


| Basic Information | |
|---|---|
| Family ID | F052703 |
| Family Type | Metagenome |
| Number of Sequences | 142 |
| Average Sequence Length | 46 residues |
| Representative Sequence | GLRKEENNEKKRKRAKRNEIQCMILLKSLIFGSTKSEICSEKDNI |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 142 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.59 % |
| % of genes from short scaffolds (< 2000 bps) | 76.06 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.268 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine (24.648 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.620 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.690 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.53% β-sheet: 0.00% Coil/Unstructured: 42.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 142 Family Scaffolds |
|---|---|---|
| PF00145 | DNA_methylase | 39.44 |
| PF13020 | NOV_C | 4.93 |
| PF04851 | ResIII | 2.82 |
| PF13604 | AAA_30 | 2.82 |
| PF09903 | DUF2130 | 2.11 |
| PF02274 | ADI | 2.11 |
| PF01935 | DUF87 | 2.11 |
| PF00271 | Helicase_C | 1.41 |
| PF01212 | Beta_elim_lyase | 1.41 |
| PF09848 | DUF2075 | 1.41 |
| PF13649 | Methyltransf_25 | 1.41 |
| PF10592 | AIPR | 1.41 |
| PF00565 | SNase | 1.41 |
| PF01420 | Methylase_S | 0.70 |
| PF04471 | Mrr_cat | 0.70 |
| PF13847 | Methyltransf_31 | 0.70 |
| PF13087 | AAA_12 | 0.70 |
| PF01435 | Peptidase_M48 | 0.70 |
| PF08669 | GCV_T_C | 0.70 |
| PF00012 | HSP70 | 0.70 |
| PF02976 | MutH | 0.70 |
| PF00580 | UvrD-helicase | 0.70 |
| PF07943 | PBP5_C | 0.70 |
| PF12161 | HsdM_N | 0.70 |
| PF14390 | DUF4420 | 0.70 |
| PF12950 | TaqI_C | 0.70 |
| PF11867 | DUF3387 | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 39.44 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 2.82 |
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 2.11 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 2.11 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 2.11 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 1.41 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 1.41 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 1.41 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 1.41 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.41 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.41 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.41 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.41 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 1.41 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 1.41 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 1.41 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 1.41 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 1.41 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.41 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 1.41 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 1.41 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.70 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.70 |
| COG0732 | Restriction endonuclease S subunit | Defense mechanisms [V] | 0.70 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.70 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
| COG3066 | DNA mismatch repair protein MutH | Replication, recombination and repair [L] | 0.70 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.27 % |
| Unclassified | root | N/A | 38.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10059230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii | 1853 | Open in IMG/M |
| 3300001344|JGI20152J14361_10033445 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300001346|JGI20151J14362_10030314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptostreptococcaceae | 2639 | Open in IMG/M |
| 3300001347|JGI20156J14371_10068272 | Not Available | 1334 | Open in IMG/M |
| 3300001347|JGI20156J14371_10110039 | Not Available | 858 | Open in IMG/M |
| 3300001348|JGI20154J14316_10017240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 4182 | Open in IMG/M |
| 3300001348|JGI20154J14316_10030616 | All Organisms → cellular organisms → Bacteria | 2665 | Open in IMG/M |
| 3300001348|JGI20154J14316_10064634 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300001348|JGI20154J14316_10080570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 1142 | Open in IMG/M |
| 3300001348|JGI20154J14316_10118704 | Not Available | 788 | Open in IMG/M |
| 3300001349|JGI20160J14292_10004929 | All Organisms → cellular organisms → Bacteria | 9811 | Open in IMG/M |
| 3300001349|JGI20160J14292_10028759 | Not Available | 2917 | Open in IMG/M |
| 3300001349|JGI20160J14292_10072314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 1379 | Open in IMG/M |
| 3300001349|JGI20160J14292_10089344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1147 | Open in IMG/M |
| 3300001352|JGI20157J14317_10067890 | Not Available | 1485 | Open in IMG/M |
| 3300001352|JGI20157J14317_10071971 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300001353|JGI20159J14440_10004909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8177 | Open in IMG/M |
| 3300001353|JGI20159J14440_10029601 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
| 3300001353|JGI20159J14440_10050712 | Not Available | 1567 | Open in IMG/M |
| 3300001353|JGI20159J14440_10058802 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300001353|JGI20159J14440_10061535 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300001354|JGI20155J14468_10027918 | Not Available | 2750 | Open in IMG/M |
| 3300001354|JGI20155J14468_10067783 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300001354|JGI20155J14468_10119721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis | 889 | Open in IMG/M |
| 3300001354|JGI20155J14468_10169928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED258 | 679 | Open in IMG/M |
| 3300001355|JGI20158J14315_10061402 | Not Available | 1497 | Open in IMG/M |
| 3300001355|JGI20158J14315_10062687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 1472 | Open in IMG/M |
| 3300001355|JGI20158J14315_10075615 | Not Available | 1261 | Open in IMG/M |
| 3300001355|JGI20158J14315_10075749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1259 | Open in IMG/M |
| 3300005933|Ga0075118_10176893 | Not Available | 702 | Open in IMG/M |
| 3300005933|Ga0075118_10218573 | Not Available | 610 | Open in IMG/M |
| 3300006029|Ga0075466_1040332 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300006193|Ga0075445_10072409 | Not Available | 1325 | Open in IMG/M |
| 3300006193|Ga0075445_10079456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales | 1250 | Open in IMG/M |
| 3300006193|Ga0075445_10334743 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006947|Ga0075444_10098227 | Not Available | 1285 | Open in IMG/M |
| 3300006947|Ga0075444_10099523 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300006947|Ga0075444_10122212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 1117 | Open in IMG/M |
| 3300007074|Ga0075110_1013333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2421 | Open in IMG/M |
| 3300007074|Ga0075110_1100733 | Not Available | 605 | Open in IMG/M |
| 3300007547|Ga0102875_1266374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 522 | Open in IMG/M |
| 3300007637|Ga0102906_1077809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 933 | Open in IMG/M |
| 3300008012|Ga0075480_10383411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii | 696 | Open in IMG/M |
| 3300008961|Ga0102887_1107603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 878 | Open in IMG/M |
| 3300009071|Ga0115566_10099665 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
| 3300009071|Ga0115566_10212370 | Not Available | 1175 | Open in IMG/M |
| 3300009074|Ga0115549_1053277 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300009076|Ga0115550_1081551 | Not Available | 1232 | Open in IMG/M |
| 3300009076|Ga0115550_1226121 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300009172|Ga0114995_10037296 | All Organisms → cellular organisms → Bacteria | 2820 | Open in IMG/M |
| 3300009172|Ga0114995_10226306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii | 1035 | Open in IMG/M |
| 3300009420|Ga0114994_10165312 | Not Available | 1496 | Open in IMG/M |
| 3300009420|Ga0114994_10635745 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300009420|Ga0114994_11108807 | Not Available | 511 | Open in IMG/M |
| 3300009423|Ga0115548_1076056 | Not Available | 1132 | Open in IMG/M |
| 3300009425|Ga0114997_10075233 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
| 3300009425|Ga0114997_10530947 | Not Available | 625 | Open in IMG/M |
| 3300009438|Ga0115559_1090541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1212 | Open in IMG/M |
| 3300009443|Ga0115557_1024685 | All Organisms → cellular organisms → Bacteria | 2955 | Open in IMG/M |
| 3300009447|Ga0115560_1285517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. CBW1108 | 629 | Open in IMG/M |
| 3300009449|Ga0115558_1025675 | All Organisms → cellular organisms → Bacteria | 2860 | Open in IMG/M |
| 3300009449|Ga0115558_1113450 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300009472|Ga0115554_1104295 | Not Available | 1203 | Open in IMG/M |
| 3300009476|Ga0115555_1333893 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300009495|Ga0115571_1062981 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300009508|Ga0115567_10437570 | Not Available | 801 | Open in IMG/M |
| 3300009508|Ga0115567_10575445 | Not Available | 681 | Open in IMG/M |
| 3300009512|Ga0115003_10081894 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
| 3300009512|Ga0115003_10566186 | Not Available | 663 | Open in IMG/M |
| 3300009785|Ga0115001_10812002 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300010368|Ga0129324_10130410 | Not Available | 1061 | Open in IMG/M |
| 3300010883|Ga0133547_10185131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4461 | Open in IMG/M |
| 3300010883|Ga0133547_10360310 | All Organisms → cellular organisms → Bacteria | 2989 | Open in IMG/M |
| 3300010883|Ga0133547_10379062 | All Organisms → cellular organisms → Bacteria | 2901 | Open in IMG/M |
| 3300010883|Ga0133547_10716914 | Not Available | 1978 | Open in IMG/M |
| 3300010883|Ga0133547_10764909 | Not Available | 1902 | Open in IMG/M |
| 3300017697|Ga0180120_10126266 | Not Available | 1097 | Open in IMG/M |
| 3300020185|Ga0206131_10095794 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1726 | Open in IMG/M |
| 3300020185|Ga0206131_10117454 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300020372|Ga0211683_10026265 | All Organisms → cellular organisms → Bacteria | 1974 | Open in IMG/M |
| 3300020372|Ga0211683_10213898 | Not Available | 613 | Open in IMG/M |
| 3300020372|Ga0211683_10229734 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300020382|Ga0211686_10115732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 1100 | Open in IMG/M |
| 3300020396|Ga0211687_10390792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 536 | Open in IMG/M |
| 3300020463|Ga0211676_10052689 | Not Available | 2876 | Open in IMG/M |
| 3300022074|Ga0224906_1221534 | Not Available | 510 | Open in IMG/M |
| 3300023240|Ga0222676_1030818 | Not Available | 863 | Open in IMG/M |
| 3300023240|Ga0222676_1052955 | Not Available | 580 | Open in IMG/M |
| (restricted) 3300024261|Ga0233439_10182059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii | 977 | Open in IMG/M |
| 3300024348|Ga0244776_10112718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2020 | Open in IMG/M |
| 3300025425|Ga0208646_1011672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2422 | Open in IMG/M |
| 3300025438|Ga0208770_1006581 | All Organisms → cellular organisms → Bacteria | 4053 | Open in IMG/M |
| 3300025438|Ga0208770_1010432 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2900 | Open in IMG/M |
| 3300025594|Ga0209094_1045320 | Not Available | 1172 | Open in IMG/M |
| 3300025621|Ga0209504_1046341 | Not Available | 1361 | Open in IMG/M |
| 3300025666|Ga0209601_1017546 | All Organisms → cellular organisms → Bacteria | 2837 | Open in IMG/M |
| 3300025690|Ga0209505_1104849 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 801 | Open in IMG/M |
| 3300025712|Ga0209305_1057588 | Not Available | 1328 | Open in IMG/M |
| 3300025809|Ga0209199_1069235 | Not Available | 1607 | Open in IMG/M |
| 3300025816|Ga0209193_1034045 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300025832|Ga0209307_1065268 | Not Available | 1251 | Open in IMG/M |
| 3300025869|Ga0209308_10134639 | Not Available | 1153 | Open in IMG/M |
| 3300025869|Ga0209308_10326481 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 633 | Open in IMG/M |
| 3300025874|Ga0209533_1063183 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 2055 | Open in IMG/M |
| 3300025880|Ga0209534_10106741 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300025881|Ga0209309_10199000 | Not Available | 970 | Open in IMG/M |
| 3300025886|Ga0209632_10037769 | All Organisms → cellular organisms → Bacteria | 3224 | Open in IMG/M |
| 3300025894|Ga0209335_10009569 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 8017 | Open in IMG/M |
| 3300025897|Ga0209425_10016317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 6102 | Open in IMG/M |
| 3300025897|Ga0209425_10021240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. PAB 2.2 | 5109 | Open in IMG/M |
| 3300027522|Ga0209384_1047614 | Not Available | 1171 | Open in IMG/M |
| 3300027672|Ga0209383_1148180 | Not Available | 731 | Open in IMG/M |
| 3300027704|Ga0209816_1049481 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300027752|Ga0209192_10032279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2484 | Open in IMG/M |
| 3300027752|Ga0209192_10089960 | Not Available | 1287 | Open in IMG/M |
| 3300027757|Ga0208671_10261109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 615 | Open in IMG/M |
| 3300027779|Ga0209709_10062138 | Not Available | 2099 | Open in IMG/M |
| 3300027779|Ga0209709_10094917 | Not Available | 1577 | Open in IMG/M |
| 3300027779|Ga0209709_10329274 | Not Available | 637 | Open in IMG/M |
| 3300027788|Ga0209711_10018332 | Not Available | 4441 | Open in IMG/M |
| 3300027791|Ga0209830_10100350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 1438 | Open in IMG/M |
| 3300027801|Ga0209091_10042918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2668 | Open in IMG/M |
| 3300027801|Ga0209091_10436985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii | 584 | Open in IMG/M |
| 3300028194|Ga0257106_1282886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → Micavibrio → unclassified Micavibrio → Micavibrio sp. | 547 | Open in IMG/M |
| 3300028196|Ga0257114_1163542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii | 848 | Open in IMG/M |
| 3300031143|Ga0308025_1041967 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300031510|Ga0308010_1126882 | Not Available | 969 | Open in IMG/M |
| 3300031596|Ga0302134_10182474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 859 | Open in IMG/M |
| 3300031630|Ga0308004_10054787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1735 | Open in IMG/M |
| 3300031630|Ga0308004_10294376 | Not Available | 629 | Open in IMG/M |
| 3300031630|Ga0308004_10371349 | Not Available | 536 | Open in IMG/M |
| 3300031630|Ga0308004_10389262 | Not Available | 518 | Open in IMG/M |
| 3300031644|Ga0308001_10196571 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300031644|Ga0308001_10247991 | Not Available | 688 | Open in IMG/M |
| 3300031644|Ga0308001_10344731 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 549 | Open in IMG/M |
| 3300031659|Ga0307986_10007140 | All Organisms → cellular organisms → Bacteria | 7192 | Open in IMG/M |
| 3300031695|Ga0308016_10086288 | Not Available | 1288 | Open in IMG/M |
| 3300031695|Ga0308016_10176508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 831 | Open in IMG/M |
| 3300031696|Ga0307995_1089116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii | 1217 | Open in IMG/M |
| 3300031702|Ga0307998_1305220 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 503 | Open in IMG/M |
| 3300031721|Ga0308013_10075906 | Not Available | 1345 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 24.65% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 19.01% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 17.61% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.56% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.56% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.52% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 3.52% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.41% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.41% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.41% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.41% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.41% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.70% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.70% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.70% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.70% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300005933 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007637 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020372 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300023240 | Saline water microbial communities from Ace Lake, Antarctica - #870 | Environmental | Open in IMG/M |
| 3300024261 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MG | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025425 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes) | Environmental | Open in IMG/M |
| 3300025438 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025666 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025690 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031596 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCM | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| 3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100592301 | 3300000101 | Marine | RGLRKEENNEKKRKRAKRNEIQCMILLKSSIFVPTKPEFCLKKEF* |
| JGI20152J14361_100334451 | 3300001344 | Pelagic Marine | PLLLSRGLRKEENNEKKRKRAKRNEIQCMILFKSLIFVSTKSEICSEKDNI* |
| JGI20151J14362_100303144 | 3300001346 | Pelagic Marine | GLRKEENNEKKRKRAKRNEIQCMILLKSLIFGSTKSEFCLNKEF* |
| JGI20156J14371_100682722 | 3300001347 | Pelagic Marine | GLRKEENNEKKRKRAKRNEIQCMILLKSLIFGSTKSEICSEKDNI* |
| JGI20156J14371_101100392 | 3300001347 | Pelagic Marine | GLRKEENNEKKRKRAKRNEIQCMILLKSLIFVFTKSEICF* |
| JGI20154J14316_100172401 | 3300001348 | Pelagic Marine | GLRKEENNEKKRKRAKRNEIQCMILLKSSIFVSTKS* |
| JGI20154J14316_100306163 | 3300001348 | Pelagic Marine | GLRKEENNEKKRKRAKRNEIQCMILLKSSIFVPTKPEFCLKKEF* |
| JGI20154J14316_100646342 | 3300001348 | Pelagic Marine | RGLRKEENNEKKRKRAKRNEIQCMILFKSLIFGSTKSEICSEKDNI* |
| JGI20154J14316_100805701 | 3300001348 | Pelagic Marine | RKEENNEKKRKRAKRNEIQCMILFKSLIFVSTKSEICSDKDFNI* |
| JGI20154J14316_101187042 | 3300001348 | Pelagic Marine | LSRGLRKEENNEKKRKRAKRNEIQCMILLKSLIFVITKSEICFEKDCCYFLNIYN* |
| JGI20160J14292_100049298 | 3300001349 | Pelagic Marine | KKRKRAKRNEIQCMILFKSLIFVSTKSEICSEKDNI* |
| JGI20160J14292_100287591 | 3300001349 | Pelagic Marine | VSPLLLSRGLRKEENNEKKRKRVKRNEIQCMILLKSLIFVSSKSEICSEKDLDKYFNSIL |
| JGI20160J14292_100723141 | 3300001349 | Pelagic Marine | PLLLSRGLRKEENNEKKRKRAKRNEIQCMILVKSLIFVSTKSEICSDKDFNI* |
| JGI20160J14292_100893441 | 3300001349 | Pelagic Marine | LRKEENNEKKRKRAKRNEIQCMILLRSSIFVSTKSEICSEKDFKTIFF* |
| JGI20157J14317_100678905 | 3300001352 | Pelagic Marine | RKEENNEKKRKRAKRNEIQCMILLRSSIFVSTKS* |
| JGI20157J14317_100719711 | 3300001352 | Pelagic Marine | GLRKEENNEKKRKRAKRNEIQCMILLRSLIFGSTKSEICSEKDNI* |
| JGI20159J14440_100049097 | 3300001353 | Pelagic Marine | RGLRKEENNEKKRKRVKRNEIQCMILLKSLIFVSSKSEICSEKDLDKYFNSIL* |
| JGI20159J14440_100296013 | 3300001353 | Pelagic Marine | LRKEENNEKKRKRAKRNEIQCMNLLRSSIFVPTKPEFCLKKESI* |
| JGI20159J14440_100507125 | 3300001353 | Pelagic Marine | LRKEENNEKKRKRAKRNEIQCMILLRSSIFVSTKS* |
| JGI20159J14440_100588022 | 3300001353 | Pelagic Marine | LRKEENNEKKRKRAKRNEIQCMILFRSLIFVSTKSEICSEKDNI* |
| JGI20159J14440_100615352 | 3300001353 | Pelagic Marine | LLSRGLRKEENNEKKRKRVKRNEIQCMILLKSLIFVSSKSEICSEKDLDKYFNSIL* |
| JGI20155J14468_100279181 | 3300001354 | Pelagic Marine | EENNEKKRKRAKRNEIQCMILFKSLIFGSTKSEFCLNKEF* |
| JGI20155J14468_100677831 | 3300001354 | Pelagic Marine | LRKEENNEKKRKRAKRNEIQCMILLKSLIFGSTKSEICSEKDNI* |
| JGI20155J14468_101197213 | 3300001354 | Pelagic Marine | SRGLRKEENNEKKRKRAKRNEIQCMILFKSSIFGSTKSKSCLKKVILITH* |
| JGI20155J14468_101699283 | 3300001354 | Pelagic Marine | GLRKEENNEKKRKRAKRNEIQCMILFKSLIFVSTKSEICSDKDFNI* |
| JGI20158J14315_100614023 | 3300001355 | Pelagic Marine | KEENNEKKRKRAKRNEIQCMILLKSLIFGSTKSEICSEKDYYYFLIIYN* |
| JGI20158J14315_100626873 | 3300001355 | Pelagic Marine | LRKEENNEKKRKRAKRNEIQCMILLKSSIFVSTKS* |
| JGI20158J14315_100756153 | 3300001355 | Pelagic Marine | RKEENNEKKRKRAKRNEIQCMILFKSLIFGSTKSEICSEKDFY* |
| JGI20158J14315_100757491 | 3300001355 | Pelagic Marine | RKEENNEKKRKRAKRNEIQCMILLRSSIFVSTKSEICSEKDFKTIFF* |
| Ga0075118_101768933 | 3300005933 | Saline Lake | SRGLRKEGNNEKKRKRKKRNEIQCMILLKSLIFVFTKSEICF* |
| Ga0075118_102185731 | 3300005933 | Saline Lake | LSRGLRKEGNNEKKRKRKKRNEIQCMILLRSLIFGFTKSEIC* |
| Ga0075466_10403321 | 3300006029 | Aqueous | KGLRKEENNEKKRKRAKRNEIQCMILLKSSIFVSTKS* |
| Ga0075445_100724091 | 3300006193 | Marine | PPLLLSRGLRKEENNEKKRKRVKRNEIQCMILFKSLIFGSTKSEICSEKDFN* |
| Ga0075445_100794563 | 3300006193 | Marine | LLSRGLRKEENNEKKRKRVKRNEIQCMILLRSSLFGSTKSEICSEKD* |
| Ga0075445_103347432 | 3300006193 | Marine | ENNEKKRKRVKRNEIQCMILFKSLIFGSTKSEICSEKDNI* |
| Ga0075444_100982271 | 3300006947 | Marine | RKEENNEKKRKRVKRNEIQCMILFKSLIFGSTKSEICSEKDFN* |
| Ga0075444_100995231 | 3300006947 | Marine | RKEENNEKKRKRVKRNEIQCMILFKSLIFGSTKSEICSEKDNI* |
| Ga0075444_101222123 | 3300006947 | Marine | MVPPLLLSRGLRKEENNEKKRKRVKRNEIQCMILFKSLIFVSTKSEICSEKDFLISKNILGFQFA* |
| Ga0075110_10133333 | 3300007074 | Saline Lake | SRGLRKEGNNEKKRKRKKRNEIQCMILLRSLIFGFTKSEIC* |
| Ga0075110_11007331 | 3300007074 | Saline Lake | LSRGLRKEENNEKKRKRVKRNEIQCMILLRSLIFGSTKSEICSEKDNI* |
| Ga0102875_12663741 | 3300007547 | Estuarine | MVSPLLLSRGLRKEENNEKKRKRAKRNEIQCMILFKSLIFVSTKSEICSDKDF |
| Ga0102906_10778092 | 3300007637 | Estuarine | SRGLRKEENNEKKRKRVKRNEIQCMILCRSLIFDCTKSEIC* |
| Ga0075480_103834112 | 3300008012 | Aqueous | SRGLRKEENNEKKRKRAKRNEIQCMILLKSSIFVPTKPEFCLKKEF* |
| Ga0102887_11076033 | 3300008961 | Estuarine | MVSPLLLSRGLRKEENNEKKRKRVKRNEIQCMILLRSSIFVPTKPEFCLNKDILKYSN |
| Ga0115566_100996653 | 3300009071 | Pelagic Marine | LLSRGLRKEENNEKKRKRAKRNEIQCMILLKSSIFVPTKPKICSEKDFI* |
| Ga0115566_102123702 | 3300009071 | Pelagic Marine | GLRKEENNEKKRKRAKRNEIQCMILFKSLIFVSTKSEICSEKDNI* |
| Ga0115549_10532772 | 3300009074 | Pelagic Marine | KEENNEKKRKRAKRNEIQCMILFKSLIFGSTKSEICSEKDNI* |
| Ga0115550_10815512 | 3300009076 | Pelagic Marine | LRKEENNEKKRKRAKRNEIQCMILFKSLIFGSTKSEFCLNKEF* |
| Ga0115550_12261211 | 3300009076 | Pelagic Marine | NNEKKRKRAKRNEIQCMILLKSSIFVPTKPKICSEKDFI* |
| Ga0114995_100372961 | 3300009172 | Marine | LRKEENNEKKRKRVKRNEIQCMILLRSSIFVPTKPEFCLKKESI* |
| Ga0114995_102263062 | 3300009172 | Marine | GLRKEENNEKKRKRVKRNEIQCMILLRSSIFVPTKPEFCLKKEF* |
| Ga0114994_101653122 | 3300009420 | Marine | RKEENNEKKRKRVKRNEIQCMILLRSLIFGSTKSEICSEKDLRIIELFLNFK* |
| Ga0114994_106357451 | 3300009420 | Marine | RKEENNEKKRKRVKRNEIQCMILLRSLIFGSTKSEICSEKDNI* |
| Ga0114994_111088071 | 3300009420 | Marine | RKEGNNEKKRKRKKRNEIQCMILLRSLIFGSTKSEICSQKVLLRVVIYI* |
| Ga0115548_10760561 | 3300009423 | Pelagic Marine | RGLRKEENNEKKRKRAKRNEIQCMILFKSLIFVSTKS* |
| Ga0114997_100752331 | 3300009425 | Marine | MVSLLLLSRGLRKEGNNEKKRKRKKRNEIQCMILLKSLIFVSTKSEICSQKVFY* |
| Ga0114997_105309471 | 3300009425 | Marine | GLRKEEYKEKKRKRVKRNEIQCMILLRSSIFDLTKSEICF* |
| Ga0115559_10905413 | 3300009438 | Pelagic Marine | PLLLSRGLRKEENNEKKRKRAKRNEIQCMILLKSSIFVPTKSEICSEKEDRIQRYNAFL* |
| Ga0115557_10246855 | 3300009443 | Pelagic Marine | LLLSRGLRKEENNEKKRKRAKRNEIQCMILLKSSIFVPTKPKICSEKDFI* |
| Ga0115560_12855173 | 3300009447 | Pelagic Marine | RGLRKEENNEKKRKRAKRNEIQCMILLKSSIFVPTKPEFC* |
| Ga0115558_10256751 | 3300009449 | Pelagic Marine | RGLRKEENNEKKRKRAKRNEIQCMILLRSSIFVPTKSEICSEKEDRIQRYNAFL* |
| Ga0115558_11134502 | 3300009449 | Pelagic Marine | SRGLRKEENNEKKRKRAKRNEIQCMILLRSSIFVPTKPKICSEKDFI* |
| Ga0115554_11042952 | 3300009472 | Pelagic Marine | MVSPLLLSRGLRKEENNEKKRKRAKRNEIQCMILFKSLIFVSTKSEICSEKDNI* |
| Ga0115555_13338931 | 3300009476 | Pelagic Marine | MVSPLLLSRGLRKEENNEKKRKRVKRNEIQCMILLKSLIFVSSKSEICSEKDLDKYFNSIL* |
| Ga0115571_10629811 | 3300009495 | Pelagic Marine | NNEKKRKRAKRNEIQCMILFKSLIFVSTKSEICSEKDNI* |
| Ga0115567_104375701 | 3300009508 | Pelagic Marine | SRGLRKEENNEKKRKRAKRNEIQCMILLRSSIFVPTKSEICSEKEDRIQRYNAFL* |
| Ga0115567_105754452 | 3300009508 | Pelagic Marine | RGLRKEENNEKKRKRAKRNEIQCMILLKSSIFVSTKSEICSEKDNI* |
| Ga0115003_100818944 | 3300009512 | Marine | LRKEGNNKKNRKRRKRNEIQCMILLKSLIFVSTKSEICSEKD* |
| Ga0115003_105661861 | 3300009512 | Marine | LRKEGNNEKKRKRKKRNEIQCMILLKSLIFGSTKSEFCLNKDY* |
| Ga0115001_108120021 | 3300009785 | Marine | KEKKRKRKKRNEIQCMILLRSSIFVPTKPEFCLKKESI* |
| Ga0129324_101304101 | 3300010368 | Freshwater To Marine Saline Gradient | RKEENNEKKRKRAKRNEIQCMILLKSSIFVPTKPKICSEKDFI* |
| Ga0133547_101851314 | 3300010883 | Marine | VMVSPLLLSRGLRKEENNEKKRKRVKRNEIQYMILLKSLIFGFTKSEIC* |
| Ga0133547_103603101 | 3300010883 | Marine | ENNEKKRKRVKRNEIQCMILLRSSIFVPTKPEFCLKKGLIYFV* |
| Ga0133547_103790624 | 3300010883 | Marine | MVSPLLLSRGLRKEENNEKKRKRVKRNEIQCMILLRSLIFVSTKSEICSEKGFIASNK* |
| Ga0133547_107169141 | 3300010883 | Marine | MVSLLLLSRGLRKEGNNEKKRKRKKRNEIQCMILLKSLIFVTTKSEICF* |
| Ga0133547_107649092 | 3300010883 | Marine | KEKKRKREKRNEIQCMILLRSQIVGSSKSEFCLKKVYKNKVYC* |
| Ga0180120_101262661 | 3300017697 | Freshwater To Marine Saline Gradient | GLRKEENNEKKRKRAKRNEIQCMILFKSLIFVSTKSEICSEKDNI |
| Ga0206131_100957941 | 3300020185 | Seawater | NNEKKRKRAKRNEIQCMILLKSSIFVPTKPKICSEKDFI |
| Ga0206131_101174543 | 3300020185 | Seawater | NNEKKRKRAKRNEIQCMILFKSLIFVSTKSEICSEKDNI |
| Ga0211683_100262651 | 3300020372 | Marine | GLRKEENNEKKRKRVKRNEIQCMILFKSLIFGSTKSEICSEKDFN |
| Ga0211683_102138982 | 3300020372 | Marine | SRGLRNEEYKEKKRKREKRNEIQCMILLKSLIFDCTKSEIC |
| Ga0211683_102297342 | 3300020372 | Marine | KEENNEKKRKRVKRNEIQCMILLRSSLFGSTKSEICSEKD |
| Ga0211686_101157322 | 3300020382 | Marine | GLRKEEYREKKRKREKRNEIQCMILLKSLIFDCTKSEIC |
| Ga0211687_103907921 | 3300020396 | Marine | MVSLLFQSRGLRKEEYREKKRKREKRNEIQCMILLRSLIFDCTKSEIC |
| Ga0211676_100526891 | 3300020463 | Marine | NEKKRKREKRNEIQCMILLKSIVFVFNQPKNCFEKGNYYN |
| Ga0224906_12215341 | 3300022074 | Seawater | MASLLFLLRGLRTKEDNEKKRKREKRNEIQCMILFKSLIFGSTKSEIC |
| Ga0222676_10308181 | 3300023240 | Saline Water | KKRKRKKRNEIQCMILLKSLVFVFNQPKKCFEKGSKII |
| Ga0222676_10529551 | 3300023240 | Saline Water | LRKEGNNEKKRKRKKRNEIQCMILLRSLIFGFTKSEIC |
| (restricted) Ga0233439_101820591 | 3300024261 | Seawater | NEKKRKRAKRNEIQCMILLKSSIFVPTKPEFCLKKEF |
| Ga0244776_101127181 | 3300024348 | Estuarine | MVSPLLLSRGLRKEENNEKKRKRVKRNEIQCMILLKSSIFVPTKPEFCLKK |
| Ga0208646_10116723 | 3300025425 | Saline Lake | SRGLRKEGNNEKKRKRKKRNEIQCMILLRSLIFGFTKSEIC |
| Ga0208770_10065811 | 3300025438 | Saline Lake | LLLLSRGLRKEGNNEKKRKRKKRNEIQCMILLKSLIFGSTKSEICSEKDFNY |
| Ga0208770_10104323 | 3300025438 | Saline Lake | KEGNNEKKRKRKKRNEIQCMILLRSSIFVPTKPEFCLKKEF |
| Ga0209094_10453202 | 3300025594 | Pelagic Marine | GLRKEENNEKKRKRAKRNEIQCMILFKSLIFGSTKSEICSEKDNI |
| Ga0209504_10463412 | 3300025621 | Pelagic Marine | VMVSPLLLSRGLRKEENNEKKRKRAKRNEIQCMILFKSLIFGSTKSEICSEKDNI |
| Ga0209601_10175461 | 3300025666 | Pelagic Marine | RGLRKEENNEKKRKRAKRNEIQCMILLRSSIFVPTKSEICSEKEDRIQRYNAFL |
| Ga0209505_11048491 | 3300025690 | Pelagic Marine | EENNEKKRKRAKRNEIQCMILFKSLIFGSTKSEFCLNKEF |
| Ga0209305_10575881 | 3300025712 | Pelagic Marine | ENNEKKRKRAKRNEIQCMILFKSLIFVSTKSEICSEKDNI |
| Ga0209199_10692351 | 3300025809 | Pelagic Marine | SRGLRKEENNEKKRKRAKRNEIQCMILLKSLIFGSTKSEFCLNKEF |
| Ga0209193_10340451 | 3300025816 | Pelagic Marine | LLSRGLRKEENNEKKRKRAKRNEIQCMILFKSLIFGSTKSEICSEKDNI |
| Ga0209307_10652681 | 3300025832 | Pelagic Marine | RGLRKEENNEKKRKRAKRNEIQCMILFKSLIFVSTKSEICSEKDNI |
| Ga0209308_101346392 | 3300025869 | Pelagic Marine | RKEENNEKKRKRAKRNEIQCMILLKSSIFVPTKPEFCLKKESI |
| Ga0209308_103264812 | 3300025869 | Pelagic Marine | GLRKEENNEKKRKRAKRNEIQCMILLKSLIFGSTKSEFCLNKEF |
| Ga0209533_10631833 | 3300025874 | Pelagic Marine | EENNEKKRKRAKRNEIQCMILLKSSIFVPTKPEFCLKKESI |
| Ga0209223_101900631 | 3300025876 | Pelagic Marine | EKKRKRVKRNEIQCMILLKSLTFVFNQPKKCFDKGSKII |
| Ga0209534_101067411 | 3300025880 | Pelagic Marine | LLLSRGLRKEENNEKKRKRAKRNEIQCMILLKSSIFVPTKPKICSEKDFI |
| Ga0209309_101990002 | 3300025881 | Pelagic Marine | KEENNEKKRKRVKRNEIQCMILFKSLIFGSTKSEFCLNKEF |
| Ga0209632_100377691 | 3300025886 | Pelagic Marine | GLRKEENNEKKRKRAKRNEIQCMILLKSSIFVPTKPKICSEKDFI |
| Ga0209335_100095691 | 3300025894 | Pelagic Marine | RGLRKEENNEKKRKRVKRNEIQCMILLKSLIFVSSKSEICSEKDLDKYFNSIL |
| Ga0209425_100163171 | 3300025897 | Pelagic Marine | RKEENNEKKRKRAKRNEIQCMILLRSSIFVPTKSEICSEKEDRIQRYNAFL |
| Ga0209425_100212404 | 3300025897 | Pelagic Marine | LSRGLRKEENNEKKRKRVKRNEIQCMILLKSLIFVSSKSEICSEKDLDKYFNSIL |
| Ga0209384_10476142 | 3300027522 | Marine | LRKEENNEKKRKRVKRNEIQCMILFKSLIFGSTKSEICSEKDLRIIELFLNFK |
| Ga0209383_11481801 | 3300027672 | Marine | ESNEKKRKRVKRNEIQCMILLRPLIFGTTRSEFCLNKDI |
| Ga0209816_10494812 | 3300027704 | Marine | LRKEENNEKKRKRVKRNEIQCMILFKSLIFGSTKSEICSEKDFN |
| Ga0209192_100322794 | 3300027752 | Marine | MVSLLFQSRGLRKEGNNEKKRKRKKRNEIQCMILLRSLIFGSTKSEICSQKVLLRVVIYI |
| Ga0209192_100899601 | 3300027752 | Marine | SPLLMSRGLRKEENNEKKRKRVKRNEIQCMILLRSLIFGSTKSEICSEKDFN |
| Ga0208671_102611091 | 3300027757 | Estuarine | MVSPLLLSKGLRKEENNEKKRKRAKRNEIQCMILLRSSIFVPTKPEFCLKKELENIS |
| Ga0209709_100621383 | 3300027779 | Marine | VMVSLLLLSRGLRKEGNNEKKRKRKKRNEIQCMILLKSLIFVSTKSEICSQKVFY |
| Ga0209709_100949172 | 3300027779 | Marine | SRGLRNEEYREKKRKREKRNEIQCMILLRSLIFDGTKSEICLQ |
| Ga0209709_103292741 | 3300027779 | Marine | GLRNEEYKEKKRKREKRNEIQCMILLRSLIFGSTKSEICSEKDL |
| Ga0209711_100183324 | 3300027788 | Marine | LRKEENNEKKRKRVKRNEIQSMILLRSLIFGSTKSEICSEKGNI |
| Ga0209830_101003501 | 3300027791 | Marine | KEENNEKKRKRVKRNEIQCMIILKSLIFVSTKSEICSDKDFNI |
| Ga0209091_100429184 | 3300027801 | Marine | KEENNEKKRKRVKRNEIQCMILLRSLIFGSTKSEICSEKDFKTIFFWK |
| Ga0209091_104369851 | 3300027801 | Marine | GLRKEDNNEKKRKRVKRNEIQCMILLRSSIFVPTKPEFCLKKEF |
| Ga0257106_12828861 | 3300028194 | Marine | RGLRKEENNEKKRKRVKRNEIQCMILFKSLIFVSTKSEICSDKDFNI |
| Ga0257114_11635422 | 3300028196 | Marine | RGLRKEENNEKKRKRAKRNEIQCMILLKSSIFVPTKPEFCLKKEF |
| Ga0308025_10419671 | 3300031143 | Marine | VMVPPLLLSRGLRKEENNEKKRKRVKRNEIQCMILFKSLIFGSTKSEICSEKDFN |
| Ga0308010_11268821 | 3300031510 | Marine | KEENNKKKRKRVKRNEIQCMILLRSLIFVTTKPEFCLNKEF |
| Ga0302134_101824743 | 3300031596 | Marine | MVSPLLLSRGLRKEEDNEKKRKRVKRNEIQCMILLRSSIFVPTKPEF |
| Ga0308004_100547873 | 3300031630 | Marine | EEYREKKRKREKRNEIQCMILLKSLIFDCTKSEIC |
| Ga0308004_102943761 | 3300031630 | Marine | GKKRKREKRNEIQCMILFKSLIFGSTKSEICSEKDNI |
| Ga0308004_103713491 | 3300031630 | Marine | LRKEEYREKKRKREKRNEIQCMILLKSLIFDLTKSEIC |
| Ga0308004_103892621 | 3300031630 | Marine | SRGLRKEEYREKKRKREKRNEIQCMILFKSLMFDRTRSEIC |
| Ga0308001_101965711 | 3300031644 | Marine | GLRKEENNEKKRKRVKRNEIQCMILFRSQIVGSSRSEYCLKKEF |
| Ga0308001_102479911 | 3300031644 | Marine | LRKEENNEKKRKRVKRNEIQCMILLKSLIFDLTKSEICF |
| Ga0308001_103447312 | 3300031644 | Marine | MVSPLLLSRGLRKEENNEKKRKRVKRNEIQCMILLKSLIFGSTKSEICSEKDNI |
| Ga0307986_100071401 | 3300031659 | Marine | LLSKGLRKEENNEKKRKRVKRNEIQCMILLRSSIFVPTKPEFCLKKEF |
| Ga0308016_100862881 | 3300031695 | Marine | LRKEENNEKKRKRVKRNEIQCMILLKSLIFGSTKSEICSEKDLRIIELFLNFK |
| Ga0308016_101765081 | 3300031695 | Marine | SRGLRKEEYREKKRKREKRNEIQCMIILKSLIFDCTKSEIC |
| Ga0307995_10891162 | 3300031696 | Marine | RKEEYREKKRKREKRNEIQCMILLRSQIVGSSKSEFCLKKEF |
| Ga0307998_13052202 | 3300031702 | Marine | NEKKRKRVKRNEIQCMILLKSLIFVPTKPEFCLNKEF |
| Ga0308013_100759062 | 3300031721 | Marine | MVPPLLLSRGLRKEENNEKKRKRVKRNEIQCMILFRSQIVGSSRSEYCLKKES |
| ⦗Top⦘ |