


| Basic Information | |
|---|---|
| Family ID | F052440 |
| Family Type | Metagenome |
| Number of Sequences | 142 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MNDPQPEGHMASYIGRRKFLATLLGGAAAAWPLAARAQ |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 142 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.14 % |
| % of genes near scaffold ends (potentially truncated) | 85.92 % |
| % of genes from short scaffolds (< 2000 bps) | 92.25 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.831 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (42.254 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.859 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.408 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.97% β-sheet: 0.00% Coil/Unstructured: 53.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 142 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 7.04 |
| PF03401 | TctC | 4.93 |
| PF13185 | GAF_2 | 4.93 |
| PF13378 | MR_MLE_C | 2.11 |
| PF00042 | Globin | 1.41 |
| PF04780 | DUF629 | 1.41 |
| PF02586 | SRAP | 1.41 |
| PF13531 | SBP_bac_11 | 1.41 |
| PF13481 | AAA_25 | 0.70 |
| PF00106 | adh_short | 0.70 |
| PF17172 | GST_N_4 | 0.70 |
| PF13458 | Peripla_BP_6 | 0.70 |
| PF00775 | Dioxygenase_C | 0.70 |
| PF14022 | DUF4238 | 0.70 |
| PF01738 | DLH | 0.70 |
| PF02163 | Peptidase_M50 | 0.70 |
| PF00027 | cNMP_binding | 0.70 |
| PF11319 | VasI | 0.70 |
| PF04226 | Transgly_assoc | 0.70 |
| PF12307 | DUF3631 | 0.70 |
| PF13302 | Acetyltransf_3 | 0.70 |
| PF00665 | rve | 0.70 |
| PF05163 | DinB | 0.70 |
| PF06808 | DctM | 0.70 |
| PF00589 | Phage_integrase | 0.70 |
| PF13467 | RHH_4 | 0.70 |
| PF04240 | Caroten_synth | 0.70 |
| PF01135 | PCMT | 0.70 |
| PF05988 | DUF899 | 0.70 |
| PF04909 | Amidohydro_2 | 0.70 |
| PF02796 | HTH_7 | 0.70 |
| PF04828 | GFA | 0.70 |
| PF07676 | PD40 | 0.70 |
| PF02357 | NusG | 0.70 |
| PF04679 | DNA_ligase_A_C | 0.70 |
| PF01255 | Prenyltransf | 0.70 |
| PF02518 | HATPase_c | 0.70 |
| PF08241 | Methyltransf_11 | 0.70 |
| PF07883 | Cupin_2 | 0.70 |
| PF13676 | TIR_2 | 0.70 |
| PF12697 | Abhydrolase_6 | 0.70 |
| PF03466 | LysR_substrate | 0.70 |
| PF00536 | SAM_1 | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 7.04 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 4.93 |
| COG1017 | Hemoglobin-like flavoprotein | Energy production and conversion [C] | 1.41 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 1.41 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.70 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.70 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.70 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.70 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.70 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.70 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.70 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.70 |
| COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 0.70 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.70 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.70 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.70 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.70 |
| COG2324 | Uncharacterized membrane protein | Function unknown [S] | 0.70 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.83 % |
| Unclassified | root | N/A | 28.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZN2CUW02G3Q6C | Not Available | 524 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10023350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1689 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10108447 | Not Available | 682 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10052057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 913 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1008947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1413 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1041938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 644 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1027192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 909 | Open in IMG/M |
| 3300002910|JGI25615J43890_1072875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 593 | Open in IMG/M |
| 3300005332|Ga0066388_101069467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1361 | Open in IMG/M |
| 3300005332|Ga0066388_103089949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 851 | Open in IMG/M |
| 3300005332|Ga0066388_103492488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
| 3300005332|Ga0066388_104047447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 747 | Open in IMG/M |
| 3300005332|Ga0066388_106606501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300005445|Ga0070708_101845009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 561 | Open in IMG/M |
| 3300005468|Ga0070707_100177196 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2078 | Open in IMG/M |
| 3300005713|Ga0066905_100839698 | Not Available | 799 | Open in IMG/M |
| 3300005713|Ga0066905_101312016 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005713|Ga0066905_101349025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 643 | Open in IMG/M |
| 3300005713|Ga0066905_102141834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300005764|Ga0066903_100599516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1908 | Open in IMG/M |
| 3300005764|Ga0066903_101279456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1368 | Open in IMG/M |
| 3300005764|Ga0066903_101371042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1326 | Open in IMG/M |
| 3300005764|Ga0066903_101419007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1306 | Open in IMG/M |
| 3300005764|Ga0066903_103875330 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300005764|Ga0066903_104681873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 728 | Open in IMG/M |
| 3300005764|Ga0066903_104986325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 704 | Open in IMG/M |
| 3300005764|Ga0066903_105983485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 637 | Open in IMG/M |
| 3300005764|Ga0066903_107392834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 567 | Open in IMG/M |
| 3300006847|Ga0075431_101031162 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300006854|Ga0075425_102563255 | Not Available | 564 | Open in IMG/M |
| 3300009792|Ga0126374_10762478 | Not Available | 735 | Open in IMG/M |
| 3300010043|Ga0126380_10141008 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300010046|Ga0126384_12103048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300010359|Ga0126376_11664774 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300010362|Ga0126377_10452925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1306 | Open in IMG/M |
| 3300010362|Ga0126377_11372329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 779 | Open in IMG/M |
| 3300010362|Ga0126377_12112531 | Not Available | 639 | Open in IMG/M |
| 3300010366|Ga0126379_13576618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300010373|Ga0134128_12822018 | Not Available | 535 | Open in IMG/M |
| 3300010376|Ga0126381_101502490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 973 | Open in IMG/M |
| 3300010376|Ga0126381_102439620 | Not Available | 750 | Open in IMG/M |
| 3300010398|Ga0126383_10809614 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300010398|Ga0126383_11550623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 752 | Open in IMG/M |
| 3300010400|Ga0134122_13333726 | Not Available | 505 | Open in IMG/M |
| 3300012204|Ga0137374_11010815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300012206|Ga0137380_10679763 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 895 | Open in IMG/M |
| 3300012948|Ga0126375_10758511 | Not Available | 763 | Open in IMG/M |
| 3300016270|Ga0182036_10403304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1066 | Open in IMG/M |
| 3300016270|Ga0182036_10817482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 760 | Open in IMG/M |
| 3300016270|Ga0182036_11143689 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300016319|Ga0182033_10093353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2193 | Open in IMG/M |
| 3300016341|Ga0182035_10311178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1295 | Open in IMG/M |
| 3300016357|Ga0182032_10430258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1073 | Open in IMG/M |
| 3300016371|Ga0182034_11634176 | Not Available | 566 | Open in IMG/M |
| 3300016404|Ga0182037_10554570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 970 | Open in IMG/M |
| 3300021560|Ga0126371_11411870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 827 | Open in IMG/M |
| 3300021560|Ga0126371_11414010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 826 | Open in IMG/M |
| 3300025910|Ga0207684_10469277 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300025928|Ga0207700_10196863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1696 | Open in IMG/M |
| 3300026324|Ga0209470_1360488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WL7 | 520 | Open in IMG/M |
| 3300027527|Ga0209684_1001248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4537 | Open in IMG/M |
| 3300027654|Ga0209799_1007694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 2269 | Open in IMG/M |
| 3300028878|Ga0307278_10190707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 915 | Open in IMG/M |
| 3300031545|Ga0318541_10033740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2552 | Open in IMG/M |
| 3300031545|Ga0318541_10157973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1246 | Open in IMG/M |
| 3300031564|Ga0318573_10184732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1102 | Open in IMG/M |
| 3300031572|Ga0318515_10323828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 827 | Open in IMG/M |
| 3300031573|Ga0310915_10720030 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300031640|Ga0318555_10522196 | Not Available | 643 | Open in IMG/M |
| 3300031640|Ga0318555_10523551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300031668|Ga0318542_10337145 | Not Available | 774 | Open in IMG/M |
| 3300031668|Ga0318542_10555614 | Not Available | 598 | Open in IMG/M |
| 3300031681|Ga0318572_10928336 | Not Available | 517 | Open in IMG/M |
| 3300031682|Ga0318560_10382160 | Not Available | 761 | Open in IMG/M |
| 3300031713|Ga0318496_10374456 | Not Available | 787 | Open in IMG/M |
| 3300031719|Ga0306917_10336187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1171 | Open in IMG/M |
| 3300031724|Ga0318500_10101772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1308 | Open in IMG/M |
| 3300031736|Ga0318501_10391929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 750 | Open in IMG/M |
| 3300031747|Ga0318502_11008310 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031763|Ga0318537_10258612 | Not Available | 645 | Open in IMG/M |
| 3300031763|Ga0318537_10307504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300031768|Ga0318509_10023932 | Not Available | 2901 | Open in IMG/M |
| 3300031768|Ga0318509_10811365 | Not Available | 517 | Open in IMG/M |
| 3300031770|Ga0318521_10822702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 566 | Open in IMG/M |
| 3300031777|Ga0318543_10427814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300031778|Ga0318498_10183558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 950 | Open in IMG/M |
| 3300031778|Ga0318498_10519273 | Not Available | 524 | Open in IMG/M |
| 3300031781|Ga0318547_10787268 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300031792|Ga0318529_10076678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1482 | Open in IMG/M |
| 3300031797|Ga0318550_10630865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300031798|Ga0318523_10323477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 769 | Open in IMG/M |
| 3300031835|Ga0318517_10232019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
| 3300031845|Ga0318511_10504393 | Not Available | 560 | Open in IMG/M |
| 3300031846|Ga0318512_10278850 | Not Available | 828 | Open in IMG/M |
| 3300031860|Ga0318495_10154870 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300031879|Ga0306919_10345904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga massiliensis | 1135 | Open in IMG/M |
| 3300031879|Ga0306919_10939265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Pseudosulfitobacter → unclassified Pseudosulfitobacter → Pseudosulfitobacter sp. DSM 107133 | 662 | Open in IMG/M |
| 3300031880|Ga0318544_10444787 | Not Available | 504 | Open in IMG/M |
| 3300031890|Ga0306925_10165645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2380 | Open in IMG/M |
| 3300031890|Ga0306925_10689241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1070 | Open in IMG/M |
| 3300031890|Ga0306925_11055189 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300031894|Ga0318522_10428808 | Not Available | 501 | Open in IMG/M |
| 3300031896|Ga0318551_10443652 | Not Available | 741 | Open in IMG/M |
| 3300031910|Ga0306923_10717555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1111 | Open in IMG/M |
| 3300031912|Ga0306921_11689466 | Not Available | 685 | Open in IMG/M |
| 3300031941|Ga0310912_10762378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 748 | Open in IMG/M |
| 3300031942|Ga0310916_11282983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
| 3300031946|Ga0310910_10298864 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300031947|Ga0310909_11244872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300031954|Ga0306926_10256476 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2166 | Open in IMG/M |
| 3300031954|Ga0306926_11112690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 933 | Open in IMG/M |
| 3300031954|Ga0306926_11579842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
| 3300031959|Ga0318530_10397491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 571 | Open in IMG/M |
| 3300032025|Ga0318507_10547319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300032035|Ga0310911_10430983 | Not Available | 763 | Open in IMG/M |
| 3300032035|Ga0310911_10451632 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300032035|Ga0310911_10559390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300032039|Ga0318559_10048847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1764 | Open in IMG/M |
| 3300032039|Ga0318559_10078685 | Not Available | 1432 | Open in IMG/M |
| 3300032041|Ga0318549_10235433 | Not Available | 823 | Open in IMG/M |
| 3300032043|Ga0318556_10397016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 721 | Open in IMG/M |
| 3300032051|Ga0318532_10353894 | Not Available | 521 | Open in IMG/M |
| 3300032052|Ga0318506_10113254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1168 | Open in IMG/M |
| 3300032055|Ga0318575_10442238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300032059|Ga0318533_11156598 | Not Available | 566 | Open in IMG/M |
| 3300032064|Ga0318510_10300528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 669 | Open in IMG/M |
| 3300032065|Ga0318513_10053427 | Not Available | 1814 | Open in IMG/M |
| 3300032076|Ga0306924_10481093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1416 | Open in IMG/M |
| 3300032076|Ga0306924_10894609 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300032076|Ga0306924_10970370 | Not Available | 935 | Open in IMG/M |
| 3300032090|Ga0318518_10020131 | Not Available | 2931 | Open in IMG/M |
| 3300032091|Ga0318577_10144973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1129 | Open in IMG/M |
| 3300032180|Ga0307471_103350011 | Not Available | 568 | Open in IMG/M |
| 3300032261|Ga0306920_101330454 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300032261|Ga0306920_102386245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 730 | Open in IMG/M |
| 3300032261|Ga0306920_104435803 | Not Available | 502 | Open in IMG/M |
| 3300033289|Ga0310914_10239704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1628 | Open in IMG/M |
| 3300033289|Ga0310914_11641757 | Not Available | 546 | Open in IMG/M |
| 3300033290|Ga0318519_10138233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1351 | Open in IMG/M |
| 3300033290|Ga0318519_10949938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 42.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 14.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.41% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.41% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.70% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_11052720 | 2170459003 | Grass Soil | MNDPQAEGHMASYIRRRKFLATLGGAAVWPLAARAQQ |
| AF_2010_repII_A1DRAFT_100233503 | 3300000597 | Forest Soil | MNDPQPEGHMASHIARRKFLATLGGAAAVTWPLAAHAQQRRCR* |
| AF_2010_repII_A1DRAFT_101084472 | 3300000597 | Forest Soil | MNDPQLEGHMASYXXRRKFLATLLGGAAAGWPLAAG |
| AF_2010_repII_A001DRAFT_100520573 | 3300000793 | Forest Soil | MDDPQPEGHMASYIARRKFLATLGDVAVAWPLAVPHSVV* |
| AP72_2010_repI_A100DRAFT_10089471 | 3300000837 | Forest Soil | MNDPQPEGHMASYIARRKFLATLLGGTAVAWPLAARAQQ |
| AP72_2010_repI_A100DRAFT_10419382 | 3300000837 | Forest Soil | MNDPQPEGHMASYIGRRKFLATLGGAAATWPLAAGARAAGAG |
| AP72_2010_repI_A001DRAFT_10271921 | 3300000893 | Forest Soil | PEPEGHMASYIERRKFLSTLGGLAAAWPLAARAQHWAAD* |
| JGI25615J43890_10728752 | 3300002910 | Grasslands Soil | MNDPQPEGHMASHIGRRKFLATLLGGAAAAWPLAARAQQSAMRCD |
| Ga0066388_1010694671 | 3300005332 | Tropical Forest Soil | MNDPQTEGQLASYIGRRKFLATLLGGAAAAWPLAAWAQQPALPVG* |
| Ga0066388_1030899491 | 3300005332 | Tropical Forest Soil | HCMNDPRPEGHMASYIRRRKFLATLGGAAAWPLAARAQQPAYEGGRK* |
| Ga0066388_1034924882 | 3300005332 | Tropical Forest Soil | MNDAQAEGHMVSHIERRKFLATLGAAAAWPLAVRAQGAALAEP* |
| Ga0066388_1040474472 | 3300005332 | Tropical Forest Soil | MNDPQPEGHMASYIARRKFFATLLGGAAVAWPLAARAKRQAAQQ* |
| Ga0066388_1066065012 | 3300005332 | Tropical Forest Soil | MNDPQPEGHMAGYIRRRKFLFLATLLGGAAVGPLAARGQSAVPVIG* |
| Ga0070708_1018450091 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDPQPEGQMASYIRRRNFLATLGGAAAWPLVARAQQAQ* |
| Ga0070707_1001771961 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDPQPEGHMASYIRRREFLATLGGAAAWPLAARAQQPVVGSG* |
| Ga0066905_1008396983 | 3300005713 | Tropical Forest Soil | MNDPQPQGHMASHIGRRKFLATLGGAAAAWPLPARAQ* |
| Ga0066905_1013120162 | 3300005713 | Tropical Forest Soil | MKDPQPGGHMASHIERRRFLATLGGAAAAWPLAAR |
| Ga0066905_1013490251 | 3300005713 | Tropical Forest Soil | RCMNDPQPEGHMASDIERRKFLATLGDAAATWPLAARAQQLSELET* |
| Ga0066905_1021418342 | 3300005713 | Tropical Forest Soil | HCMNDPQPEGHMASHIERRKFLATLGGAAAAWPLAARAQPAKAA* |
| Ga0066903_1005995162 | 3300005764 | Tropical Forest Soil | MNDPQPEGHMASHTERRKFLAALGGTAVAWPLAARGQQYQWR* |
| Ga0066903_1012794561 | 3300005764 | Tropical Forest Soil | MNDPQPEGHMASHIERRKFLATLCGAAAWPLAARAQQ |
| Ga0066903_1013710421 | 3300005764 | Tropical Forest Soil | MNDPQPEGHMASYIARRKFLATLLGGAAAWPLAAR |
| Ga0066903_1014190071 | 3300005764 | Tropical Forest Soil | MGMTPQVEGHMASHIGRRKFLATLGGAAAWPLAAR |
| Ga0066903_1038753303 | 3300005764 | Tropical Forest Soil | MNDPQPEGHMASYIRRREILATLGCAVAWPLAARA |
| Ga0066903_1046818731 | 3300005764 | Tropical Forest Soil | MNDPQAEGHTASYIVRRKFLATLGDAALAWPVAARVQRPTGRRE |
| Ga0066903_1049863252 | 3300005764 | Tropical Forest Soil | MNDPQPEGHMASHIGRRKFLATLGGAAVAWPQPARRIEN* |
| Ga0066903_1059834852 | 3300005764 | Tropical Forest Soil | MNDPQAEGHMVSHIERRKFLATLGAAAAWPLAVRAQGAALAEP* |
| Ga0066903_1073928342 | 3300005764 | Tropical Forest Soil | MNDPQLEGHMASYIARRKFLATLGSAAAAWPLASATIRGHTR |
| Ga0075431_1010311621 | 3300006847 | Populus Rhizosphere | MNDPQPEGHMAIFGRRKFLMTLGGTAAAWPVRVWAHQPAAMRVIVLES* |
| Ga0075425_1025632551 | 3300006854 | Populus Rhizosphere | PEGHMASYLGRRKFLATLGGAAAWPLAARAQSTTA* |
| Ga0126374_107624781 | 3300009792 | Tropical Forest Soil | MKDLQPEGHMASHIERRKFLATLGGAAAWPLAARAQQMSVLG |
| Ga0126380_101410083 | 3300010043 | Tropical Forest Soil | MNDPQPEGHMTSYLGRRKFLAMLGGATAWPVAARA |
| Ga0126384_121030483 | 3300010046 | Tropical Forest Soil | NDPQREGHMASYIQRRKFLATLLGGAAVAWPLAAHAQQAGKVYRTP* |
| Ga0126376_116647741 | 3300010359 | Tropical Forest Soil | MNDPQPEGHVASYIARRKFLATLGGAAVWPLAARAEQIVGHTGR* |
| Ga0126377_104529252 | 3300010362 | Tropical Forest Soil | MNDPQAEGHTASYIVRRKFLATLGDAALAWPVAARVQRPTG |
| Ga0126377_113723292 | 3300010362 | Tropical Forest Soil | MNDPQPEGHMASHIRRRKFLATLGGAAATWPLAARAEQSTKLPT |
| Ga0126377_121125312 | 3300010362 | Tropical Forest Soil | MNDPQLEGHMASYIQRRKFLATLGGTVIAWPLAARA |
| Ga0126379_135766182 | 3300010366 | Tropical Forest Soil | MTPKPEGHMASYIGRRKFLATLLGGAAAAWPLAARA |
| Ga0134128_128220182 | 3300010373 | Terrestrial Soil | MLHGMNDPQPEGHMASHIGRRKFLATLGGAAVAWS |
| Ga0126381_1015024901 | 3300010376 | Tropical Forest Soil | LHCMNDPQPEGHMASYIARRKFFATLLGGAAVAWPLAARAKRQAAQQ* |
| Ga0126381_1024396201 | 3300010376 | Tropical Forest Soil | MNDPQPEGHMASYIARRKFFATLLGGAAAAWPLAARA* |
| Ga0126383_108096141 | 3300010398 | Tropical Forest Soil | RCMNDPQPEGHMASHIGRRKFLATLGGAAAAWPLAAYAITFL* |
| Ga0126383_115506232 | 3300010398 | Tropical Forest Soil | MNDPQLEGHMASYIRRRKFLTTLGGTAAWPLAARAQPSKSPLAR* |
| Ga0134122_133337262 | 3300010400 | Terrestrial Soil | MDTPPAPEDHMAIHIGRREVLCTLASAAVTWPLAARAQQPAR |
| Ga0137374_110108152 | 3300012204 | Vadose Zone Soil | CMNDPQPEGHMASYIERRKFLATLLGGAAVAWPLAARAQQAATRLD* |
| Ga0137380_106797631 | 3300012206 | Vadose Zone Soil | MNDPQVEGHMASHIERRKLLATLGGAATWPLAARAAAGDAGD* |
| Ga0126375_107585111 | 3300012948 | Tropical Forest Soil | PQPEGHMASYIRRRKLLATLLGGTAVAWPLAARSQQPAMKKLA* |
| Ga0126369_116295432 | 3300012971 | Tropical Forest Soil | MGPNAVPFLHCMNDPQPEGHLASHIGRRKFLATLGGAAVAWPL |
| Ga0182036_104033043 | 3300016270 | Soil | MNDPQPDGHMASHIARRKFLAMLGGAAGWPLAARAQQA |
| Ga0182036_108174822 | 3300016270 | Soil | MNDPQPEGHMARYIARRKFLATLVGGAVVAWPVAARAAGR |
| Ga0182036_111436891 | 3300016270 | Soil | MIPHCMNDPQPEGHMASHIGRRKFLATLLGGAAAW |
| Ga0182033_100933531 | 3300016319 | Soil | NDPQPEGHMASYIRRRKFLATLVGGAAAAWPLAARAHLVISAKRL |
| Ga0182035_103111783 | 3300016341 | Soil | NDPQPEGHMASHIARRKFLAMLGGAAGWPLAARAQQASKV |
| Ga0182032_104302581 | 3300016357 | Soil | MNGPQPEGHLASYIQRRKFLATLGGSAAAAWPLAARA |
| Ga0182034_116341762 | 3300016371 | Soil | MNDPQLEGHMASYIARRKFLATLGGAAAWPLAARAQAYPSRP |
| Ga0182037_105545701 | 3300016404 | Soil | HCMNDPQPEGHMASYIARRKFFATLLGGAAVACPLAARAKRRAAQQ |
| Ga0126371_114118703 | 3300021560 | Tropical Forest Soil | VNDPQREGHMASYIQRRKFLATLLGGAAVAWPLAAHAQQAGKVYRTP |
| Ga0126371_114140101 | 3300021560 | Tropical Forest Soil | MNDPQPEGHMASYIRRRKFLATLLVGAAAAWPLAARAQQP |
| Ga0207684_104692772 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDPEPEGHMASYIARRKFLATLGGGAAAWPPAACAQQSAM |
| Ga0207700_101968633 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDPQSEGQMASHIGRRKFLASLGAASAWPLAARAQQP |
| Ga0209470_13604882 | 3300026324 | Soil | MNDPQPKGHMASYIGRRKFLATLGGAAAVAWPLAARA |
| Ga0209684_10012487 | 3300027527 | Tropical Forest Soil | MNDPQPEDHMASYIGRRKFLATLGGAAAAWPFASARKYDRT |
| Ga0209799_10076946 | 3300027654 | Tropical Forest Soil | PQPEGHMGIARRKLLATLGAAAAWPLAARAQQGVIWARQVI |
| Ga0307278_101907073 | 3300028878 | Soil | MNDPQPEGHMASYIGRRKFLATLGGAATWPLAARAQQSS |
| Ga0318541_100337403 | 3300031545 | Soil | MNDLQPEGHMASYIERRKFLATLLGGVAVTWPLAVRAQRPARLLAGKI |
| Ga0318541_101579734 | 3300031545 | Soil | MNDPQAEGHMASHIERRKFLATLGGAAASAWPLAA |
| Ga0318573_101847321 | 3300031564 | Soil | MNDPQPEGHMASYIARRKFLAALGGVAAGWPLAARAQQA |
| Ga0318515_103238283 | 3300031572 | Soil | MNDPQPEGHMASHIGRRKFLATLGGAAVAWPLGAR |
| Ga0310915_107200301 | 3300031573 | Soil | EGHVASYIERRKFLATVGGAAVWPLAARAQQAVKI |
| Ga0318555_105221961 | 3300031640 | Soil | SHHCMNGRQPECHMASHIERRKFLATLGGAAAAWSLAARAQQCYC |
| Ga0318555_105235513 | 3300031640 | Soil | MNDPQPEGHMASYIARRKFLATLLGGAAAAWPLAA |
| Ga0318542_103371452 | 3300031668 | Soil | MNDPQLEGHMASYIARRKFLATFGGAAAWPFAAGAQA |
| Ga0318542_105556142 | 3300031668 | Soil | MNDPQPEGHMASYIGRRKFLATLGGATAAWPLAARAP |
| Ga0318572_109283361 | 3300031681 | Soil | MNDPQPEGHMASYIERRKFLATLLGGAAAWPLAARAAGGPR |
| Ga0318560_103821601 | 3300031682 | Soil | NGPQPEGHMASYIARRKFFATLLGGAAVAWPLAARAKRRAAQQ |
| Ga0318496_103744562 | 3300031713 | Soil | MNDPQPEGHMASYLGRWKFLATLGGAATAWPFAAR |
| Ga0306917_103361871 | 3300031719 | Soil | MNDPQPEGHMASHIERRKFLATLGSAAAAWPYVARAQRIDRTMRRVGVL |
| Ga0318500_101017723 | 3300031724 | Soil | EGRMTVTIGRRELLVALGGAAAAWPLAARAPGFHVRC |
| Ga0318501_103919292 | 3300031736 | Soil | MNDPQPEGHMASHIARRKFLAMLGGAAGWPLAARAQQASKV |
| Ga0318502_110083102 | 3300031747 | Soil | MNDPQPEGHMASRIERRTFLATLGGAAATWPLAAWAQRPD |
| Ga0318537_102586121 | 3300031763 | Soil | MNDPQPEGHMASYIARRKFLAALLGGAAASWPLAARAQQPAACVPLR |
| Ga0318537_103075041 | 3300031763 | Soil | MNDPQPEGHMASHIRRRKFLATLGGAAAAWPLAAH |
| Ga0318509_100239321 | 3300031768 | Soil | MNDPQPEGHMASYIRRRHFLATLLGGAAAWPLATRAQQRPGK |
| Ga0318509_108113651 | 3300031768 | Soil | MNDPQPEGHMASHIGRRKFLATLGGAAAWPLAAHAQ |
| Ga0318521_108227021 | 3300031770 | Soil | MNDPHPEGQMASHIERRKFLATLGGAAAAWPLDAR |
| Ga0318543_104278141 | 3300031777 | Soil | MNDPQPEGHMASYIGRRKVLATLGGAAAWPLAARAQQQAV |
| Ga0318498_101835581 | 3300031778 | Soil | MKTPKPEGHMASYIRRRKFLATLGGAVAWPIATHA |
| Ga0318498_105192731 | 3300031778 | Soil | MNDPQPEGHMASYIRRRKFLATLGGAAVAWPLAAR |
| Ga0318547_107872682 | 3300031781 | Soil | MNDPQPEGHMASDIERRKFLATLGGAVAVWPLAARAQQP |
| Ga0318529_100766782 | 3300031792 | Soil | CINDPQPEGHMASHIGRRKFLATLGGAAAAWPLAADAQ |
| Ga0318550_106308651 | 3300031797 | Soil | MNDPQPEGHMASYIQRRKFLATLGGAAAAWPLAAHSQGA |
| Ga0318523_103234772 | 3300031798 | Soil | MNDPQPEGHMASYLGRRKFLATLLGGAAAWPLAGA |
| Ga0318517_102320192 | 3300031835 | Soil | PQPEGHMASYIGRRKFLATLLGGAAVAWPLAARAKRRAAQQ |
| Ga0318511_105043931 | 3300031845 | Soil | MNDPQPEGHMASYIRRRKFFATLLGGAAAAWPLAARAQQT |
| Ga0318512_102788502 | 3300031846 | Soil | MNDPQPEGHMASYIARRKFLVTLLGGAAAAWPLAARAQQAR |
| Ga0318495_101548701 | 3300031860 | Soil | MNGPQPEGHMASHIERRKFLATLGGAAAAWPLAAR |
| Ga0306919_103459041 | 3300031879 | Soil | CMNDPQPEGHMASYIGRRKFLATLGGAAAWSLAAHAQCGG |
| Ga0306919_109392651 | 3300031879 | Soil | MNDPQPEGHVASYIARRKFLATLGGAAAAWPLAARAQ |
| Ga0318544_104447872 | 3300031880 | Soil | MNDPQPEGHMANHIGRRKLLATLGGAAVAWPLAARATWHR |
| Ga0306925_101656451 | 3300031890 | Soil | MNDPQPEGHMASYIERRKFLATLGGVAAWPLAARHGLSDPS |
| Ga0306925_106892411 | 3300031890 | Soil | MNDPQPEGHMASHFGRRKFLAALGGAAAWPFVARAQQPA |
| Ga0306925_110551891 | 3300031890 | Soil | MTDPQPEGHMASYIRRRKFLATLLGGAAVAWPLAARAQQ |
| Ga0318522_104288081 | 3300031894 | Soil | MNDPQPEGQMASHIGRRKFLATLGSATVAWPLAAP |
| Ga0318551_104436521 | 3300031896 | Soil | MNDPQPEGQMASYLGRRQFLATLGGGAAAAWPLAA |
| Ga0306923_107175551 | 3300031910 | Soil | MNDPQPEGHMARYIARRKFLATLVGSAAAWPFAARAQ |
| Ga0306921_116894662 | 3300031912 | Soil | MNGPQPEGHLASYIGRRELLAALGGAAAWPLAAGAQQ |
| Ga0310912_107623782 | 3300031941 | Soil | MNDPQPEGHMASYIRRRKFLATLLGGAALGWPLAARA |
| Ga0310916_112829832 | 3300031942 | Soil | MNDPQPQGHMASHIGRRKFLVTLGGAAVTWPIAARAQ |
| Ga0310910_102988641 | 3300031946 | Soil | MGMNDPQLEGHMASHIGRRKFLAALLGGVAVAWPLAAR |
| Ga0310909_112448723 | 3300031947 | Soil | MNDPQPEGQMASHIGRRKFLAALGAVVVAWPLAARAQ |
| Ga0306926_102564761 | 3300031954 | Soil | MNDPQPEGHMASYIARRKFFATLLGGAAVAWPLAARAKRR |
| Ga0306926_111126902 | 3300031954 | Soil | MNDPQPEGHMASYIARRKFLATLLGGAAAAWPIAAGAQQTLSTRR |
| Ga0306926_115798422 | 3300031954 | Soil | MIDPQPEGHMASHIGRRKFLATLGAAAAWPLAARA |
| Ga0318530_103974911 | 3300031959 | Soil | MNDPQPEGHMASHIGRRKFLATLLGSAAAWPVAARAQQRPM |
| Ga0318507_105473191 | 3300032025 | Soil | MNDPQPEGHMASYIGRRKVLATLGGAAAWPLAARA |
| Ga0310911_104309831 | 3300032035 | Soil | MNDPQPEGHMASHIGRRKFLATLGGVVAGPLAPRGQQA |
| Ga0310911_104516322 | 3300032035 | Soil | MNDPQPEGHMASYIRRRNFLATLGGAAAWPLADRQG |
| Ga0310911_105593901 | 3300032035 | Soil | MNGPQPEGHMASYIRRRKFLATLLGGAVAWPLTIRAQQPAM |
| Ga0318559_100488473 | 3300032039 | Soil | GRQPECHMASHIERRKFLATLGGAAAAWSLAARAQQCYC |
| Ga0318559_100786851 | 3300032039 | Soil | RCMNDPQPEGHMASYIARRKFFATLLGGAAVAWPLAARAKRRAAQQ |
| Ga0318549_102354331 | 3300032041 | Soil | CMNGPQPEGHMASYIARRKFFATLLGGAAVAWPLAARAKRRAAQQ |
| Ga0318556_103970161 | 3300032043 | Soil | MNDPQPEGHMASYIRRRKFLATLLGGAAAWPLAARAQQGK |
| Ga0318532_103538941 | 3300032051 | Soil | MNDPQPEGHMASHIGRRKFLATLGGAAAWPLATRA |
| Ga0318506_101132541 | 3300032052 | Soil | MNDPQPEGHMASYIRRRECLAALGGAAVAWPLAARAQRP |
| Ga0318575_104422382 | 3300032055 | Soil | MNDPQPEGHMARHIGRRRFLATLGGAAAAWPLAAG |
| Ga0318533_111565981 | 3300032059 | Soil | MNDPRPEGHMASYIGRRRFLATLGGAAAWPLAAWA |
| Ga0318510_103005282 | 3300032064 | Soil | MNDPQPEGHMASYIGRRKFLATLLGGAAAAWPLAARAQ |
| Ga0318513_100534271 | 3300032065 | Soil | MNDPQPEGHMASYIRRRHFLATLLGGAAAWPLATR |
| Ga0306924_104810933 | 3300032076 | Soil | MNDPLPEGHMASYIARRKFLATLAGAAACPLAPRAQQPAK |
| Ga0306924_108946092 | 3300032076 | Soil | MNDPQPEGHMASYIARRNFLATLLGGAAAWPLVARAQQPA |
| Ga0306924_109703702 | 3300032076 | Soil | MNGPQPEGHMASYIARRKFLATLLGGAVAWPLAARAQ |
| Ga0318525_106556231 | 3300032089 | Soil | MTPKPEGHMASHIRRRKFLAALGGAAAAWPLAARAQQSAM |
| Ga0318518_100201311 | 3300032090 | Soil | MNDPQPEGHMASYIRRRHFLATLLGGAAAWPLATRAQQ |
| Ga0318577_101449731 | 3300032091 | Soil | GPQPEGHMASYIARRKFFATLLGGAAVAWPLAARAKRRAAQQ |
| Ga0307471_1033500111 | 3300032180 | Hardwood Forest Soil | MNDPQPEGHMGSHIERRKFLATLGGAAAVWPLAARAQQ |
| Ga0306920_1013304541 | 3300032261 | Soil | MNDPQPEGHMASDIERRKFLATLGGAVAVWPLAARAQQ |
| Ga0306920_1023862452 | 3300032261 | Soil | MNDPQSEGHMASCIRRRKFLAMLGGGAAVWPLAAR |
| Ga0306920_1044358031 | 3300032261 | Soil | MNDPQLEGHMASYIARRKFFATLGGAAAWPLAARAQAYPS |
| Ga0310914_102397044 | 3300033289 | Soil | MGMTPTGGYMASYIARRKFLATLGGAAAAWPLGARAS |
| Ga0310914_116417571 | 3300033289 | Soil | MNDPQPEGHMASYIARRKFLATLLGGAAAAWPLTARAQPPEVQ |
| Ga0318519_101382332 | 3300033290 | Soil | MEAWYYCMNDPQSEGQMASCIQRRKFLATLLGGAAAAWPLAARAQ |
| Ga0318519_109499381 | 3300033290 | Soil | VSFLHCMNDPQPEGHMASRIERRKFLATLGGAVSWPLAARA |
| ⦗Top⦘ |