


| Basic Information | |
|---|---|
| Family ID | F052234 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MRINIWIILAALLALLVITRYLQHDRDTERICADDPSASVCQR |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 42.66 % |
| % of genes near scaffold ends (potentially truncated) | 60.14 % |
| % of genes from short scaffolds (< 2000 bps) | 86.01 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.839 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.077 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.965 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.643 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF05694 | SBP56 | 4.90 |
| PF04392 | ABC_sub_bind | 3.50 |
| PF13442 | Cytochrome_CBB3 | 2.80 |
| PF00589 | Phage_integrase | 2.10 |
| PF13460 | NAD_binding_10 | 2.10 |
| PF08734 | GYD | 2.10 |
| PF00856 | SET | 1.40 |
| PF13545 | HTH_Crp_2 | 1.40 |
| PF01595 | CNNM | 1.40 |
| PF13683 | rve_3 | 1.40 |
| PF13924 | Lipocalin_5 | 1.40 |
| PF05425 | CopD | 1.40 |
| PF00550 | PP-binding | 0.70 |
| PF02775 | TPP_enzyme_C | 0.70 |
| PF03480 | DctP | 0.70 |
| PF13701 | DDE_Tnp_1_4 | 0.70 |
| PF05199 | GMC_oxred_C | 0.70 |
| PF11154 | DUF2934 | 0.70 |
| PF00872 | Transposase_mut | 0.70 |
| PF06823 | DUF1236 | 0.70 |
| PF13991 | BssS | 0.70 |
| PF13649 | Methyltransf_25 | 0.70 |
| PF03972 | MmgE_PrpD | 0.70 |
| PF08241 | Methyltransf_11 | 0.70 |
| PF01370 | Epimerase | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.50 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 2.10 |
| COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 1.40 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.70 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.70 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.84 % |
| Unclassified | root | N/A | 39.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101453182 | Not Available | 572 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10067001 | Not Available | 913 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10071032 | Not Available | 881 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10072757 | Not Available | 869 | Open in IMG/M |
| 3300000955|JGI1027J12803_100822469 | Not Available | 811 | Open in IMG/M |
| 3300000955|JGI1027J12803_102026655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300000956|JGI10216J12902_100605564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300000956|JGI10216J12902_106427941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300000956|JGI10216J12902_118605368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 594 | Open in IMG/M |
| 3300004268|Ga0066398_10043704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 879 | Open in IMG/M |
| 3300004633|Ga0066395_10993062 | Not Available | 512 | Open in IMG/M |
| 3300005172|Ga0066683_10727634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300005187|Ga0066675_10086517 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300005332|Ga0066388_100022756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5572 | Open in IMG/M |
| 3300005332|Ga0066388_100327875 | All Organisms → cellular organisms → Bacteria | 2177 | Open in IMG/M |
| 3300005332|Ga0066388_100869384 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300005332|Ga0066388_101244161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Ancylobacter → Ancylobacter dichloromethanicus | 1277 | Open in IMG/M |
| 3300005332|Ga0066388_105048485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300005332|Ga0066388_105201120 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005332|Ga0066388_105523842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300005332|Ga0066388_107835811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300005363|Ga0008090_10169342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3262 | Open in IMG/M |
| 3300005445|Ga0070708_100125057 | All Organisms → cellular organisms → Bacteria | 2376 | Open in IMG/M |
| 3300005451|Ga0066681_10991507 | Not Available | 501 | Open in IMG/M |
| 3300005468|Ga0070707_100086991 | All Organisms → cellular organisms → Bacteria | 3022 | Open in IMG/M |
| 3300005468|Ga0070707_100357529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1418 | Open in IMG/M |
| 3300005468|Ga0070707_102176393 | Not Available | 522 | Open in IMG/M |
| 3300005471|Ga0070698_100353420 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300005553|Ga0066695_10111177 | Not Available | 1686 | Open in IMG/M |
| 3300005554|Ga0066661_10223020 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300005557|Ga0066704_10266171 | Not Available | 1163 | Open in IMG/M |
| 3300005562|Ga0058697_10089562 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300005713|Ga0066905_100376404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1143 | Open in IMG/M |
| 3300005713|Ga0066905_100600611 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300005713|Ga0066905_100817876 | Not Available | 809 | Open in IMG/M |
| 3300005713|Ga0066905_101689207 | Not Available | 581 | Open in IMG/M |
| 3300005713|Ga0066905_101995342 | Not Available | 538 | Open in IMG/M |
| 3300005764|Ga0066903_100040050 | All Organisms → cellular organisms → Bacteria | 5510 | Open in IMG/M |
| 3300005764|Ga0066903_101564721 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300005764|Ga0066903_101706638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1199 | Open in IMG/M |
| 3300005764|Ga0066903_101775004 | Not Available | 1177 | Open in IMG/M |
| 3300005764|Ga0066903_103515277 | Not Available | 844 | Open in IMG/M |
| 3300005764|Ga0066903_105907191 | Not Available | 642 | Open in IMG/M |
| 3300005764|Ga0066903_106105978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300005764|Ga0066903_107165914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300005764|Ga0066903_107872567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300005764|Ga0066903_108948921 | Not Available | 507 | Open in IMG/M |
| 3300005764|Ga0066903_109007017 | Not Available | 505 | Open in IMG/M |
| 3300006049|Ga0075417_10089516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1384 | Open in IMG/M |
| 3300006163|Ga0070715_10121510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1246 | Open in IMG/M |
| 3300006796|Ga0066665_11564997 | Not Available | 517 | Open in IMG/M |
| 3300006845|Ga0075421_100348340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1790 | Open in IMG/M |
| 3300006845|Ga0075421_102352272 | Not Available | 559 | Open in IMG/M |
| 3300006854|Ga0075425_100289352 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
| 3300006854|Ga0075425_100324844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1771 | Open in IMG/M |
| 3300006871|Ga0075434_101635345 | Not Available | 652 | Open in IMG/M |
| 3300006904|Ga0075424_101657310 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300006904|Ga0075424_102475458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300007076|Ga0075435_100363503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1242 | Open in IMG/M |
| 3300009012|Ga0066710_101292363 | Not Available | 1131 | Open in IMG/M |
| 3300009038|Ga0099829_10727029 | Not Available | 825 | Open in IMG/M |
| 3300010043|Ga0126380_10023849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2989 | Open in IMG/M |
| 3300010043|Ga0126380_10969936 | Not Available | 713 | Open in IMG/M |
| 3300010043|Ga0126380_11025853 | Not Available | 697 | Open in IMG/M |
| 3300010046|Ga0126384_10037407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3269 | Open in IMG/M |
| 3300010046|Ga0126384_11450975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300010048|Ga0126373_10159596 | All Organisms → cellular organisms → Bacteria | 2152 | Open in IMG/M |
| 3300010048|Ga0126373_12245066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. P5 | 607 | Open in IMG/M |
| 3300010337|Ga0134062_10187947 | Not Available | 936 | Open in IMG/M |
| 3300010358|Ga0126370_10915684 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300010358|Ga0126370_10952358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 780 | Open in IMG/M |
| 3300010359|Ga0126376_10179815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1730 | Open in IMG/M |
| 3300010360|Ga0126372_12570350 | Not Available | 560 | Open in IMG/M |
| 3300010366|Ga0126379_10826479 | Not Available | 1026 | Open in IMG/M |
| 3300010366|Ga0126379_12564395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300010366|Ga0126379_13446493 | Not Available | 530 | Open in IMG/M |
| 3300010366|Ga0126379_13847083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300010376|Ga0126381_100141287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3148 | Open in IMG/M |
| 3300010376|Ga0126381_102448957 | Not Available | 748 | Open in IMG/M |
| 3300010863|Ga0124850_1003160 | Not Available | 4946 | Open in IMG/M |
| 3300012204|Ga0137374_10330418 | Not Available | 1238 | Open in IMG/M |
| 3300012208|Ga0137376_10593585 | Not Available | 958 | Open in IMG/M |
| 3300012211|Ga0137377_10174255 | Not Available | 2065 | Open in IMG/M |
| 3300012211|Ga0137377_10936071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
| 3300012355|Ga0137369_10372626 | Not Available | 1036 | Open in IMG/M |
| 3300012358|Ga0137368_10435935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 854 | Open in IMG/M |
| 3300012359|Ga0137385_10420903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1137 | Open in IMG/M |
| 3300012532|Ga0137373_10090414 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2701 | Open in IMG/M |
| 3300012923|Ga0137359_11305041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300016270|Ga0182036_10557269 | Not Available | 914 | Open in IMG/M |
| 3300016319|Ga0182033_11506567 | Not Available | 607 | Open in IMG/M |
| 3300016357|Ga0182032_10726302 | Not Available | 835 | Open in IMG/M |
| 3300016371|Ga0182034_10269639 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300016445|Ga0182038_10817078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. P5 | 818 | Open in IMG/M |
| 3300018468|Ga0066662_10996774 | Not Available | 829 | Open in IMG/M |
| 3300021168|Ga0210406_11181449 | Not Available | 558 | Open in IMG/M |
| 3300025885|Ga0207653_10347664 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300025885|Ga0207653_10448077 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300025910|Ga0207684_10012110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7509 | Open in IMG/M |
| 3300025922|Ga0207646_10392490 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300026304|Ga0209240_1237038 | Not Available | 555 | Open in IMG/M |
| 3300026319|Ga0209647_1215769 | Not Available | 653 | Open in IMG/M |
| 3300027874|Ga0209465_10019566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3107 | Open in IMG/M |
| 3300028881|Ga0307277_10478656 | Not Available | 558 | Open in IMG/M |
| 3300031546|Ga0318538_10058662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1903 | Open in IMG/M |
| 3300031546|Ga0318538_10136856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1287 | Open in IMG/M |
| 3300031546|Ga0318538_10459957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Ancylobacter → Ancylobacter dichloromethanicus | 689 | Open in IMG/M |
| 3300031573|Ga0310915_10557593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 813 | Open in IMG/M |
| 3300031640|Ga0318555_10291098 | Not Available | 883 | Open in IMG/M |
| 3300031679|Ga0318561_10349818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300031713|Ga0318496_10857074 | Not Available | 501 | Open in IMG/M |
| 3300031747|Ga0318502_10684992 | Not Available | 619 | Open in IMG/M |
| 3300031770|Ga0318521_10388261 | Not Available | 831 | Open in IMG/M |
| 3300031770|Ga0318521_10528107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 710 | Open in IMG/M |
| 3300031770|Ga0318521_10555559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. P5 | 692 | Open in IMG/M |
| 3300031771|Ga0318546_10426575 | Not Available | 927 | Open in IMG/M |
| 3300031777|Ga0318543_10444965 | Not Available | 581 | Open in IMG/M |
| 3300031778|Ga0318498_10263724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 775 | Open in IMG/M |
| 3300031778|Ga0318498_10563031 | Not Available | 500 | Open in IMG/M |
| 3300031781|Ga0318547_10830771 | Not Available | 576 | Open in IMG/M |
| 3300031794|Ga0318503_10155620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
| 3300031846|Ga0318512_10283334 | Not Available | 822 | Open in IMG/M |
| 3300031860|Ga0318495_10406222 | Not Available | 600 | Open in IMG/M |
| 3300031879|Ga0306919_11263837 | Not Available | 560 | Open in IMG/M |
| 3300031890|Ga0306925_10095339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3162 | Open in IMG/M |
| 3300031910|Ga0306923_12267438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300031941|Ga0310912_10677067 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300031942|Ga0310916_11456429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300031954|Ga0306926_10749748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1180 | Open in IMG/M |
| 3300031981|Ga0318531_10151539 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300032001|Ga0306922_11367789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300032025|Ga0318507_10376528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300032039|Ga0318559_10405606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300032051|Ga0318532_10037043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. P5 | 1646 | Open in IMG/M |
| 3300032059|Ga0318533_10079967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2229 | Open in IMG/M |
| 3300032059|Ga0318533_10459948 | Not Available | 931 | Open in IMG/M |
| 3300032064|Ga0318510_10043149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. P5 | 1569 | Open in IMG/M |
| 3300032076|Ga0306924_12175087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300032091|Ga0318577_10236366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Ancylobacter → Ancylobacter dichloromethanicus | 875 | Open in IMG/M |
| 3300032094|Ga0318540_10494453 | Not Available | 590 | Open in IMG/M |
| 3300032261|Ga0306920_100126353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3803 | Open in IMG/M |
| 3300033289|Ga0310914_10042703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3703 | Open in IMG/M |
| 3300033289|Ga0310914_10587747 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 19.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.39% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.70% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.70% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1014531821 | 3300000364 | Soil | MRFNIWVILAALLALLVATRYLQHERDTDRICADDPSASV |
| AF_2010_repII_A1DRAFT_100670012 | 3300000597 | Forest Soil | MRMNIWIMLAALLALLAITRYAQHEKEAERICVDDLTASVCHR* |
| AF_2010_repII_A1DRAFT_100710323 | 3300000597 | Forest Soil | MPRGGKATPMRVNIWIILATLLALLVITRYLQHHGETERICADDPTASVCQR* |
| AF_2010_repII_A1DRAFT_100727572 | 3300000597 | Forest Soil | VRINIWIILATLLALLVIIRYMQHQETPAICVDEPTAAVCHR* |
| JGI1027J12803_1008224692 | 3300000955 | Soil | MRLNIWITLASLLALLAIIRYMQRPADTQICVDDPTASVCHR* |
| JGI1027J12803_1020266553 | 3300000955 | Soil | WIILAALLALLVITRYLQQDRDTQRICADDPSVSACQQ* |
| JGI10216J12902_1006055642 | 3300000956 | Soil | MRVNIWIILAALLALLVITRYMQHEQDTDRICANDPTASVCQR* |
| JGI10216J12902_1064279411 | 3300000956 | Soil | MRLNIWVILATLLALLLATRYLQHEGYTQRICADDPSASV |
| JGI10216J12902_1186053681 | 3300000956 | Soil | MRINTWIILGTLLALLAITRYMQHQGDQRICVDDP |
| Ga0066398_100437041 | 3300004268 | Tropical Forest Soil | MRLNIWIILAALLALLVITRYIQQERDTERICADDPSASACQR* |
| Ga0066395_109930621 | 3300004633 | Tropical Forest Soil | MRINIWIILATLLALLAITRYVQEGRHTEHICANDPTASACER* |
| Ga0066683_107276342 | 3300005172 | Soil | QCGGRSALMRINIWIILGTLLALLAITRYMQHREDTQRICANDPTASVCER* |
| Ga0066675_100865172 | 3300005187 | Soil | MRINIWIILGTLLALLAIARYMQHQGDQRICVDDPTASVCHR* |
| Ga0066388_1000227565 | 3300005332 | Tropical Forest Soil | MRINIWIILATLLALLVITRYLQQDRNTQRICADDPSASVCQQ* |
| Ga0066388_1003278754 | 3300005332 | Tropical Forest Soil | MRMNIWIILAALLALLAITRYAQQGRNTQRICADDPTASVCHR* |
| Ga0066388_1008693843 | 3300005332 | Tropical Forest Soil | MRINIWIILGVLLVLFAITRLWRHQQDIQRICADDPSASVCER* |
| Ga0066388_1012441612 | 3300005332 | Tropical Forest Soil | MRINIWIILGTLLALLAITRYLQDQRDTQRICADDPTASVCQR* |
| Ga0066388_1050484852 | 3300005332 | Tropical Forest Soil | MRINIWIILAALLALLVITRYLQQDRDTQRICADDPSASVCQR* |
| Ga0066388_1052011202 | 3300005332 | Tropical Forest Soil | MRINIWIILAALLALLVITRYLQHDRDTERICADDPSASVCQR* |
| Ga0066388_1055238421 | 3300005332 | Tropical Forest Soil | MRINIWIILASLLALLVITRYLQQARDTQRICADDPSASVCQR* |
| Ga0066388_1078358111 | 3300005332 | Tropical Forest Soil | MHQVHAQGLLSGAGKPALMRINIWIALAVLLALLAITRLSQCQHETERICADDPSASECQR* |
| Ga0008090_101693423 | 3300005363 | Tropical Rainforest Soil | MRINIWIILATLLALLVITRYIQHEKDAERICLDDPTASVCQRRLLSQIE* |
| Ga0070708_1001250574 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRINIWIILAALLALLAITRYMQHQQDTERICANDPTASVCQR* |
| Ga0066681_109915072 | 3300005451 | Soil | MRINIWIVIAILTALLAITRYFVQERETQRICADDPSASVCQ |
| Ga0070707_1000869914 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ALMRINIWIILAALLALLAITRYMQHQQDTERICANDPTASVCQR* |
| Ga0070707_1003575293 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRINIWIILAALLALLVITRYMQNDRTQRICADDPSASVCQR |
| Ga0070707_1021763932 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRGGKATLMRVNIWIILATLLALLVITRYLQHQGETKRICTDDPTASVCQR* |
| Ga0070698_1003534202 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVNIWIILAALLALLVITRYMQHERDTDRICANDPTASVCQR* |
| Ga0066695_101111772 | 3300005553 | Soil | MRINIWIVIAILTALLAITRYFVQERETQRICADDPSASVCQR* |
| Ga0066661_102230201 | 3300005554 | Soil | QCGGRSALMRINIWIILGTLLALLAIARYMQHQGDQRICVDDPTASVCHR* |
| Ga0066704_102661711 | 3300005557 | Soil | MRINIWIILAALLALLAITRYMQHQQDTERICANDPT |
| Ga0058697_100895622 | 3300005562 | Agave | MRLTVWLILAALLALVLVIRYMQKHETPAICVDDPTASVCHR* |
| Ga0066905_1003764042 | 3300005713 | Tropical Forest Soil | MRINIWIILAALLALLVMTRYLQQDRDTQRICADDPSASVCQR* |
| Ga0066905_1006006112 | 3300005713 | Tropical Forest Soil | MRINIWIILATLLALLAITRYVQEGRHTEHICANGPTALACER* |
| Ga0066905_1008178761 | 3300005713 | Tropical Forest Soil | MRMNIWIILAALLALLAITRYAQQGKNTQRICADDPTASVCHR* |
| Ga0066905_1016892071 | 3300005713 | Tropical Forest Soil | NSSPGQAALMRINIWIILASLLALLVITRYLQHDRDTERICADDPSASVCQR* |
| Ga0066905_1019953422 | 3300005713 | Tropical Forest Soil | MRLNIWVIFATLLALLLATRYLQHEGYTQRICADDPSASDADGK |
| Ga0066903_10004005012 | 3300005764 | Tropical Forest Soil | MRMNIWIILAALLALLAITRYAQQGRNTQRICADDPTASVCH |
| Ga0066903_1015647212 | 3300005764 | Tropical Forest Soil | MRINIWIILAALLALLVITRYLQQDGDTQRICADDPSASVCQR* |
| Ga0066903_1017066381 | 3300005764 | Tropical Forest Soil | MRLNIWVILAALLALLVATRYLQHERDTERICADDPSA |
| Ga0066903_1017750043 | 3300005764 | Tropical Forest Soil | MRLNIWIILATLLALFAIIRYMQSPGDTQICIDDPTAAVAIDES* |
| Ga0066903_1035152771 | 3300005764 | Tropical Forest Soil | MRLNIWIILATLLALFAIIRYMQSPGDTQICIDDPTAAVAIDEVK |
| Ga0066903_1059071911 | 3300005764 | Tropical Forest Soil | MRLNIWIIVATLLALLAIIRYMQRPGDMQICVDDPTAPVCHR* |
| Ga0066903_1061059782 | 3300005764 | Tropical Forest Soil | ILAALLALLVITRYMQNDRDTQRICTDDPSASVCQQ* |
| Ga0066903_1071659142 | 3300005764 | Tropical Forest Soil | MHQVHAQGLLSGAGKTALMRINIWIVLAVLLALLAITRLSQCQHETERICADDPSASECQR* |
| Ga0066903_1078725672 | 3300005764 | Tropical Forest Soil | MRINIWIILAALLALLVITRYLQQDRDTQRICADDPIASACQR* |
| Ga0066903_1089489212 | 3300005764 | Tropical Forest Soil | MMRLNIWVILAALLALLVATRYLQHERDTERICADDPSAP |
| Ga0066903_1090070173 | 3300005764 | Tropical Forest Soil | MRINIWIILAALLALLVITRYLQQDRDMQRICADDPSASA |
| Ga0075417_100895162 | 3300006049 | Populus Rhizosphere | MRINVWIILGILLVLFAMTRYTKYQKDTERICANDPTASVCER* |
| Ga0070715_101215102 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLNIWIILASLLALLAIIRYMQRPADTQICVDDPTASVAIDES* |
| Ga0066665_115649972 | 3300006796 | Soil | MRLNFWILLATLLALLAITRYMQRPGDTQICVDDPTASV |
| Ga0075421_1003483405 | 3300006845 | Populus Rhizosphere | MRINVWIILGILLVLFAMTRYTKYQKDTERICANDPTASVC |
| Ga0075421_1023522721 | 3300006845 | Populus Rhizosphere | MVLRRQVAYRQRGGWSALMRIDIWVIVLVTLLALLVVARYLQHQGDTQRICVDDPTASVCHR* |
| Ga0075425_1002893521 | 3300006854 | Populus Rhizosphere | MRINIWIILAALLALLVITRYMQEDRDTQRICADDPTASVCHR* |
| Ga0075425_1003248442 | 3300006854 | Populus Rhizosphere | MRINIWIVLAILLVLLAVTRYAQYQRDTQERICVDDPTASVCERM* |
| Ga0075434_1016353452 | 3300006871 | Populus Rhizosphere | AALLALLAITRYMQHQQDTERICANDPTASVCQR* |
| Ga0075424_1016573101 | 3300006904 | Populus Rhizosphere | MRVNIWIILAALLALLVITRYMQHERDTDRICANDPTAS |
| Ga0075424_1024754581 | 3300006904 | Populus Rhizosphere | INIWIILAALLALLVITRYLQQDRDTQRICADDPSVSACQQ* |
| Ga0075435_1003635031 | 3300007076 | Populus Rhizosphere | MRINIWIVLAILLTLLAVTRYLPHRGDTQRVCVDDPTASVC |
| Ga0066710_1012923633 | 3300009012 | Grasslands Soil | ALMRINIWIILGTLLALLAITRYMQHQGDTQRICANDPTASVCHR |
| Ga0099829_107270291 | 3300009038 | Vadose Zone Soil | KAPLMRMNIWIILATLLALLAITRYMQHEKDTERICVDDPTASVCHR* |
| Ga0126380_100238493 | 3300010043 | Tropical Forest Soil | MRINIWIILASLLALLVITRYLQHDRDTERICADDPSASVCQR* |
| Ga0126380_109699361 | 3300010043 | Tropical Forest Soil | LNCETQLPMPRRQRFLTMRLNIWVILAALLALLVATRYLQHERDTERICADDPSASVCGR |
| Ga0126380_110258531 | 3300010043 | Tropical Forest Soil | MRMNIWIILAALLALLAITRYAQQGKNTQGICADDPTASVCHR* |
| Ga0126384_100374076 | 3300010046 | Tropical Forest Soil | MRMNIWIILAALLALLAITRYAQQGRNTQRICADGPTASVCHR* |
| Ga0126384_114509752 | 3300010046 | Tropical Forest Soil | LREQRGCWAALMRINIWIILATLLALLVITRYLEQGRDTQRICADDPSASVCQR* |
| Ga0126373_101595963 | 3300010048 | Tropical Forest Soil | ALMRVNIWIVLAILLVLLAVARYVRYQGDRERICIDDPTASVCHR* |
| Ga0126373_122450662 | 3300010048 | Tropical Forest Soil | ILAALLALLAITRYLQHQQDTQRICADDPTASVCQR* |
| Ga0134062_101879471 | 3300010337 | Grasslands Soil | MRLNIWVILATLLALLLATRYLQHEGYTQRICADDPRAS |
| Ga0126370_109156841 | 3300010358 | Tropical Forest Soil | MRINTWIILAALLALLVITRYLQQDRDTQRICADDPSASV |
| Ga0126370_109523582 | 3300010358 | Tropical Forest Soil | MRINIWIILDVLLVLFAITRLWRHQQDIQRICADDPSASVCER* |
| Ga0126376_101798154 | 3300010359 | Tropical Forest Soil | IWIILAALLALLVITRYMQNDRDTQRICTDDPSASVCQQ* |
| Ga0126372_125703501 | 3300010360 | Tropical Forest Soil | ETQLPMPRRQRFLTMRLNIWVILAALLALLVATRHLQHERDTERICADDPSASVCGR* |
| Ga0126379_108264792 | 3300010366 | Tropical Forest Soil | VKAAERSAKTLPSVAGLALMRMNIWIMLAALLALLAITRYAQHEKEAERICVDDLTASVCHR* |
| Ga0126379_125643951 | 3300010366 | Tropical Forest Soil | IMLAALLALLAITRYAQHEKEAERICVDDPTASVCHR* |
| Ga0126379_134464931 | 3300010366 | Tropical Forest Soil | FLTMRLNIWVILAALLALLVATRYLQHERDTERICADDPSASVCGR* |
| Ga0126379_138470831 | 3300010366 | Tropical Forest Soil | RLNIWIIFAALLALLAITRYLQHQQDTRRICADDPTASACQREERLSNVI* |
| Ga0126381_1001412871 | 3300010376 | Tropical Forest Soil | PRRGRAALMRINIWIILASLLALLVITRYLQHDRDTERICADDPSASVCQR* |
| Ga0126381_1024489572 | 3300010376 | Tropical Forest Soil | MMRLNIWVILAALLALLVATRYLQHERDTERICADD |
| Ga0124850_10031602 | 3300010863 | Tropical Forest Soil | MPRRQRFLTMRLNIWVIFATLLALLLATRYLQHEGYTQRICADDPSASVCGR* |
| Ga0137374_103304182 | 3300012204 | Vadose Zone Soil | MRINIWIILGILLGLFAITRYAHYQKDTERICANEPTASVCER* |
| Ga0137376_105935854 | 3300012208 | Vadose Zone Soil | PLMRMNIWIILATLLALLAITRYMQHEKDTERICVDDPTASVCHR* |
| Ga0137377_101742553 | 3300012211 | Vadose Zone Soil | MRINIWIILGALLALLAITRYTQYREDTQRICAKDPTASVCER* |
| Ga0137377_109360712 | 3300012211 | Vadose Zone Soil | MRMNIWIILATLLALLAITRYMQHEKDTERICVDDPTASVCHR* |
| Ga0137369_103726261 | 3300012355 | Vadose Zone Soil | MRINIWIILGPLLALLAITRYMQHQKDTQRICANDPTASVCER* |
| Ga0137368_104359351 | 3300012358 | Vadose Zone Soil | MRVNIWIVLAFLLALFAITRFAHYQGDTRRICADDPSASVCQR* |
| Ga0137385_104209031 | 3300012359 | Vadose Zone Soil | QMRINIWIILGALLALLAITRYTQYREDTQRICAKDPTASVCER* |
| Ga0137373_100904144 | 3300012532 | Vadose Zone Soil | MRINIWIILGALLALLSITRYTQYREDTQRICAKDPTASVCER* |
| Ga0137359_113050413 | 3300012923 | Vadose Zone Soil | IWIILAALLALLVITRYLQHDRDTQRICADDPSASVCQR* |
| Ga0182036_105572692 | 3300016270 | Soil | RQRFLTMRLNIWVILAALLALLVATRHLQHERDTERICADDPSASVCGR |
| Ga0182033_115065671 | 3300016319 | Soil | CETQLPMPRRQRFLTMRLNIWVILAALLALLVATRYLQHERDTERICADDPSASVCGR |
| Ga0182032_107263022 | 3300016357 | Soil | ETQLPMPRRQRFLTMRLNIWVILAALLALLVATRHLQHERDTERICADDPSASVCGR |
| Ga0182034_102696393 | 3300016371 | Soil | WLALMRMNIWIILAALLALLAITRYAEQDRNTQRTCADDPTASVCHR |
| Ga0182038_108170781 | 3300016445 | Soil | NAGQGALMRLNIWIIFAALLALLAITRYLQHQQDTRRICADDPTASACQ |
| Ga0066662_109967742 | 3300018468 | Grasslands Soil | MRINIWIILAALLALLAITRYMQHQQDTERICANDPTASVC |
| Ga0210406_111814492 | 3300021168 | Soil | RAALMRINIWIVLAILLVLLAVTRYAQYQRDTQERICVDDPTASVCERM |
| Ga0207653_103476642 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VAGLALMRINIWIILAALLALLVITRYMQNDRTQRICADDPSASVCQR |
| Ga0207653_104480772 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGQGALMRINIWIILAALLALLAITRYMQHQQDTERICANDPTASVCQR |
| Ga0207684_100121106 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRINIWIILAALLALLAITRYMQHQQDTERICANDPTASVCQR |
| Ga0207646_103924901 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRINIWIILAALLALLVITRYMQNDRTQRICADDPSASVCQ |
| Ga0209240_12370381 | 3300026304 | Grasslands Soil | MRMNIWIILATLLALLAITRYMQHEKDTERICVDDPTASVCHR |
| Ga0209647_12157691 | 3300026319 | Grasslands Soil | AALMRINIWIILAALLALLVITRYLQHDRDTQRICADDPSASVCQR |
| Ga0209465_100195663 | 3300027874 | Tropical Forest Soil | MPRRQRFLTMRLNIWVILAALLALLVATRYLQHERDTERICADDPSASVCGR |
| Ga0307277_104786561 | 3300028881 | Soil | MRINIWIILGILLALFAITRYTHYQKDAERICANDPTESVCER |
| Ga0318538_100586623 | 3300031546 | Soil | MRVNIWILLAIPLVLLAVARYVRYQEDQRICVDDPTAGCAIGEKA |
| Ga0318538_101368561 | 3300031546 | Soil | MRINIWIILATLLALLVITRYLQHDRDTQRICADDPSASVC |
| Ga0318538_104599572 | 3300031546 | Soil | MRVNIWIIHAALLALLAITRYLQHQQDTQRICGDD |
| Ga0310915_105575932 | 3300031573 | Soil | MRINIWIILATLLALLVITRYLQQDRDTQRICADDPSA |
| Ga0318555_102910981 | 3300031640 | Soil | MRISIWIILATLLALLAITRYVQEGRHTEHICANDPT |
| Ga0318561_103498182 | 3300031679 | Soil | LTMRLNIWVILAALLALLVATRHLQHERDTERICADDPSASVCGR |
| Ga0318496_108570741 | 3300031713 | Soil | MRINIWIVLAFLLVLFAVTRYLRYQEDTQRICADDPTASVCER |
| Ga0318502_106849921 | 3300031747 | Soil | TQLPMPRRQRFLTMRLNIWVILAALLALLVATRYLQHERDTERICADDPSASVCGR |
| Ga0318521_103882611 | 3300031770 | Soil | EGGAGALMRINLWIILAALLALLAITRYLQDQQDTEHICADDPTASVCQR |
| Ga0318521_105281071 | 3300031770 | Soil | IWIILAALLALLAITRYLQHQHDTQRICGDDPTASVCQR |
| Ga0318521_105555592 | 3300031770 | Soil | DAGQGALMRLNIWIIFAALLALLAITRYLQHQQDTRRICADDPTASACQ |
| Ga0318546_104265752 | 3300031771 | Soil | RLNCETQLPMPRRQRFLTMRLNIWVILAALLALLVATRYLQHQRDTERICADDPSASVCG |
| Ga0318543_104449651 | 3300031777 | Soil | RRFLTMRLNIWVILAALLALLVATRYLQHERDTERICADDPSASVCGR |
| Ga0318498_102637241 | 3300031778 | Soil | VNIWIMLAALLALLVITRYLQHQQDTQRICGDDPTASVCQR |
| Ga0318498_105630312 | 3300031778 | Soil | NIWIVLAFLLVLFAVTRYLRYQEDTQRICADDPTASVCER |
| Ga0318547_108307711 | 3300031781 | Soil | SVAGFALMRMNIWIILAALLALLAITRYAQQGRNTQRICADDPTASVCHR |
| Ga0318503_101556202 | 3300031794 | Soil | GQGALMRVNIWIILAALLALLAITRYLQHQHDTQRICGDDPTASVCQR |
| Ga0318512_102833342 | 3300031846 | Soil | LATLLALLAITRYVQEGRHTEHICANDPTASACER |
| Ga0318495_104062222 | 3300031860 | Soil | MRLNIWVILAALLALLVATRYLQHQRDTERICADDPS |
| Ga0306919_112638371 | 3300031879 | Soil | AQRTGHDYAHHWLALMRMNIWIILAALLALLAITRYAEQGRNTQRICADDPTASVCHR |
| Ga0306925_100953396 | 3300031890 | Soil | MPRRQRFLTMRLNIWVIFATLLALLLATRYLQHEGYTQRICADDPSASVCGR |
| Ga0306923_122674381 | 3300031910 | Soil | WIILAALLALLAITWYLQHQQDTQRICGDDPTASVCQR |
| Ga0310912_106770672 | 3300031941 | Soil | MRLNIWVILAALLALLLATRYLQHEGYTQRICGDDPSASGMRTVR |
| Ga0310916_114564292 | 3300031942 | Soil | EPFAGNAGGQGSLMAVNIWTILAAPLALLAITRYLQHQQDTQRIRGDDPTASVCQR |
| Ga0306926_107497483 | 3300031954 | Soil | LNCETQLPMPRRQRFLTMRLNIWVILAALLALLVATRHLQHERDTERICADDPSASVCGR |
| Ga0318531_101515392 | 3300031981 | Soil | PSVAGLALMRMNIWIILAALLALLAITRYAEQDRNTQRICADDPTASVCHR |
| Ga0306922_113677891 | 3300032001 | Soil | MRMNIWIILAALLALLAITRYAQQGRNTQRICADDPTASA |
| Ga0318507_103765283 | 3300032025 | Soil | INIWIILASLLALLVITRYLQQARDTQRICADDPSASVCQR |
| Ga0318559_104056062 | 3300032039 | Soil | IILAALLALLAITRYLQHQQDTQRICGDDPTAPVCQR |
| Ga0318532_100370431 | 3300032051 | Soil | LHRNAGQGALMRLNIWIIFAALLALLAITRYLQHQQDTRRICADDPTASACQ |
| Ga0318533_100799675 | 3300032059 | Soil | CRAIHRNAGQGALMRLNIWIIFAALLALLAITRYLQHQQDTRRICADDPTASACQ |
| Ga0318533_104599482 | 3300032059 | Soil | RFLTMRLNIWVILAALLALLVATRYLQHERDTERICADDPSASVCGR |
| Ga0318510_100431491 | 3300032064 | Soil | ALMRLNIWIIFAALLALLAITRYLQHQQDTRRICADDPTASACQ |
| Ga0306924_121750872 | 3300032076 | Soil | MRINIWIILATLLALLVITRYLQQDRDTQRICADDPSASVC |
| Ga0318577_102363661 | 3300032091 | Soil | MRVNIWIIHAALLALLAITRYLQHQQDTQRICGDDPTASV |
| Ga0318540_104944531 | 3300032094 | Soil | QRFLTMRLNIWVILAALLALLVATRYLQHERDTERICADDPSASVCGR |
| Ga0306920_1001263531 | 3300032261 | Soil | MRMNIWIILAALLALLAITRYAQQGRNTQHICADDPTASACHR |
| Ga0310914_100427031 | 3300033289 | Soil | MRINLWIILAALLALLAITRYLQDQQDTEHICADDPTASVCQR |
| Ga0310914_105877472 | 3300033289 | Soil | PSVAGLALMRMNIWIILAALLALLAITRYAEQDRNTQRTCADDPTASVCHR |
| ⦗Top⦘ |