


| Basic Information | |
|---|---|
| Family ID | F052211 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 45 residues |
| Representative Sequence | PVDCSAGEDVYHEQYATFHLAKGGPVGVTSNVTLTRSTMIKF |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.10 % |
| % of genes near scaffold ends (potentially truncated) | 93.71 % |
| % of genes from short scaffolds (< 2000 bps) | 93.71 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.217 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.776 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.671 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.245 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.71% β-sheet: 0.00% Coil/Unstructured: 54.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF10049 | DUF2283 | 6.29 |
| PF00903 | Glyoxalase | 3.50 |
| PF13531 | SBP_bac_11 | 3.50 |
| PF06707 | DUF1194 | 2.80 |
| PF01594 | AI-2E_transport | 2.10 |
| PF00296 | Bac_luciferase | 1.40 |
| PF01208 | URO-D | 1.40 |
| PF00857 | Isochorismatase | 1.40 |
| PF00501 | AMP-binding | 0.70 |
| PF01794 | Ferric_reduct | 0.70 |
| PF13410 | GST_C_2 | 0.70 |
| PF12680 | SnoaL_2 | 0.70 |
| PF02423 | OCD_Mu_crystall | 0.70 |
| PF05598 | DUF772 | 0.70 |
| PF07859 | Abhydrolase_3 | 0.70 |
| PF06100 | MCRA | 0.70 |
| PF01042 | Ribonuc_L-PSP | 0.70 |
| PF13620 | CarboxypepD_reg | 0.70 |
| PF17137 | DUF5110 | 0.70 |
| PF13518 | HTH_28 | 0.70 |
| PF03404 | Mo-co_dimer | 0.70 |
| PF13744 | HTH_37 | 0.70 |
| PF08924 | DUF1906 | 0.70 |
| PF04964 | Flp_Fap | 0.70 |
| PF02656 | DUF202 | 0.70 |
| PF07298 | NnrU | 0.70 |
| PF07690 | MFS_1 | 0.70 |
| PF05973 | Gp49 | 0.70 |
| PF11185 | DUF2971 | 0.70 |
| PF00171 | Aldedh | 0.70 |
| PF09587 | PGA_cap | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 2.10 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 1.40 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 1.40 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.40 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.40 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.70 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.70 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.70 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.70 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.70 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.70 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.70 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.70 |
| COG4094 | Uncharacterized membrane protein | Function unknown [S] | 0.70 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.70 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.70 |
| COG4716 | Myosin-crossreactive antigen (function unknown) | Function unknown [S] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.22 % |
| Unclassified | root | N/A | 16.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002914|JGI25617J43924_10003544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4520 | Open in IMG/M |
| 3300004091|Ga0062387_101224985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 589 | Open in IMG/M |
| 3300004092|Ga0062389_101618341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. | 830 | Open in IMG/M |
| 3300004635|Ga0062388_102741716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300005343|Ga0070687_100537519 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300005406|Ga0070703_10552366 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005530|Ga0070679_100357990 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300005533|Ga0070734_10347397 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300005610|Ga0070763_10036665 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300005712|Ga0070764_10324163 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300005712|Ga0070764_10482566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 743 | Open in IMG/M |
| 3300005712|Ga0070764_10831183 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005712|Ga0070764_10978944 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005764|Ga0066903_103076604 | Not Available | 903 | Open in IMG/M |
| 3300005890|Ga0075285_1038087 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300005921|Ga0070766_10644902 | Not Available | 714 | Open in IMG/M |
| 3300005921|Ga0070766_11192358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300006050|Ga0075028_100296876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 900 | Open in IMG/M |
| 3300006059|Ga0075017_101004087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium botulinum | 650 | Open in IMG/M |
| 3300006102|Ga0075015_100766161 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300006162|Ga0075030_100668383 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300006163|Ga0070715_11052409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis → Nitrobacter hamburgensis X14 | 510 | Open in IMG/M |
| 3300006176|Ga0070765_100200252 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300006176|Ga0070765_100354281 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300006804|Ga0079221_10479164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300007255|Ga0099791_10090613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium rhizogenes | 1400 | Open in IMG/M |
| 3300007788|Ga0099795_10099905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1137 | Open in IMG/M |
| 3300009098|Ga0105245_10353137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1457 | Open in IMG/M |
| 3300009521|Ga0116222_1188344 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300009700|Ga0116217_10107299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium loti | 1905 | Open in IMG/M |
| 3300009792|Ga0126374_11390668 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300010046|Ga0126384_11625100 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300010159|Ga0099796_10079415 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300010360|Ga0126372_12197860 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300010361|Ga0126378_11737732 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300010362|Ga0126377_13271293 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010373|Ga0134128_10764061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1072 | Open in IMG/M |
| 3300010376|Ga0126381_102668989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 714 | Open in IMG/M |
| 3300010376|Ga0126381_103909314 | Not Available | 581 | Open in IMG/M |
| 3300010379|Ga0136449_103890030 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300010379|Ga0136449_104344015 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010400|Ga0134122_11419093 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300010859|Ga0126352_1070742 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300011445|Ga0137427_10416400 | Not Available | 558 | Open in IMG/M |
| 3300012361|Ga0137360_11809671 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012469|Ga0150984_100300768 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300012469|Ga0150984_107127809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1446 | Open in IMG/M |
| 3300012685|Ga0137397_10834317 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BLR3 | 684 | Open in IMG/M |
| 3300012922|Ga0137394_10862216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300012924|Ga0137413_11637463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300012927|Ga0137416_10770835 | Not Available | 849 | Open in IMG/M |
| 3300012929|Ga0137404_11798667 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300012930|Ga0137407_10798512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 891 | Open in IMG/M |
| 3300012948|Ga0126375_11374376 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 597 | Open in IMG/M |
| 3300012971|Ga0126369_10588640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1181 | Open in IMG/M |
| 3300013308|Ga0157375_12415226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 627 | Open in IMG/M |
| 3300014158|Ga0181521_10127977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1500 | Open in IMG/M |
| 3300014164|Ga0181532_10563437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300014489|Ga0182018_10203438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 1106 | Open in IMG/M |
| 3300016270|Ga0182036_10069869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2285 | Open in IMG/M |
| 3300016270|Ga0182036_10528939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
| 3300016319|Ga0182033_11538952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300017924|Ga0187820_1306361 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300017927|Ga0187824_10137116 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300017933|Ga0187801_10345253 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300017936|Ga0187821_10094403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1099 | Open in IMG/M |
| 3300017936|Ga0187821_10204218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300017943|Ga0187819_10495344 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300017946|Ga0187879_10073424 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300017955|Ga0187817_10676231 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300017970|Ga0187783_10444153 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300017970|Ga0187783_11188451 | Not Available | 549 | Open in IMG/M |
| 3300018012|Ga0187810_10475693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300018020|Ga0187861_10432836 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300018058|Ga0187766_10412452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 895 | Open in IMG/M |
| 3300018090|Ga0187770_11174818 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300020581|Ga0210399_10887443 | Not Available | 724 | Open in IMG/M |
| 3300020581|Ga0210399_11585952 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300021171|Ga0210405_10271414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1341 | Open in IMG/M |
| 3300021178|Ga0210408_11004754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 645 | Open in IMG/M |
| 3300021180|Ga0210396_10442155 | Not Available | 1141 | Open in IMG/M |
| 3300021181|Ga0210388_10567371 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300021402|Ga0210385_11521136 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300021404|Ga0210389_10405658 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300021404|Ga0210389_10667582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 815 | Open in IMG/M |
| 3300021404|Ga0210389_11512338 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300021404|Ga0210389_11532640 | Not Available | 506 | Open in IMG/M |
| 3300021407|Ga0210383_10075235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium loti | 2824 | Open in IMG/M |
| 3300021407|Ga0210383_10549459 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300021407|Ga0210383_10991402 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300021420|Ga0210394_11252735 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Lewinellaceae → Flavilitoribacter → Flavilitoribacter nigricans → Flavilitoribacter nigricans DSM 23189 = NBRC 102662 | 635 | Open in IMG/M |
| 3300021420|Ga0210394_11623704 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300021433|Ga0210391_10389182 | Not Available | 1094 | Open in IMG/M |
| 3300021474|Ga0210390_10248190 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300021474|Ga0210390_10735832 | Not Available | 820 | Open in IMG/M |
| 3300021476|Ga0187846_10184168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 878 | Open in IMG/M |
| 3300021476|Ga0187846_10370313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300021477|Ga0210398_11220035 | Not Available | 594 | Open in IMG/M |
| 3300021478|Ga0210402_11812356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300021479|Ga0210410_10099060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2573 | Open in IMG/M |
| 3300022522|Ga0242659_1142299 | Not Available | 504 | Open in IMG/M |
| 3300022523|Ga0242663_1125251 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300022557|Ga0212123_10067268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 3115 | Open in IMG/M |
| 3300025500|Ga0208686_1017857 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
| 3300025885|Ga0207653_10102740 | Not Available | 1012 | Open in IMG/M |
| 3300025915|Ga0207693_10398394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1076 | Open in IMG/M |
| 3300025960|Ga0207651_11169712 | Not Available | 690 | Open in IMG/M |
| 3300026359|Ga0257163_1076343 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300026555|Ga0179593_1238888 | All Organisms → cellular organisms → Bacteria | 2506 | Open in IMG/M |
| 3300026557|Ga0179587_10063317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2161 | Open in IMG/M |
| 3300027591|Ga0209733_1049422 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300027625|Ga0208044_1016087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2741 | Open in IMG/M |
| 3300027884|Ga0209275_10180231 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300027903|Ga0209488_10733833 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300027908|Ga0209006_11298447 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300028047|Ga0209526_10625272 | Not Available | 687 | Open in IMG/M |
| 3300028806|Ga0302221_10326598 | Not Available | 669 | Open in IMG/M |
| 3300028906|Ga0308309_10399625 | Not Available | 1178 | Open in IMG/M |
| 3300028906|Ga0308309_10443732 | Not Available | 1117 | Open in IMG/M |
| 3300031236|Ga0302324_102639815 | Not Available | 609 | Open in IMG/M |
| 3300031525|Ga0302326_13174563 | Not Available | 556 | Open in IMG/M |
| 3300031595|Ga0265313_10289813 | Not Available | 660 | Open in IMG/M |
| 3300031708|Ga0310686_103174563 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300031708|Ga0310686_113157686 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031708|Ga0310686_114494476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300031715|Ga0307476_10981913 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300031747|Ga0318502_10712493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium genosp. B | 607 | Open in IMG/M |
| 3300031751|Ga0318494_10162174 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300031768|Ga0318509_10408689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300031792|Ga0318529_10334608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300031792|Ga0318529_10401362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium genosp. B | 638 | Open in IMG/M |
| 3300031797|Ga0318550_10054800 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| 3300031823|Ga0307478_11230957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW704-F3 | 623 | Open in IMG/M |
| 3300031823|Ga0307478_11784032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 506 | Open in IMG/M |
| 3300031835|Ga0318517_10501124 | Not Available | 547 | Open in IMG/M |
| 3300031910|Ga0306923_12411651 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031942|Ga0310916_11073100 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300032052|Ga0318506_10099860 | Not Available | 1239 | Open in IMG/M |
| 3300032076|Ga0306924_12454194 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300032160|Ga0311301_11387605 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300032892|Ga0335081_10578791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1391 | Open in IMG/M |
| 3300033158|Ga0335077_11604834 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300034090|Ga0326723_0423116 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.59% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.10% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.10% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.10% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.40% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.40% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.40% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.40% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.40% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.40% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.70% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.70% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.70% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.70% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.70% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.70% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.70% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.70% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25617J43924_100035444 | 3300002914 | Grasslands Soil | VIVPVDCSAGEDVYREQYATYHLGGGGPAVITNNITLTRSSMIKF* |
| Ga0062387_1012249853 | 3300004091 | Bog Forest Soil | VPVDCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRSTMIRFL* |
| Ga0062389_1016183413 | 3300004092 | Bog Forest Soil | IVPVDCSAGETVYHEQYAAFQLAKGGPVGITSNVTLTRSAMIKF* |
| Ga0062388_1027417161 | 3300004635 | Bog Forest Soil | DCSAGEDVYHEQYAAFHLAKGGPVGVTSNVTLTRSTMIKF* |
| Ga0070687_1005375191 | 3300005343 | Switchgrass Rhizosphere | PVDCSAGDSPYHEQYAAFHLAKGGPVAVTSNVTLTRSTMVKF* |
| Ga0070703_105523661 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | PVDCSAGESIYNEQYAAFHLTKGGPVGVTSNVTATRSTMIKY* |
| Ga0070679_1003579901 | 3300005530 | Corn Rhizosphere | QRGYKVIVPVDCSAGEDVYNEQYATYHLAKSGPTYLTSVVTLTRSTMIKY* |
| Ga0070734_103473973 | 3300005533 | Surface Soil | YKVIVPVDCSAGEDEYHEQYAAYHLAKGSWVGVTSNVTLTRSTMMKY* |
| Ga0070763_100366655 | 3300005610 | Soil | QEAVQRGYKVIVPVDCSAGETVYHEQYAAFQLAKGGPVGITSNVTLTRSTMVRFLGP* |
| Ga0070764_103241631 | 3300005712 | Soil | VQRGYKVIVPVDCSAGETVYHEQYAAFQLAKGGPVGITSNVTLTRSTMIKF* |
| Ga0070764_104825662 | 3300005712 | Soil | AQEAVQRGYKVIVPVDCSAGEDVYHEQYATFQLAKGGPVGITSNVTLTRSGMIKFQGP* |
| Ga0070764_108311831 | 3300005712 | Soil | QEAVQRGYKVIVPVDCSAGETVYHEQYAAFQLAKGGPVGITSNITLTRSTMIRFLSP* |
| Ga0070764_109789441 | 3300005712 | Soil | QEAVQRGYKVIVPVDCSAGETVYHEQYAAFQLAKGGPVGITSNVTLTRSTMIKF* |
| Ga0066903_1030766041 | 3300005764 | Tropical Forest Soil | DCSAGEDVYNEQYAAYHLAKGGPAVVTSKVKMTRSPMVKFGS* |
| Ga0075285_10380871 | 3300005890 | Rice Paddy Soil | AQRGYKVILPVDCSAGEAVYNEQYAAFHLTKGGPVGVTSNVTATRSTMIKYQ* |
| Ga0070766_106449022 | 3300005921 | Soil | GEDVYHEQYAAFQLAKGGPVGITSNVTLTRSTMIKF* |
| Ga0070766_111923581 | 3300005921 | Soil | SAGEDEYHEQYAAFHLAKGGPVVVTDKVTLTRSTMIKF* |
| Ga0075028_1002968762 | 3300006050 | Watersheds | PVDCSAAESVYNEQYAAFHLAKGGPVGVTGQVTLTRSTMIKF* |
| Ga0075017_1010040871 | 3300006059 | Watersheds | YKVIVPVDCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRSSMIKF* |
| Ga0075015_1007661611 | 3300006102 | Watersheds | DCSAGEDVYHEQYAAFHLAKGGPAGVTSNVTLTRSTMIKF* |
| Ga0075030_1006683832 | 3300006162 | Watersheds | LRIPGLAAAVPVDCSAGEDVYHEQYAAFQLAKGGPLGITSNVTLTRSMMIKF* |
| Ga0070715_110524091 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PVDCSAGEDVYHEQYATFHLAKGGPVGVTSNVTLTRSTMIKF* |
| Ga0070765_1002002521 | 3300006176 | Soil | GYKVIVPVDCSAGETVYHEQYAAFQLAKGGPVGITSNVTLTRSAMIKFQGP* |
| Ga0070765_1003542814 | 3300006176 | Soil | VGTSQEAVQRGYKVIVPVDCSAGETVYHEQYAAFQLAKGGPVGITSNVTLTRSTMIKF* |
| Ga0079221_104791641 | 3300006804 | Agricultural Soil | VDCSAGEDEFHELYATYHLAKGGPANLTSNVTVTRTTMIKF* |
| Ga0099791_100906133 | 3300007255 | Vadose Zone Soil | AGEDVYREQYATYHLGGGGPAVITNNITLTRSSMIKF* |
| Ga0099795_100999051 | 3300007788 | Vadose Zone Soil | YKVIVPVDCSAAEDVYHEQYAAFHLAKGGPAGVTSNVTMTRSSMIKF* |
| Ga0105245_103531371 | 3300009098 | Miscanthus Rhizosphere | VDCSAGDSPYHEQYAAFHLAKGGPVAVTSNVTLTRSTMVKF* |
| Ga0116222_11883441 | 3300009521 | Peatlands Soil | DCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRSAMIRFLSP* |
| Ga0116217_101072995 | 3300009700 | Peatlands Soil | EDVYHEQYAAFQLAKGGPVGITSNVTLTRSTMIRFLSP* |
| Ga0126374_113906681 | 3300009792 | Tropical Forest Soil | QRGYKVIVPVDCSAGEDVYHEQYAAFHLAKGGPAGVTSNVTITRSTMMKF* |
| Ga0126384_116251001 | 3300010046 | Tropical Forest Soil | YQVIVPVDCSAAEDGYREQYAMFHLAKGGPVIVTSKLTTTRSTMVKF* |
| Ga0099796_100794152 | 3300010159 | Vadose Zone Soil | DCSAGEDAYHEQYAAFHLAKGGPAGVTSNVTMTRTTMVKF* |
| Ga0126372_121978601 | 3300010360 | Tropical Forest Soil | AQRGYKVIVPVDCSAGEDVYHEQYAAFHLAKGGPAGVTSNVTMTRSTMMKF* |
| Ga0126378_117377321 | 3300010361 | Tropical Forest Soil | GEDVYHEQYAAFHLAKGGPAGITSNVTMTRSTMIKF* |
| Ga0126377_132712932 | 3300010362 | Tropical Forest Soil | PVDCSAGESVYNEQYAAFHLTKGGPAGVTSNVTATRSTMIKY* |
| Ga0134128_107640611 | 3300010373 | Terrestrial Soil | VIVPVDCSAGEDVYNEQYATYHLAKSGPTYLTSVVTLTRSTMIKY* |
| Ga0126381_1026689891 | 3300010376 | Tropical Forest Soil | GYKIIVPVDCSAGEDEYHEQYAAFHLAKGSWVGVTSNVTLTRSSMIKF* |
| Ga0126381_1039093141 | 3300010376 | Tropical Forest Soil | GEDEYHEQYAAFHLAKGSWAGVTNNVTLTRSTMIKF* |
| Ga0136449_1038900301 | 3300010379 | Peatlands Soil | RGYKVIVPVDCSAGEDEYHEQYAAYHLAVGSWVGVTSNVTLTRAAMMKF* |
| Ga0136449_1043440151 | 3300010379 | Peatlands Soil | DCSAGETVYHEQYAAFHLAKGGPVGITSNVTLTRSTMIKF* |
| Ga0134122_114190931 | 3300010400 | Terrestrial Soil | VIIPVDCSAGDSPYHEQYAAFHLAKGGPVAVTSNVTLTRSTMVKF* |
| Ga0126352_10707422 | 3300010859 | Boreal Forest Soil | VPVDCSAGEDEYHEQYAAFHLAKGSWVGVTSNVTLTRSAMMKF* |
| Ga0137427_104164002 | 3300011445 | Soil | SIYNEQYAAFHLTKGGPVGVTSNVTATRSTMIKY* |
| Ga0137360_118096711 | 3300012361 | Vadose Zone Soil | KVIVPVDCSAGEDVYHEQYAAFHLAKGGPAGVTNNVTMTRSTLIKF* |
| Ga0150984_1003007681 | 3300012469 | Avena Fatua Rhizosphere | EDMYNEQYATYHLAKGGPAIITSAVTMTRSAMIKF* |
| Ga0150984_1071278091 | 3300012469 | Avena Fatua Rhizosphere | IVPVDCSAGEDEYHEQYATFHLAKVSWVGVTSNVTLTRSTMIKF* |
| Ga0137397_108343172 | 3300012685 | Vadose Zone Soil | DCSAGEDVYHEQYAAFHLAKGGPAGVTSNVTMTRTTMIKF* |
| Ga0137394_108622161 | 3300012922 | Vadose Zone Soil | VVVPVDCSAGEDIYNEQYATYHLAKGGPAIITSAVTMTRSAMIKF* |
| Ga0137413_116374631 | 3300012924 | Vadose Zone Soil | DCSAGEDAYHEQYAAFHLAKGGPVGVTSNVTMTRTTMIKF* |
| Ga0137416_107708352 | 3300012927 | Vadose Zone Soil | AAEGVYNEQYAAFHLAKGGPVGVTSQVTLTRSTMIKF* |
| Ga0137404_117986671 | 3300012929 | Vadose Zone Soil | AGEDAYHEQYAAFHLAKGGPAGVTSNVTMTRTTMVKF* |
| Ga0137407_107985122 | 3300012930 | Vadose Zone Soil | SAGEDIYREQYATFHLTKGGPAIVTSKVTTTRSTMIKF* |
| Ga0126375_113743761 | 3300012948 | Tropical Forest Soil | VILPVDCSAGEAIYNEQYAAFHLTKGGPVGVTSNVTATRSTMIKYQ* |
| Ga0126369_105886402 | 3300012971 | Tropical Forest Soil | YKVIVPVDCSAGEDVYHEQYAAFHLAKGGPAGVTSNVTMTRSTMIKF* |
| Ga0157375_124152263 | 3300013308 | Miscanthus Rhizosphere | DCSAGEDEYHEQYATFHLAKGSWVGVTSNVTLTRSTMIKF* |
| Ga0181521_101279771 | 3300014158 | Bog | AQRGYKVIVPVDCSAGEDAYRERYAAFHLAKGGPAQVTGNVTLTRSTMIKF* |
| Ga0181532_105634372 | 3300014164 | Bog | VRRSAATKVIVPVDCSAGETVYHEQYAAFHLAKGGPVGITSNITLTRSTMIKFQGP* |
| Ga0182018_102034383 | 3300014489 | Palsa | DCSAGDSVYNEQYAAFQLTKGGPAGITSNVTLTRTSMVKF* |
| Ga0182036_100698695 | 3300016270 | Soil | YKIILPVDCSAGENEYQEQYATYHLTKGSWVGVTSNVTPTRSTMVKF |
| Ga0182036_105289391 | 3300016270 | Soil | PVDCSAGEDEYHEQYAVFHLAKGSWVGVTSNVTITRSAMIKF |
| Ga0182033_115389521 | 3300016319 | Soil | GEDEYHEQYAAFHLAKGSWAGVTSNVTLTRSTMMKF |
| Ga0187820_13063611 | 3300017924 | Freshwater Sediment | SAGEDVYHEQYATFHLAKGGPAGITGNVTMTRSTMIKF |
| Ga0187824_101371161 | 3300017927 | Freshwater Sediment | IIPVDCSAAEDEYHEQYAAFHLGKGGPVNVTSATTLTRTTMIKF |
| Ga0187801_103452531 | 3300017933 | Freshwater Sediment | EDTYMEQYAAFHLFKGGPAGVTSQVTVTRSSMMKF |
| Ga0187821_100944032 | 3300017936 | Freshwater Sediment | VPVDCSAGRSAYREQYVAYELGVGGPDPVTSNVTLTRTTMLKFK |
| Ga0187821_102042182 | 3300017936 | Freshwater Sediment | LPVDCSAAENEFHEQYATYHLAKGGPVNVTSATTITRTTMIKF |
| Ga0187819_104953441 | 3300017943 | Freshwater Sediment | CLSSEDTYMEQYAAFHLFKAGPNVVTSQVTMTRSTMVKF |
| Ga0187879_100734241 | 3300017946 | Peatland | KVIVPVDCSAGETVYHEQYAAFQLAKGGPVGITSNVTLTRSAMIRFLSP |
| Ga0187817_106762311 | 3300017955 | Freshwater Sediment | LSSEDTYMEQYAAFHLFKAGPNVVTSQVTMTRSTMVKF |
| Ga0187783_104441531 | 3300017970 | Tropical Peatland | VIVPVDCSAGEDVYHEQYAAFDLAKGGPAGVTQNVTLTRSTMMKF |
| Ga0187783_111884511 | 3300017970 | Tropical Peatland | VQRGYKVVFPVDCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRSSMMKF |
| Ga0187810_104756931 | 3300018012 | Freshwater Sediment | CLSSEDTYMEQYAAFHLFKGGPAGVTSQVTVTRSSMMKF |
| Ga0187861_104328361 | 3300018020 | Peatland | FKVIVPVDCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRSAMIRFLSP |
| Ga0187766_104124521 | 3300018058 | Tropical Peatland | VDCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRAAMIKF |
| Ga0187770_111748181 | 3300018090 | Tropical Peatland | IVPVDCSAGESVYNEQYAAFHLAKGGPVGVTSNVTLTRTGMIKF |
| Ga0210399_108874432 | 3300020581 | Soil | YKVVVPVDCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRSAMIKFLSP |
| Ga0210399_115859522 | 3300020581 | Soil | TSQEAVQRGYKVIVPVDCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRSGMIKF |
| Ga0210405_102714141 | 3300021171 | Soil | RGYKIIVPVDCSAGEDEYHEQYAAYHLAKGSWVGVTSNVTLTRSTMIKY |
| Ga0210408_110047542 | 3300021178 | Soil | DCSAGEDEYHEQYAAFHLAKGGPTIVTDKVTLTRSTMIKF |
| Ga0210396_104421552 | 3300021180 | Soil | VIVPVDCSAGETVYHEQYAAFQLAKGGPVGITSNVTLTRSAIIRFLSP |
| Ga0210388_105673711 | 3300021181 | Soil | EASQRGYKVIVPVDCSAGESVYHEQYAAFHLAKGGPVNMTNNVTLTRTTMIKF |
| Ga0210385_115211361 | 3300021402 | Soil | IVPVDCSAGETVYHEQYAAFHLAKGGPVGITSNITLTRSTMIKF |
| Ga0210389_104056581 | 3300021404 | Soil | ETVYHEQYAAFHLAKGGPVGITSNVTLTRSTMIKF |
| Ga0210389_106675821 | 3300021404 | Soil | EDVYHEQYAAFQLAKGGPVGITSNVTLTRSSMIKF |
| Ga0210389_115123381 | 3300021404 | Soil | VIVPVDCSAGEDAYHEQYAAFHLAKGGPVIVTGQVTLTRSAMIKF |
| Ga0210389_115326402 | 3300021404 | Soil | REDVYHEQYAAFQLAKGGPVGITSNVTLTRSGMIKF |
| Ga0210383_100752351 | 3300021407 | Soil | IVPVDCSAGETVYHEQYAAFQLAKGGPVGITSNVTLTRSAMIKFQGP |
| Ga0210383_105494593 | 3300021407 | Soil | QRGYKVIVPVDCSAGETVYHEQYAAFHLAKGGPVGITSNVTLTRSTMIKF |
| Ga0210383_109914022 | 3300021407 | Soil | AGEDVYNEQYAAIHLAKGGPVGVTSNVTMTRSTMIKF |
| Ga0210394_112527352 | 3300021420 | Soil | LRILAWLAADPVDCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRCTMIKF |
| Ga0210394_116237042 | 3300021420 | Soil | YKVIVPVDCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRSTMIKF |
| Ga0210391_103891823 | 3300021433 | Soil | GYKVIVPVDCSAGETVYHEQYAAFQLAKGGPVGITSNVTLTRSAMIKFQGP |
| Ga0210390_102481904 | 3300021474 | Soil | TSQEAVQRGYKVIVPVDCSAGETVYHEQYAAFQLAKGGPVGITSNVTLTRSAMIKFQGP |
| Ga0210390_107358321 | 3300021474 | Soil | DCSAGESVYHEQYAAFHLAKGGPVNMTNNITLTRTTMLKF |
| Ga0187846_101841681 | 3300021476 | Biofilm | AEDVYHEQYAAFHLAKGGPVGVTGNVTMTRSNMIKF |
| Ga0187846_103703131 | 3300021476 | Biofilm | VPVDCSAGEDEYHEQYAVFHLAKGSWVGVTSNVTITRSAMIKF |
| Ga0210398_112200351 | 3300021477 | Soil | VDCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRSTMIRFLSP |
| Ga0210402_118123562 | 3300021478 | Soil | YKVIVPVEAEDVYHEQYAAFHLAKGGPVGVTNNVTMTRSTMIKF |
| Ga0210410_100990603 | 3300021479 | Soil | VVPVDCSAGEDEYHEQYAAFHLAKGGPTIVTDKVTLTRSTMIKF |
| Ga0242659_11422992 | 3300022522 | Soil | GEDEYHEQYAAFHLAKGGPVQVTSQVTLTRSAMIKF |
| Ga0242663_11252512 | 3300022523 | Soil | VIIPVDCSAGENVYNEQYAAFHLAKGGPVGVTGNVTMTRSTMIKF |
| Ga0212123_100672681 | 3300022557 | Iron-Sulfur Acid Spring | GYKVIVPVDCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRSSMIRFLSQ |
| Ga0208686_10178575 | 3300025500 | Peatland | AGEDVYHEQYAAFQLAKGGPVGITSNVTLTRSAMIRFLSP |
| Ga0207653_101027402 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | PVDCSAGESIYNEQYAAFHLTKGGPVGVTSNVTATRSTMIKY |
| Ga0207693_103983941 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GYKVIIPVDCSAAEDEYHEQYAAFHLGKGGPVNVTSATTLTRTTMVKF |
| Ga0207651_111697122 | 3300025960 | Switchgrass Rhizosphere | SAGEDAYHEQYAAFHLAKGGPVGVTSNVTMTRSTMIKF |
| Ga0257163_10763431 | 3300026359 | Soil | DCSAAEDVYHEQYAAFHLAKGGPAGVTSNVTMTRSSMIKF |
| Ga0179593_12388886 | 3300026555 | Vadose Zone Soil | VIVPVDCSAGEDVYREQYATYHLGGGGPAVITNNITLTRSSMIKF |
| Ga0179587_100633171 | 3300026557 | Vadose Zone Soil | PVDCSASEDVYREQYATYHLGSGGPASITRNITLTRSSMIKF |
| Ga0209733_10494221 | 3300027591 | Forest Soil | GYKVIIPVDCSAAESVYNEQYATFHLAKGGPVGVTSQVTLTRSAMIKF |
| Ga0208044_10160877 | 3300027625 | Peatlands Soil | GFKVIVPVDCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRSAMIRFLSP |
| Ga0209275_101802311 | 3300027884 | Soil | RGYKVIVPVDCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRSAMIKF |
| Ga0209488_107338331 | 3300027903 | Vadose Zone Soil | VDCSAGEDVYNEQYATWHLAKGGPQGVTSNVTLTRTTMVKFQ |
| Ga0209006_112984471 | 3300027908 | Forest Soil | GTASGAAQRDYKVIIPVDCSAAEDVYHEQYAAFHLAKGGPLQVTNQVTNSFTNTPSK |
| Ga0209526_106252722 | 3300028047 | Forest Soil | TVGTSQEAVQRGYKVIVPVDCSAGETVYHEQYAAFQLAKGGPVGITSNVTLTRSAMIKFQGP |
| Ga0302221_103265982 | 3300028806 | Palsa | GTSQEAVQRGFKVIVPVDCSAGDSVYSEQYAAFQLTKGGPVPITSNVTLTRSTMVKF |
| Ga0308309_103996251 | 3300028906 | Soil | PVDCSAGETVYHEQYAAFQLAKGGPVGITSNVTLTRSAMIKFQGP |
| Ga0308309_104437321 | 3300028906 | Soil | PVDCSAGETVYHEQYAAFQLAKGGPVGITSNVTLTRSTMIKF |
| Ga0302324_1026398151 | 3300031236 | Palsa | FKVIVPVDCSAGDSVYSEQYAAFQLTKGGPVPITSNVTLTRSTMVKF |
| Ga0302326_131745632 | 3300031525 | Palsa | QESVQRGYKVIVPVDCSAGESVYHEQYAAFQLAKGGPVSITANVTLTRTTMVKF |
| Ga0265313_102898133 | 3300031595 | Rhizosphere | VIVPIDCSAGESVYHEQYAAFQLAKGGPVGITSNVTLTRSTMIKFLSP |
| Ga0310686_1031745632 | 3300031708 | Soil | YKVIVPVDCSAGEDVYHEQYAAFQLAKGGPTGITSNVTLTRTTMVKF |
| Ga0310686_1131576862 | 3300031708 | Soil | MCGNSFQGATVGTAQGSGEAVQRGYKVIVPMDCSAGEDVYHEQYAAFQLAKGGPVGITSNVTLTRTGVVKF |
| Ga0310686_1144944762 | 3300031708 | Soil | VIIPVDCSEGEEVDHEQYAAFQLAKGGLIGITRNVTLRRTTMVKF |
| Ga0307476_109819133 | 3300031715 | Hardwood Forest Soil | EDVYHEQYAAFHLAKGGPAGITSNVTMTRSTMIKF |
| Ga0318502_107124931 | 3300031747 | Soil | IILPVDCSAGENEYQEQYATYHLTKGSWVGVTSNVTPTRSTMVKF |
| Ga0318494_101621741 | 3300031751 | Soil | SAGENEYQEQYATYHLTKGSWVGVTSNVTPTRSTMVKF |
| Ga0318509_104086891 | 3300031768 | Soil | QRGYKVIVPVDCSAGEDEYHEQYAAFHLAKGGPVGVTGNVTMTRSTMIKF |
| Ga0318529_103346081 | 3300031792 | Soil | VIVPVDCSAAEDVYHEQYAAFHLAKGGPVGVTNNVTMTRSTMIKF |
| Ga0318529_104013622 | 3300031792 | Soil | ILPVDCSAGENEYQEQYATYHLTKGSWVGVTSNVTPTRSTMVKF |
| Ga0318550_100548001 | 3300031797 | Soil | AQRGYKIILPVDCSAGENEYQEQYATYHLTKGSWVGVTSNVTPTRSTMVKF |
| Ga0307478_112309572 | 3300031823 | Hardwood Forest Soil | VQRGYKVIVPVDCPAGDSVYHEQCAAFQLAKGGPVGITANVTLTRTTMVKF |
| Ga0307478_117840321 | 3300031823 | Hardwood Forest Soil | CSAGEDEYHEQYAAFHLAKGSWAGVTMNVTLTRSTMMKF |
| Ga0318517_105011241 | 3300031835 | Soil | DVYNEQYAAYHLAKGGPAVVTSKVKMTRSPMVKFGS |
| Ga0306923_124116511 | 3300031910 | Soil | VDCSAGEDVYHEQYAAFHLAKGGPAGVTMNVTMTRTTMIKFQ |
| Ga0310916_110731001 | 3300031942 | Soil | GEDVYHEQYAAFHLAKGGPAGVTMNVTMTRTTMIKFQ |
| Ga0318506_100998603 | 3300032052 | Soil | AEDVYHEQYAAFHLAKGGPVGVTNNVTMTRSTMIKF |
| Ga0306924_124541941 | 3300032076 | Soil | IVPVDCSAGEDVYNEQYAAYHLAKGGPAVVTNKVTMTRSSMVKFGA |
| Ga0311301_113876051 | 3300032160 | Peatlands Soil | AQRGYKVIIPVDCSAGENVYNEQYAAFHLAKGGPVAVTGNVTMTRSTMIKF |
| Ga0335081_105787912 | 3300032892 | Soil | VIVPVDCSAGEDEYHEQYAAFHLAKGGPAGVTNNVTLTRSTMIKF |
| Ga0335077_116048341 | 3300033158 | Soil | GYKVIVPVDCSAGEDVYHEQYAAFHLAKGGPAGITSNVTMTRSTMLKF |
| Ga0326723_0423116_1_132 | 3300034090 | Peat Soil | VPVDCSAGEDAYHEQYAAFHLAKGGPAGVTSNVTMTRSTMIKF |
| ⦗Top⦘ |