102248257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300005093|Ga0062594_102797741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
| 3300005093|Ga0062594_102918644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 533 | Open in IMG/M |
| 3300005290|Ga0065712_10152720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1357 | Open in IMG/M |
| 3300005290|Ga0065712_10384183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300005327|Ga0070658_10009873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 7669 | Open in IMG/M |
| 3300005327|Ga0070658_10039807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas astaxanthinifaciens | 3792 | Open in IMG/M |
| 3300005327|Ga0070658_10066799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2938 | Open in IMG/M |
| 3300005327|Ga0070658_10160376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1886 | Open in IMG/M |
| 3300005327|Ga0070658_10170287 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
| 3300005327|Ga0070658_10172122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1819 | Open in IMG/M |
| 3300005327|Ga0070658_10418985 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300005327|Ga0070658_10425226 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300005327|Ga0070658_10485390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1066 | Open in IMG/M |
| 3300005327|Ga0070658_11044901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 710 | Open in IMG/M |
| 3300005327|Ga0070658_11242169 | Not Available | 647 | Open in IMG/M |
| 3300005328|Ga0070676_11288641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 558 | Open in IMG/M |
| 3300005336|Ga0070680_100118816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2205 | Open in IMG/M |
| 3300005336|Ga0070680_100762547 | Not Available | 833 | Open in IMG/M |
| 3300005336|Ga0070680_100794773 | Not Available | 815 | Open in IMG/M |
| 3300005336|Ga0070680_101692411 | Not Available | 548 | Open in IMG/M |
| 3300005339|Ga0070660_100047857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3283 | Open in IMG/M |
| 3300005339|Ga0070660_100536787 | Not Available | 975 | Open in IMG/M |
| 3300005344|Ga0070661_101451064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
| 3300005366|Ga0070659_101657869 | Not Available | 571 | Open in IMG/M |
| 3300005455|Ga0070663_100782167 | Not Available | 817 | Open in IMG/M |
| 3300005458|Ga0070681_10193536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1953 | Open in IMG/M |
| 3300005458|Ga0070681_10624626 | Not Available | 992 | Open in IMG/M |
| 3300005530|Ga0070679_100633819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1012 | Open in IMG/M |
| 3300005530|Ga0070679_100910181 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300005530|Ga0070679_102044216 | Not Available | 522 | Open in IMG/M |
| 3300005563|Ga0068855_100131127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2863 | Open in IMG/M |
| 3300005577|Ga0068857_101817022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300005578|Ga0068854_100181761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1643 | Open in IMG/M |
| 3300005614|Ga0068856_100279691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1685 | Open in IMG/M |
| 3300006169|Ga0082029_1089050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 5511 | Open in IMG/M |
| 3300006169|Ga0082029_1177546 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300006169|Ga0082029_1316506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1085 | Open in IMG/M |
| 3300006169|Ga0082029_1468395 | Not Available | 618 | Open in IMG/M |
| 3300006169|Ga0082029_1665224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 2246 | Open in IMG/M |
| 3300006804|Ga0079221_10888641 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300006806|Ga0079220_11140467 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300009174|Ga0105241_11035501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 770 | Open in IMG/M |
| 3300010219|Ga0136220_1022868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RG327 | 742 | Open in IMG/M |
| 3300012212|Ga0150985_104164705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RG327 | 1105 | Open in IMG/M |
| 3300012212|Ga0150985_106886694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1903 | Open in IMG/M |
| 3300012212|Ga0150985_116306752 | Not Available | 941 | Open in IMG/M |
| 3300012469|Ga0150984_100210612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 1453 | Open in IMG/M |
| 3300012469|Ga0150984_120409453 | Not Available | 610 | Open in IMG/M |
| 3300012905|Ga0157296_10170208 | Not Available | 670 | Open in IMG/M |
| 3300012914|Ga0157297_10257450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 635 | Open in IMG/M |
| 3300012943|Ga0164241_11024053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 606 | Open in IMG/M |
| 3300013100|Ga0157373_10160330 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300013100|Ga0157373_10857156 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300013100|Ga0157373_11014071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 620 | Open in IMG/M |
| 3300013100|Ga0157373_11200916 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300013102|Ga0157371_10039261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3384 | Open in IMG/M |
| 3300013104|Ga0157370_10118402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2474 | Open in IMG/M |
| 3300013104|Ga0157370_10140845 | All Organisms → cellular organisms → Bacteria | 2247 | Open in IMG/M |
| 3300013104|Ga0157370_11094959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 720 | Open in IMG/M |
| 3300013105|Ga0157369_12316149 | Not Available | 544 | Open in IMG/M |
| 3300015371|Ga0132258_10570053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2839 | Open in IMG/M |
| 3300015371|Ga0132258_12486648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1296 | Open in IMG/M |
| 3300015371|Ga0132258_12923959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1186 | Open in IMG/M |
| 3300018920|Ga0190273_10398801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 966 | Open in IMG/M |
| 3300019362|Ga0173479_10043964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1430 | Open in IMG/M |
| 3300020069|Ga0197907_10320466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 684 | Open in IMG/M |
| 3300020069|Ga0197907_10368520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 707 | Open in IMG/M |
| 3300020075|Ga0206349_1808981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 577 | Open in IMG/M |
| 3300020078|Ga0206352_10674874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 983 | Open in IMG/M |
| 3300020080|Ga0206350_11305768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 554 | Open in IMG/M |
| 3300022883|Ga0247786_1073498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 715 | Open in IMG/M |
| 3300025903|Ga0207680_10000679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 16102 | Open in IMG/M |
| 3300025904|Ga0207647_10078708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1980 | Open in IMG/M |
| 3300025904|Ga0207647_10232280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1061 | Open in IMG/M |
| 3300025904|Ga0207647_10270679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 971 | Open in IMG/M |
| 3300025909|Ga0207705_10005335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 9614 | Open in IMG/M |
| 3300025909|Ga0207705_10005376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 9575 | Open in IMG/M |
| 3300025909|Ga0207705_10006018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 9025 | Open in IMG/M |
| 3300025909|Ga0207705_10031666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3776 | Open in IMG/M |
| 3300025909|Ga0207705_10037883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3450 | Open in IMG/M |
| 3300025909|Ga0207705_10469687 | Not Available | 976 | Open in IMG/M |
| 3300025909|Ga0207705_10541187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 905 | Open in IMG/M |
| 3300025911|Ga0207654_10092672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1845 | Open in IMG/M |
| 3300025911|Ga0207654_11235182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 545 | Open in IMG/M |
| 3300025912|Ga0207707_10135142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2156 | Open in IMG/M |
| 3300025912|Ga0207707_10170334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1903 | Open in IMG/M |
| 3300025912|Ga0207707_11029764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 674 | Open in IMG/M |
| 3300025917|Ga0207660_10590964 | Not Available | 904 | Open in IMG/M |
| 3300025917|Ga0207660_10778908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 781 | Open in IMG/M |
| 3300025919|Ga0207657_10187877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1668 | Open in IMG/M |
| 3300025919|Ga0207657_10474924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 980 | Open in IMG/M |
| 3300025919|Ga0207657_10739992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 762 | Open in IMG/M |
| 3300025919|Ga0207657_11060969 | Not Available | 620 | Open in IMG/M |
| 3300025920|Ga0207649_10859900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 710 | Open in IMG/M |
| 3300025921|Ga0207652_10987089 | Not Available | 741 | Open in IMG/M |
| 3300025926|Ga0207659_11787174 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300025932|Ga0207690_10666550 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300025944|Ga0207661_11186303 | Not Available | 703 | Open in IMG/M |
| 3300025949|Ga0207667_11897213 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300026041|Ga0207639_10352664 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300026041|Ga0207639_12280365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 503 | Open in IMG/M |
| 3300026078|Ga0207702_10294678 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300027617|Ga0210002_1016952 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1156 | Open in IMG/M |
| 3300027766|Ga0209796_10016559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2241 | Open in IMG/M |
| 3300027876|Ga0209974_10043188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1502 | Open in IMG/M |
| 3300027876|Ga0209974_10243965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 674 | Open in IMG/M |
| 3300028592|Ga0247822_10659999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 842 | Open in IMG/M |
| 3300028592|Ga0247822_11098104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 660 | Open in IMG/M |
| 3300031824|Ga0307413_11146131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 674 | Open in IMG/M |
| 3300031854|Ga0310904_10723281 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300031858|Ga0310892_10515838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 798 | Open in IMG/M |
| 3300031908|Ga0310900_10764358 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031938|Ga0308175_100136605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2329 | Open in IMG/M |
| 3300031939|Ga0308174_11468517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 584 | Open in IMG/M |
| 3300032074|Ga0308173_10789361 | Not Available | 873 | Open in IMG/M |
| 3300033550|Ga0247829_10817253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RG327 | 776 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 20.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 11.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 9.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.34% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 4.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.52% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 3.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.52% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.82% |
| Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Ore Pile And Mine Drainage Contaminated Soil | 2.11% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.11% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.11% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.11% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.41% |
| Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 1.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.41% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.41% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.70% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Soil | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Host-Associated | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003312 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P1 sample | Environmental | Open in IMG/M |
| 3300003315 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P2 sample | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003461 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P4 sample | Environmental | Open in IMG/M |
| 3300003848 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010219 | Soil microbial communities from Bangor area, North Wales, UK, before enrichment, after WGA | Engineered | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027766 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_01290340 | 2140918013 | Soil | MQRIGDIIHHRRDSDDFSEGDHREYVESGVRDILLIGGATLLFIGAFVVSLV |
| ICChiseqgaiiDRAFT_23540565 | 3300000033 | Soil | MQRIGDIIHHRRDSDDFSEGDHREYVESGVRDILLIGGATLLFIGAFVVSLV* |
| JGI24736J21556_10600122 | 3300001904 | Corn Rhizosphere | HHRTRDDFGEGDHQEYVERGVRDILLIGGAAALLIGAFVISLV* |
| JGI24738J21930_100546533 | 3300002075 | Corn Rhizosphere | MRGIRDMFHHRSRDDFGEGDHQEYVESGVRDILLISGAAVVLVGAFVVSL |
| soilL1_100483113 | 3300003267 | Sugarcane Root And Bulk Soil | MQRIGDFIHHRARDDFGEGDHQEYVESGVRDIFLIGGAAIVLVGAFVVSLL* |
| P12013IDBA_100034515 | 3300003312 | Ore Pile And Mine Drainage Contaminated Soil | MQRIGDIFHHRRHHRDRDDFGEGDHQEYVESGLRDIFLIAGATVILIGAFAVSLF* |
| P12013IDBA_10109363 | 3300003312 | Ore Pile And Mine Drainage Contaminated Soil | MRTSHYTDRRPRDDFSDGDHQEYVESGLRDGLLIGGAMLLLVGGFFAAILV* |
| P12013IDBA_10182015 | 3300003312 | Ore Pile And Mine Drainage Contaminated Soil | MQRIGNLFRQRAGEDFSEGDHREYVEPGTRDIFLIGGAAVVLVAAFVVSLV* |
| P22013IDBA_100609283 | 3300003315 | Ore Pile And Mine Drainage Contaminated Soil | MQRIGDIFHHRRHHRDRDDFGEGDHQEYVESGLRDIFLIAGATVILIGAFAVSLFDGRTG |
| soilH1_100447584 | 3300003321 | Sugarcane Root And Bulk Soil | MQRIGDFIHHRARDDFGEGDHQEYVESGVRDIFLIGGAAIVLVGAFVVS |
| soilH1_101134182 | 3300003321 | Sugarcane Root And Bulk Soil | MQRIGDILHHRARDDFGDGDHQEYVESSARDAILIGGAAALLIGVFVASLL* |
| soilH2_100292932 | 3300003324 | Sugarcane Root And Bulk Soil | LVRLGQEAYGANSVCKEVTMQRIGNIFHARPRDDFGEGDHQEYVESGLRDILLIGGAAVLLVGAFIGSLL* |
| soilH2_101351461 | 3300003324 | Sugarcane Root And Bulk Soil | MQRIFHRAEDDFSDGDHQEHVETGYSEILLIGGAAVVLVGAFVLSLF* |
| soilH2_102113732 | 3300003324 | Sugarcane Root And Bulk Soil | MQRIGSIFHHRPRDDFGEGDHQEYVESGLRDIFLIGGAAVVLVGAFVVSLF* |
| soilH2_102579371 | 3300003324 | Sugarcane Root And Bulk Soil | MQRIGEMFHRRPRDDFGEGDHQEYVESGIREILLVGGAAALLIGAFVVSLV* |
| P42013CM_10366092 | 3300003461 | Ore Pile And Mine Drainage Contaminated Soil | MQRIGEMFHRRPRDDFGEGDHQEYVESGYRDILLVGGAAVVLVGAFVISLF* |
| Ga0058694_10135892 | 3300003848 | Agave | MQRIGDIMHLRRRDDFGEGDHQEYVEPGFRDALLIGGLGIILVGGFIASLFG* |
| Ga0063454_1013552631 | 3300004081 | Soil | MQRIGNLFHHRDTDDFSEGDHHEYVENGLRDIILIGGAAFVLIGAFVVSLVWG* |
| Ga0062593_1000331384 | 3300004114 | Soil | MRGIRDMFHHRSRDDFGEGDHQEYVESGVRDILLISGAAVVLVGAFVVSLF* |
| Ga0062593_1001325932 | 3300004114 | Soil | MQRIGDMFHHRTRDDFGEGDHQEYVERGVRDILLIGGAAALLIGAFVISLV* |
| Ga0062589_1004678982 | 3300004156 | Soil | MQRIGELFHHRSRDDFGEGDHQEYVESGVRDILLIGGAAALLIGAFIISLV* |
| Ga0062589_1010714341 | 3300004156 | Soil | MRGIRDMFHHRSRDDFGEGDHQEYVESGVRDILLISGAAVV |
| Ga0062589_1021629662 | 3300004156 | Soil | MQRIGSIFHHRPREDFSEGDHQEYVESGIRDIFLIGGAAVVLVGAFVVSLF* |
| Ga0063356_1040924361 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RSKGLIPLAREMAMQRIGNIFHHRPRDDFGEGDHQEYVESGVRDILLIGGAAVLLVGAFVVSLF* |
| Ga0062591_1010439092 | 3300004643 | Soil | LIPLAREMAMQRIGSIFHHRPREDFGEGDHQEYVESGIRDIFLIGGAAVVLVGAFVVSLF |
| Ga0062594_1022482572 | 3300005093 | Soil | MHKIGDIFHTDDADDFSEGDHQEYVKGGFREILLVGGAAVVLIAAF |
| Ga0062594_1027977411 | 3300005093 | Soil | MHKIGDIFHTEDADDFSEGDHQEYVKGGFREILLVGGAAVVLIGAFVISLV* |
| Ga0062594_1029186441 | 3300005093 | Soil | MQRIGSIFHHRPRDDFGEGDHQEYVESGVRDILLIGGAAVVLVGAFVVSLF* |
| Ga0065712_101527203 | 3300005290 | Miscanthus Rhizosphere | IRDMFHHRSRDDFGEGDHQEYVESGVRDILLISGAAVVLVGAFVVSLF* |
| Ga0065712_103841831 | 3300005290 | Miscanthus Rhizosphere | GIRDMFHHRSRDDFGEGDHQEYVESGVRDILLISGAAVVLVGAFVVSLF* |
| Ga0070658_100098732 | 3300005327 | Corn Rhizosphere | MQRIGNLFHRRSRDDFGEGDHQEYVENGLRDILLIAGAALLLIGGFVASLA* |
| Ga0070658_100398073 | 3300005327 | Corn Rhizosphere | MQKIGDIFHYRQRDDFGDGDHQEYVQGGLREILFVGGAAVVLVGAFVVSLF* |
| Ga0070658_100667993 | 3300005327 | Corn Rhizosphere | MQKIGDIFHHRERDDFADGDHQEYVQGGLREILFVGGAAVVLVGAFVISLF* |
| Ga0070658_101603762 | 3300005327 | Corn Rhizosphere | MQRIGDIMHFRRRDDFGEGDHQEYVEPGFRDVVLIGGTALMLIGAFIASLAA* |
| Ga0070658_101702872 | 3300005327 | Corn Rhizosphere | MQRIGEFFHRRPLDDFGEGDHQEYVQNGLPDMLLIGGAALLLLGGFAAVILG* |
| Ga0070658_101721223 | 3300005327 | Corn Rhizosphere | MQKIGDIFHHRSRDDFGDGDHQEYVETGVRDILLVGGAAVLLVGAFVVSLF* |
| Ga0070658_104189851 | 3300005327 | Corn Rhizosphere | MQRIGEFFHRRPLDDFGEGDHQEYVQNGLPDMLLIGGAALLLLGGFAAVIL |
| Ga0070658_104252262 | 3300005327 | Corn Rhizosphere | MQRIGDILHLRRRDDFGDGDHQEYVEPGLRDVLLIGGIAVILIGGFVASLFG* |
| Ga0070658_104853904 | 3300005327 | Corn Rhizosphere | ILRRRRDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVVSLF* |
| Ga0070658_110449011 | 3300005327 | Corn Rhizosphere | GDVILRRRRDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVISLF* |
| Ga0070658_112421692 | 3300005327 | Corn Rhizosphere | RDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVISLF* |
| Ga0070676_112886411 | 3300005328 | Miscanthus Rhizosphere | MMPNPAAREVSMQRIGDMFHHRTRDDFGEGDHQEYVERGVRDILLIGGAAALLIGAFVISLV* |
| Ga0070680_1001188164 | 3300005336 | Corn Rhizosphere | MQRIGSIFHRPRDDFGEGDHQEYVESGVRDILLIGGAAVVLVGAFVVSLF* |
| Ga0070680_1007625472 | 3300005336 | Corn Rhizosphere | MGWLLERRYAMQKIGDIILRRRRDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVISLF* |
| Ga0070680_1007947732 | 3300005336 | Corn Rhizosphere | MRLPVAKEVSMQRIGDMFAHRSRDDFAEGDHQEYVESGVRDVLLIGGAAALLIGGFVISLM* |
| Ga0070680_1016924112 | 3300005336 | Corn Rhizosphere | MQKIGDMFHRRPRDDFGEGDHQEYVETGLRDILLVGGAAVVLVGAFVASLF* |
| Ga0070660_1000478573 | 3300005339 | Corn Rhizosphere | MGWLLERRYAMQKIGDVILRRRRDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVVSLF* |
| Ga0070660_1005367873 | 3300005339 | Corn Rhizosphere | MQRIGEMFRPRARDDFGEGDHQEYVETGVRDVLLIGGAAALLIGGFVISLI* |
| Ga0070661_1014510642 | 3300005344 | Corn Rhizosphere | MQKIGDIFHHRERDDFADGDHQEYVQGGLREILFVGGAAVVLVGAFVIS |
| Ga0070659_1016578692 | 3300005366 | Corn Rhizosphere | HHRSRDDFGEGDHQEYVESGVRDILLISGAAVVLVGAFVVSLF* |
| Ga0070663_1007821672 | 3300005455 | Corn Rhizosphere | MGWLLERRYAMQKIGDIILRRQRDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVISLL* |
| Ga0070681_101935362 | 3300005458 | Corn Rhizosphere | MQKIGDIFHHKPREDFGEGDHQEYVETGMRDILLVGGAAVLLVGAFVVSLF* |
| Ga0070681_106246261 | 3300005458 | Corn Rhizosphere | RAYEAGPFAEEVAMQRIGEMFHHRSRDDFGEGDHQEYVESGIRDVLLVGGAAALLIGAFVASLI* |
| Ga0070679_1006338191 | 3300005530 | Corn Rhizosphere | MGWLLERRYAMQKIGDIILRRRRDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVVSLF* |
| Ga0070679_1009101812 | 3300005530 | Corn Rhizosphere | MQRIGDILHHRTRDDFGDGDHQEYVESSARDAILIGGAAALLIGVFVASLL* |
| Ga0070679_1020442161 | 3300005530 | Corn Rhizosphere | DMFAHRSRDDFAEGDHQEYVESGVRDVLLIGGAAALLIGGFVISLI* |
| Ga0068855_1001311274 | 3300005563 | Corn Rhizosphere | MQKIGDVILRRRRDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVVSLF* |
| Ga0068857_1018170222 | 3300005577 | Corn Rhizosphere | MQRIGDILHHRTRDDFGDGDHQEYVESGVREAVLIGGAAALLIGVFVASLF* |
| Ga0068854_1001817614 | 3300005578 | Corn Rhizosphere | MQRIGDMFHHRTRDDFGEGDHQEYVERGVRDILLIGGAA |
| Ga0068856_1002796914 | 3300005614 | Corn Rhizosphere | MQRIGEFFHRRPLNDFGEGDHQEYVQNGLPDMLLIGGAALLLIGGFAAVILG* |
| Ga0082029_10890504 | 3300006169 | Termite Nest | MQRIGDMLHLRDRSDFGEGDHQEYVESGLRDVVLIAGAAMLMIGGFIWALAG* |
| Ga0082029_11775462 | 3300006169 | Termite Nest | MQRIGDIFHHRARDDYESDRGEYVEGGVRDILLIGFAALLLIGGFVAAIA* |
| Ga0082029_13165064 | 3300006169 | Termite Nest | MQRIGDMLHLRERSDFGEGDHQEYVESGLRDIVLIAGAALLMIGGFIWSLAG* |
| Ga0082029_14683951 | 3300006169 | Termite Nest | MQRIADIFHRRPRDDFGEGDHQEYVESGVRDILLIGGAAILLVGGFIASLL* |
| Ga0082029_16652246 | 3300006169 | Termite Nest | MQRIGDILHRREQDEFEGDHQEYVESGVRDIVLIAGAAVLMIGGFVWSLASL* |
| Ga0079221_108886412 | 3300006804 | Agricultural Soil | MQRISNMFHHRARDDFGEGDHQEYVETGLRDVVVIGAAAALLIGVFVASLV* |
| Ga0079220_111404672 | 3300006806 | Agricultural Soil | FHHRARDDFGEGDHQEYVETGLRDVVVIGAAAALLIGVFVASLV* |
| Ga0105241_110355011 | 3300009174 | Corn Rhizosphere | MQRIGEFFHRRPLNDFGEGDHQEYVQNGLPDMLLIGGAALLLLGGFAAVILG* |
| Ga0136220_10228682 | 3300010219 | Soil | MQRIGDIIHRRRDSDDFSEGDHREYVESGVRDILLIGGATLLFIGAFVVSLV* |
| Ga0150985_1041647052 | 3300012212 | Avena Fatua Rhizosphere | MQRIGNIFHHRDTDDFSEGDHHEYVENGLRDIILIGGAAFVLIGAFVVSLV* |
| Ga0150985_1068866943 | 3300012212 | Avena Fatua Rhizosphere | MHKIGDIFHTEDADDFSEGDHQEYVKGGLREILLVGGAAVVLIGAFVISLV* |
| Ga0150985_1163067522 | 3300012212 | Avena Fatua Rhizosphere | MQRIGDILHLRRRREDFGEGDHQEYVEPGLRDALLIGGLAVILVGGFVVSLFE* |
| Ga0150984_1002106122 | 3300012469 | Avena Fatua Rhizosphere | MHKIGDIFHTKDADDFSEGDHQEYVKGGLREILLVGGAAVVLIGAFVISLV* |
| Ga0150984_1204094532 | 3300012469 | Avena Fatua Rhizosphere | AMQRIGDILHLRRRREDFGEGDHQEYVEPGLRDALLIGGLAVILVGGFVVSLFE* |
| Ga0157296_101702081 | 3300012905 | Soil | MFHHRSRDDFGEGDHQEYVESGVRDILLISGAAVVLVGAFVVSLF* |
| Ga0157297_102574502 | 3300012914 | Soil | MAMQRIGSIFHHRPREDFGEGDHQEYVESGIRDIFLIGGAAVVLVGAFVVSLF* |
| Ga0164241_110240532 | 3300012943 | Soil | MQRIGNMFHHRPRSDFGEGDHQEYVESGMRDVFLIGGAALIFIGGFIASLV* |
| Ga0157373_101603301 | 3300013100 | Corn Rhizosphere | MQRIGEFFHRRPLDDFGEGDHQEYVQNGLPDMLLIGAAALLLIGGFAAVILG* |
| Ga0157373_108571561 | 3300013100 | Corn Rhizosphere | MQRIGEFFHRRPLDDFGEGDHQEYVQNGLPDMLLIGGAA |
| Ga0157373_110140712 | 3300013100 | Corn Rhizosphere | MQRIGEFFHRRPIGDFGEGDHQEYVQNGWPDILLIGGAALLLLGGFAAMILS* |
| Ga0157373_112009162 | 3300013100 | Corn Rhizosphere | MQRIGELFHHRSRDDFGEGDHQEYVESGVRDILLIGGAAALLIGAFI |
| Ga0157371_100392613 | 3300013102 | Corn Rhizosphere | MQRISSILHIRDRDDFADGDHQEYVESGVRDIFLIGGMSVLFIALFIVSLF* |
| Ga0157370_101184024 | 3300013104 | Corn Rhizosphere | MQKIGDIILRRQRDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVISLF* |
| Ga0157370_101408453 | 3300013104 | Corn Rhizosphere | MQKIGDIFHHRPRDDFGDGDHQEYVETGVRDILLVGGAAVLLVGAFVVSLF* |
| Ga0157370_110949591 | 3300013104 | Corn Rhizosphere | HRRPLDDFGEGDHQEYVQNGLPDMLLIGGAALLLLGGFAAVILG* |
| Ga0157369_123161492 | 3300013105 | Corn Rhizosphere | MQRIGEFFHRRPIGDFGEGDHQEYVQNGWPDILLIGGAALLLLGGFAAVILS* |
| Ga0132258_105700533 | 3300015371 | Arabidopsis Rhizosphere | MRGIKDMFHHRSRDDFGEGDHQEYVESGVRDILLISGAAVVLVGAFVVSLF* |
| Ga0132258_124866482 | 3300015371 | Arabidopsis Rhizosphere | MHKIGNIFHTEDADDFSEGDHQEYVKGGFREILLVGGAAVVLIGAFVISLV* |
| Ga0132258_129239593 | 3300015371 | Arabidopsis Rhizosphere | MRGIGSIFHHRSRDDFGEGDHQEYVESGVRDILLISGAAVVLVGAFVVSLF* |
| Ga0190273_103988012 | 3300018920 | Soil | MQRIGDMLHLREHREFGEGDHQEYVEPGVTDVVLIAGAALLMIGGFVWALVAT |
| Ga0173479_100439644 | 3300019362 | Soil | MRGIRDMFHHRSRDDFGEGDHQEYVESGVRDILLISGAAVVLVGAFVVSLF |
| Ga0197907_103204662 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKIGDIILRRRRDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVVSLF |
| Ga0197907_103685202 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MQRIGEFFHRRPLDDFGEGDHQEYVQNGLPDMLLIGGAALLLLGGFAAVILG |
| Ga0206349_18089811 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | AMQRIGEFFHRRPLNDFGEGDHQEYVQNGLPDMLLIGGAALLLLGGFAAVILG |
| Ga0206352_106748741 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKIGDIFHHRERDDFADGDHQEYVQGGLREILFVGGAAVVLVGAFVISLF |
| Ga0206350_113057681 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MQRIGEFFHRRPLNDFGEGDHQEYVQNGLPDMLLIGAAALLLIGGFAAVILG |
| Ga0247786_10734981 | 3300022883 | Soil | MFHHRSRDDFGEGDHQEYVESGVRDILLISGAAVVLVGAFVVSLF |
| Ga0207680_1000067912 | 3300025903 | Switchgrass Rhizosphere | MQRIGDMFHHRTRDDFGEGDHQEYVERGVRDILLIGGAAALLIGAFVISLV |
| Ga0207647_100787083 | 3300025904 | Corn Rhizosphere | MQKIGDIFHHRSRDDFGDGDHQEYVETGVRDILLVGGAAVLLVGAFVVSLF |
| Ga0207647_102322802 | 3300025904 | Corn Rhizosphere | MQKIGDIFHYRQRDDFGDGDHQEYVQGGLREILFVGGAAVVLVGAFVVSLF |
| Ga0207647_102706792 | 3300025904 | Corn Rhizosphere | MQRIGDIMHFRRRDDFGEGDHQEYVEPGFRDVVLIGGTALMLIGAFIASLAA |
| Ga0207705_100053352 | 3300025909 | Corn Rhizosphere | MQKIGDVILRRRRDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVISLF |
| Ga0207705_100053761 | 3300025909 | Corn Rhizosphere | MQKIGDIFHHRPRDDFGDGDHQEYVETGVRDILLVGGAAVLLVGAFVVSLF |
| Ga0207705_100060181 | 3300025909 | Corn Rhizosphere | KIGDVILRRRRDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVVSLF |
| Ga0207705_100316666 | 3300025909 | Corn Rhizosphere | MQKIGDIFRHRQREDFGEGDHQEYVETGVRDILLVGGAAVVLVGAFVVSLF |
| Ga0207705_100378834 | 3300025909 | Corn Rhizosphere | MQRIGNLFHRRSRDDFGEGDHQEYVENGLRDILLIAGAALLLIGGFVASLA |
| Ga0207705_104696872 | 3300025909 | Corn Rhizosphere | MGWGLERRYAMQKIGDIILRRQRDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVISL |
| Ga0207705_105411872 | 3300025909 | Corn Rhizosphere | MQRIGDILHLRRRDDFGDGDHQEYVEPGLRDVLLIGGIAVILIGGFVASLFG |
| Ga0207654_100926723 | 3300025911 | Corn Rhizosphere | MMPNPAAREVSMQRIGDMFHHRTRDDFGEGDHQEYVERGVRDILLIGGAAALLIGAFVISLV |
| Ga0207654_112351822 | 3300025911 | Corn Rhizosphere | MQRIGEFFHRRPLNDFGEGDHQEYVQNGLPDMLLIGGAALLLIGGFAAVILG |
| Ga0207707_101351421 | 3300025912 | Corn Rhizosphere | FHHRPRDDFGEGDHQEYVESGVRDILLIGGAAVVLVGAFVVSLF |
| Ga0207707_101703342 | 3300025912 | Corn Rhizosphere | MQKIGDIFHHKPREDFGEGDHQEYVETGMRDILLVGGAAVLLVGAFVVSLF |
| Ga0207707_110297641 | 3300025912 | Corn Rhizosphere | MQRIGSIFHRPRDDFGEGDHQEYVESGVRDILLIGGAAVVLVGAFVVSLF |
| Ga0207660_105909642 | 3300025917 | Corn Rhizosphere | MGWLLERRYAMQKIGDIILRRRRDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVISL |
| Ga0207660_107789083 | 3300025917 | Corn Rhizosphere | HRPRDDFGDGDHQEYVETGVRDILLVGGAAVLLVGAFVVSLF |
| Ga0207657_101878772 | 3300025919 | Corn Rhizosphere | MGWLLERRYAMQKIGDVILRRRRDDFRDGDHQEYVEGGMSQIFLVGGAAVVLVGAFVVSL |
| Ga0207657_104749242 | 3300025919 | Corn Rhizosphere | MQRIGSIFHHRPRDDFGEGDHQEYVESGVRDILLIGGAAVVLVGAFVVSLF |
| Ga0207657_107399922 | 3300025919 | Corn Rhizosphere | MQRIGELFHHRSRDDFGEGDHQEYVESGVRDILLIGGAAALLIGAFIISLV |
| Ga0207657_110609692 | 3300025919 | Corn Rhizosphere | MHKIGDIFHTEDADDFSEGDHQEYVKGGLREILLVGGAAVVLIGAFVISLV |
| Ga0207649_108599002 | 3300025920 | Corn Rhizosphere | MQRISSILHHRDRDDFSGGDHQEYVESGVRDIFLIGGMSVLFVALFIVSLF |
| Ga0207652_109870892 | 3300025921 | Corn Rhizosphere | MQRIGEMFRPRARDDFGEGDHQEYVETGVRDVLLIGGAAALLIGGFVISLI |
| Ga0207659_117871741 | 3300025926 | Miscanthus Rhizosphere | MQRIGELFHHRSRDDFGEGDHQEYVESGVRDILLIGGAAALLI |
| Ga0207690_106665502 | 3300025932 | Corn Rhizosphere | MQKIGDIFYHRSRDDFGDGDHQEYVETGVRDILLVGGAAVLLVGAFVVSLF |
| Ga0207661_111863032 | 3300025944 | Corn Rhizosphere | MQRIGDILHHRTRDDFGDGDHQEYVESGVREAVLIGGAAALLIGVFVASLF |
| Ga0207667_118972132 | 3300025949 | Corn Rhizosphere | HAMQKIGDIFHHRERDDFADGDHQEYVQGGLREILFVGGAAVVLVGAFVISLF |
| Ga0207639_103526641 | 3300026041 | Corn Rhizosphere | MQRIGEFFHRRPLDDFGEGDHQEYVQNGLPDMLLIGGAALLL |
| Ga0207639_122803652 | 3300026041 | Corn Rhizosphere | MQKIGDIFHHRERDDFADGDHQEYVQGGLREILFVGGAAVVLVGAFVVSLF |
| Ga0207702_102946781 | 3300026078 | Corn Rhizosphere | MQRIGSIFHHRPREDFGEGDHQEYVESGVRDILLIGGAAVVLVGAFV |
| Ga0210002_10169521 | 3300027617 | Arabidopsis Thaliana Rhizosphere | MHKIGDIIHPRSNDDFSEGDHREYVEGGLRDILLVGGAALVLYETARRAPHP |
| Ga0209796_100165593 | 3300027766 | Agave | MQRIGDIMHLRRRDDFGEGDHQEYVEPGFRDALLIGGLGIILVGGFIASLFG |
| Ga0209974_100431881 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MHKIGDIIHPRSNDDFSEGDHREYVEGGLRDILLVGGAALVLVGAFVASLF |
| Ga0209974_102439653 | 3300027876 | Arabidopsis Thaliana Rhizosphere | HRSRDDFGEGDHQEYVESGVRDILLISGAAVVLVGAFVVSLF |
| Ga0247822_106599993 | 3300028592 | Soil | RGIRDMFHHRSRDDFGEGDHQEYVESGVRDILLISGAAVVLVGAFVVSLF |
| Ga0247822_110981041 | 3300028592 | Soil | MRGIRDMFHHRSRDDFGEGDHQEYVESGVRDILLISGAAVVLVGAFVVS |
| Ga0307413_111461313 | 3300031824 | Rhizosphere | MHRIADFFHRRPRDDFSEGDHREYVESGARDIFLIGGAALLLIGGFVASLA |
| Ga0310904_107232812 | 3300031854 | Soil | MRRINTMFHHEPRAEFGEGDHQEYVERGSRDIFLIAGAALLLIGGFVASLF |
| Ga0310892_105158383 | 3300031858 | Soil | FGEGDHQEYVESGVRDILLISGAAVVLVGAFVVSLF |
| Ga0310900_107643582 | 3300031908 | Soil | TMFHHEPRAEFGEGDHQEYVERGSRDIFLIAGAALLLIGGFVASLF |
| Ga0308175_1001366052 | 3300031938 | Soil | MQRIGHMLHFRSHDAFGDGDHQEYVESGVRDVLLIGGAAALLIGAFIVSLF |
| Ga0308174_114685172 | 3300031939 | Soil | MQRIGDIMHLRRRDDFGEGDHQEYVEPGYRDALLIGGLALILVGGFVVSLL |
| Ga0308173_107893613 | 3300032074 | Soil | LEEEHAMQRIGDMMHLRRRDDFGEGDHQEYVEPGFRDALLIGGLALILVGGFVGSLFS |
| Ga0247829_108172532 | 3300033550 | Soil | MQRIGDIIHRRRDSDDFSEGDHREYVESGVRDILLIGGATLLFIGAFVVSLV |
| ⦗Top⦘ |