


| Basic Information | |
|---|---|
| Family ID | F052086 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 39 residues |
| Representative Sequence | RAVECATITYDQLKAGAMPAGAARVRRLPAIVGQPALAG |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.61 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.846 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.462 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.357 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (65.035 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.43% β-sheet: 0.00% Coil/Unstructured: 86.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF00239 | Resolvase | 2.80 |
| PF08281 | Sigma70_r4_2 | 2.10 |
| PF13975 | gag-asp_proteas | 2.10 |
| PF12762 | DDE_Tnp_IS1595 | 2.10 |
| PF12760 | Zn_Tnp_IS1595 | 2.10 |
| PF00535 | Glycos_transf_2 | 1.40 |
| PF13414 | TPR_11 | 1.40 |
| PF04964 | Flp_Fap | 1.40 |
| PF02796 | HTH_7 | 1.40 |
| PF13356 | Arm-DNA-bind_3 | 0.70 |
| PF00072 | Response_reg | 0.70 |
| PF01420 | Methylase_S | 0.70 |
| PF02567 | PhzC-PhzF | 0.70 |
| PF13432 | TPR_16 | 0.70 |
| PF00571 | CBS | 0.70 |
| PF00353 | HemolysinCabind | 0.70 |
| PF01042 | Ribonuc_L-PSP | 0.70 |
| PF13545 | HTH_Crp_2 | 0.70 |
| PF00205 | TPP_enzyme_M | 0.70 |
| PF04966 | OprB | 0.70 |
| PF13701 | DDE_Tnp_1_4 | 0.70 |
| PF05050 | Methyltransf_21 | 0.70 |
| PF12631 | MnmE_helical | 0.70 |
| PF08818 | DUF1801 | 0.70 |
| PF00589 | Phage_integrase | 0.70 |
| PF03235 | DUF262 | 0.70 |
| PF02668 | TauD | 0.70 |
| PF13692 | Glyco_trans_1_4 | 0.70 |
| PF01939 | NucS | 0.70 |
| PF01526 | DDE_Tnp_Tn3 | 0.70 |
| PF00685 | Sulfotransfer_1 | 0.70 |
| PF07769 | PsiF_repeat | 0.70 |
| PF13480 | Acetyltransf_6 | 0.70 |
| PF13676 | TIR_2 | 0.70 |
| PF07690 | MFS_1 | 0.70 |
| PF04116 | FA_hydroxylase | 0.70 |
| PF12708 | Pectate_lyase_3 | 0.70 |
| PF13433 | Peripla_BP_5 | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 2.80 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 2.80 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 1.40 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.70 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.70 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.70 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.70 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.70 |
| COG0732 | Restriction endonuclease S subunit | Defense mechanisms [V] | 0.70 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.70 |
| COG1637 | Endonuclease NucS, RecB family | Replication, recombination and repair [L] | 0.70 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.70 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.70 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.85 % |
| All Organisms | root | All Organisms | 46.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_110102301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidocella → unclassified Acidocella → Acidocella sp. 20-61-6 | 793 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10095045 | Not Available | 1181 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10131621 | Not Available | 1006 | Open in IMG/M |
| 3300004080|Ga0062385_10573601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
| 3300004091|Ga0062387_100010062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3442 | Open in IMG/M |
| 3300004633|Ga0066395_10744038 | Not Available | 585 | Open in IMG/M |
| 3300005179|Ga0066684_11120065 | Not Available | 503 | Open in IMG/M |
| 3300005332|Ga0066388_101750690 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300005602|Ga0070762_10389783 | Not Available | 895 | Open in IMG/M |
| 3300005764|Ga0066903_107797243 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300006032|Ga0066696_10215632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1230 | Open in IMG/M |
| 3300006175|Ga0070712_101149057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Nitrospirillum → Nitrospirillum amazonense | 675 | Open in IMG/M |
| 3300006175|Ga0070712_101591770 | Not Available | 571 | Open in IMG/M |
| 3300006176|Ga0070765_100939718 | Not Available | 817 | Open in IMG/M |
| 3300010046|Ga0126384_11494134 | Not Available | 633 | Open in IMG/M |
| 3300010360|Ga0126372_11185975 | Not Available | 787 | Open in IMG/M |
| 3300010361|Ga0126378_11565147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
| 3300010376|Ga0126381_100083054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium | 4037 | Open in IMG/M |
| 3300010376|Ga0126381_101456518 | Not Available | 990 | Open in IMG/M |
| 3300010376|Ga0126381_101801404 | Not Available | 884 | Open in IMG/M |
| 3300012199|Ga0137383_10881364 | Not Available | 653 | Open in IMG/M |
| 3300012205|Ga0137362_10410226 | Not Available | 1173 | Open in IMG/M |
| 3300012206|Ga0137380_10949469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum thermophilum | 737 | Open in IMG/M |
| 3300012207|Ga0137381_10163168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1921 | Open in IMG/M |
| 3300012209|Ga0137379_10460732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1180 | Open in IMG/M |
| 3300012212|Ga0150985_123034847 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1066 | Open in IMG/M |
| 3300012361|Ga0137360_11038872 | Not Available | 707 | Open in IMG/M |
| 3300012362|Ga0137361_10258288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1588 | Open in IMG/M |
| 3300012362|Ga0137361_10658761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 958 | Open in IMG/M |
| 3300012363|Ga0137390_11782948 | Not Available | 547 | Open in IMG/M |
| 3300012582|Ga0137358_10464396 | Not Available | 854 | Open in IMG/M |
| 3300012948|Ga0126375_10224571 | Not Available | 1252 | Open in IMG/M |
| 3300014658|Ga0181519_10000403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 40172 | Open in IMG/M |
| 3300014658|Ga0181519_10403453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum soli | 844 | Open in IMG/M |
| 3300016294|Ga0182041_10806965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 839 | Open in IMG/M |
| 3300016341|Ga0182035_11058683 | Not Available | 721 | Open in IMG/M |
| 3300016341|Ga0182035_11168015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300016341|Ga0182035_11417492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300016341|Ga0182035_11536177 | Not Available | 599 | Open in IMG/M |
| 3300016357|Ga0182032_10819602 | Not Available | 787 | Open in IMG/M |
| 3300016357|Ga0182032_11517762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 582 | Open in IMG/M |
| 3300016357|Ga0182032_11758460 | Not Available | 541 | Open in IMG/M |
| 3300016371|Ga0182034_10130888 | Not Available | 1854 | Open in IMG/M |
| 3300016371|Ga0182034_11789309 | Not Available | 541 | Open in IMG/M |
| 3300016387|Ga0182040_10249700 | Not Available | 1332 | Open in IMG/M |
| 3300016387|Ga0182040_10660181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 852 | Open in IMG/M |
| 3300016404|Ga0182037_10437681 | Not Available | 1085 | Open in IMG/M |
| 3300016404|Ga0182037_11833153 | Not Available | 542 | Open in IMG/M |
| 3300016445|Ga0182038_10474002 | Not Available | 1063 | Open in IMG/M |
| 3300018433|Ga0066667_10365349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1153 | Open in IMG/M |
| 3300019242|Ga0181502_1519261 | Not Available | 754 | Open in IMG/M |
| 3300020579|Ga0210407_10040282 | All Organisms → cellular organisms → Bacteria | 3475 | Open in IMG/M |
| 3300020579|Ga0210407_10096232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2245 | Open in IMG/M |
| 3300020579|Ga0210407_10585550 | Not Available | 870 | Open in IMG/M |
| 3300020580|Ga0210403_10309327 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300020580|Ga0210403_10656540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 843 | Open in IMG/M |
| 3300020581|Ga0210399_10837631 | Not Available | 749 | Open in IMG/M |
| 3300020583|Ga0210401_10397957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1239 | Open in IMG/M |
| 3300021168|Ga0210406_10446532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
| 3300021171|Ga0210405_10030091 | All Organisms → cellular organisms → Bacteria | 4354 | Open in IMG/M |
| 3300021171|Ga0210405_10074826 | All Organisms → cellular organisms → Bacteria | 2669 | Open in IMG/M |
| 3300021171|Ga0210405_10802203 | Not Available | 721 | Open in IMG/M |
| 3300021171|Ga0210405_10908703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300021178|Ga0210408_10094403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2349 | Open in IMG/M |
| 3300021178|Ga0210408_10096500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2322 | Open in IMG/M |
| 3300021178|Ga0210408_10583872 | Not Available | 886 | Open in IMG/M |
| 3300021178|Ga0210408_10729409 | Not Available | 779 | Open in IMG/M |
| 3300021180|Ga0210396_10230431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1649 | Open in IMG/M |
| 3300021401|Ga0210393_11222655 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300021405|Ga0210387_11571610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300021405|Ga0210387_11685765 | Not Available | 537 | Open in IMG/M |
| 3300021420|Ga0210394_11238886 | Not Available | 639 | Open in IMG/M |
| 3300021432|Ga0210384_10327553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1379 | Open in IMG/M |
| 3300021444|Ga0213878_10237407 | Not Available | 773 | Open in IMG/M |
| 3300021478|Ga0210402_11036796 | Not Available | 747 | Open in IMG/M |
| 3300021478|Ga0210402_11403841 | Not Available | 625 | Open in IMG/M |
| 3300021479|Ga0210410_11657566 | Not Available | 533 | Open in IMG/M |
| 3300021559|Ga0210409_10678531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 901 | Open in IMG/M |
| 3300021560|Ga0126371_10187797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2155 | Open in IMG/M |
| 3300021560|Ga0126371_10408666 | Not Available | 1500 | Open in IMG/M |
| 3300021560|Ga0126371_12968642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 574 | Open in IMG/M |
| 3300021560|Ga0126371_13477888 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 532 | Open in IMG/M |
| 3300026489|Ga0257160_1105327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300026550|Ga0209474_10190344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1313 | Open in IMG/M |
| 3300026551|Ga0209648_10398555 | Not Available | 905 | Open in IMG/M |
| 3300026551|Ga0209648_10767200 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 526 | Open in IMG/M |
| 3300026999|Ga0207949_1002073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1714 | Open in IMG/M |
| 3300027173|Ga0208097_1010589 | Not Available | 1002 | Open in IMG/M |
| 3300027537|Ga0209419_1129465 | Not Available | 504 | Open in IMG/M |
| 3300027812|Ga0209656_10241930 | Not Available | 857 | Open in IMG/M |
| 3300027884|Ga0209275_10247962 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300027889|Ga0209380_10172445 | Not Available | 1267 | Open in IMG/M |
| 3300031057|Ga0170834_111270196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300031446|Ga0170820_16298754 | Not Available | 612 | Open in IMG/M |
| 3300031545|Ga0318541_10279057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 930 | Open in IMG/M |
| 3300031545|Ga0318541_10372823 | Not Available | 797 | Open in IMG/M |
| 3300031545|Ga0318541_10699203 | Not Available | 566 | Open in IMG/M |
| 3300031561|Ga0318528_10640902 | Not Available | 569 | Open in IMG/M |
| 3300031573|Ga0310915_10208793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae | 1367 | Open in IMG/M |
| 3300031679|Ga0318561_10259474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 948 | Open in IMG/M |
| 3300031680|Ga0318574_10588562 | Not Available | 652 | Open in IMG/M |
| 3300031681|Ga0318572_10570711 | Not Available | 674 | Open in IMG/M |
| 3300031681|Ga0318572_10607243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300031719|Ga0306917_10329001 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300031719|Ga0306917_11200912 | Not Available | 589 | Open in IMG/M |
| 3300031754|Ga0307475_10192406 | Not Available | 1629 | Open in IMG/M |
| 3300031768|Ga0318509_10717807 | Not Available | 554 | Open in IMG/M |
| 3300031770|Ga0318521_10160963 | Not Available | 1279 | Open in IMG/M |
| 3300031771|Ga0318546_10750432 | Not Available | 687 | Open in IMG/M |
| 3300031771|Ga0318546_10825519 | Not Available | 652 | Open in IMG/M |
| 3300031777|Ga0318543_10323375 | Not Available | 690 | Open in IMG/M |
| 3300031796|Ga0318576_10525000 | Not Available | 558 | Open in IMG/M |
| 3300031797|Ga0318550_10663212 | Not Available | 500 | Open in IMG/M |
| 3300031805|Ga0318497_10042949 | All Organisms → cellular organisms → Bacteria | 2305 | Open in IMG/M |
| 3300031890|Ga0306925_10402181 | Not Available | 1467 | Open in IMG/M |
| 3300031890|Ga0306925_11301742 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300031893|Ga0318536_10415407 | Not Available | 679 | Open in IMG/M |
| 3300031910|Ga0306923_10958613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 933 | Open in IMG/M |
| 3300031912|Ga0306921_10821778 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300031912|Ga0306921_11988208 | Not Available | 619 | Open in IMG/M |
| 3300031941|Ga0310912_10492338 | Not Available | 956 | Open in IMG/M |
| 3300031942|Ga0310916_10521052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1012 | Open in IMG/M |
| 3300031942|Ga0310916_11477964 | Not Available | 555 | Open in IMG/M |
| 3300031945|Ga0310913_10338480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1064 | Open in IMG/M |
| 3300031947|Ga0310909_11377892 | Not Available | 565 | Open in IMG/M |
| 3300031947|Ga0310909_11420490 | Not Available | 555 | Open in IMG/M |
| 3300031954|Ga0306926_11124377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. C03 | 927 | Open in IMG/M |
| 3300031954|Ga0306926_12000859 | Not Available | 651 | Open in IMG/M |
| 3300031962|Ga0307479_10326389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1517 | Open in IMG/M |
| 3300032001|Ga0306922_10685091 | Not Available | 1080 | Open in IMG/M |
| 3300032001|Ga0306922_12034865 | Not Available | 558 | Open in IMG/M |
| 3300032035|Ga0310911_10198155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1141 | Open in IMG/M |
| 3300032043|Ga0318556_10389439 | Not Available | 729 | Open in IMG/M |
| 3300032065|Ga0318513_10199992 | Not Available | 963 | Open in IMG/M |
| 3300032076|Ga0306924_10245407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 2056 | Open in IMG/M |
| 3300032076|Ga0306924_11146751 | Not Available | 844 | Open in IMG/M |
| 3300032076|Ga0306924_11795729 | Not Available | 639 | Open in IMG/M |
| 3300032076|Ga0306924_11850510 | Not Available | 627 | Open in IMG/M |
| 3300032076|Ga0306924_12590998 | Not Available | 506 | Open in IMG/M |
| 3300032261|Ga0306920_100900868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1293 | Open in IMG/M |
| 3300032261|Ga0306920_101495326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 964 | Open in IMG/M |
| 3300032261|Ga0306920_102271064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 752 | Open in IMG/M |
| 3300033290|Ga0318519_10807281 | Not Available | 577 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.80% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.10% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.40% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.70% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.70% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.70% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1101023011 | 3300001213 | Wetland | LIRRAVECATITYDQIVAGDMDGGATRNRRILLPVVDCLP* |
| JGIcombinedJ51221_100950453 | 3300003505 | Forest Soil | LIRRAVECATITYDQLTAGVMPAGAARVRRLPATVVQPALAG* |
| JGIcombinedJ51221_101316211 | 3300003505 | Forest Soil | LIRRAVECATITYDQLTAGVMPAGAARVRRLPAMVVQPALAG* |
| Ga0062385_105736011 | 3300004080 | Bog Forest Soil | RAVECATITYDQLKTGAMPAGASRVRRLPAEIVQPALAR* |
| Ga0062387_1000100621 | 3300004091 | Bog Forest Soil | LIRRAIECTTITYDQLKSGALPSGASRVRRVPATVGQPVLAG* |
| Ga0066395_107440381 | 3300004633 | Tropical Forest Soil | LIRRAVECATITYDQLKAGAISTGASRVRRLPVMVGQPALA* |
| Ga0066684_111200651 | 3300005179 | Soil | IRRAVECATITYDQLTAGTMPGGANRVRRLPVEVAQPALAR* |
| Ga0066388_1017506903 | 3300005332 | Tropical Forest Soil | RRAVECATITYDQLKAGAMPAGAARVRRLPAIVGQPALAG* |
| Ga0070762_103897833 | 3300005602 | Soil | VECATITYDQLTAGVMPAGAARVRRLPATVVQPALAG* |
| Ga0066903_1077972431 | 3300005764 | Tropical Forest Soil | VECATITYDQLKAGAMPAGAARVRRLPAIVGQPALAG* |
| Ga0066696_102156323 | 3300006032 | Soil | AVECATVTYDQLKAGNLPDGAERIRRLPAAVAEPALAG* |
| Ga0070712_1011490571 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DGYLIRRAVECATITYDQLRAGTMPGGANRIRRPPAAVAEPALAG* |
| Ga0070712_1015917701 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ECATITYDQLKTGTLPGGANRVRRLPAAVAQPALAG* |
| Ga0070765_1009397181 | 3300006176 | Soil | ATITYDQLTAGVMPAGAARVRRLPATVVQPALAG* |
| Ga0126384_114941342 | 3300010046 | Tropical Forest Soil | DRYLIRRAVECATITYDQLTAGLTPAGAARLRRLPATVGQPALAG* |
| Ga0126372_111859751 | 3300010360 | Tropical Forest Soil | LIRRAVECATITYDQLKTATMPGGANRIRRPRAALAEPALAG* |
| Ga0126378_115651471 | 3300010361 | Tropical Forest Soil | ATITYDQLTAGVMPAGAARVRRLPATVGLPALAR* |
| Ga0126381_1000830549 | 3300010376 | Tropical Forest Soil | VECATITYDQLTAGVMPAGAARVRRFPATVGQPALAG* |
| Ga0126381_1014565183 | 3300010376 | Tropical Forest Soil | VQCATITFDQLKAGAMPAGAARVRRLPATVGQPALAG* |
| Ga0126381_1018014041 | 3300010376 | Tropical Forest Soil | AVQCATITFDQLKAGAMPAGAARVRRLPATVGQPALAG* |
| Ga0137383_108813641 | 3300012199 | Vadose Zone Soil | VECATITYDQLTAGTMPGGANRVRRPPAAVAEPALAG* |
| Ga0137362_104102261 | 3300012205 | Vadose Zone Soil | AVECATITFDQLTTGTLPGGANRVRRLPAAVAQPALAG* |
| Ga0137380_109494691 | 3300012206 | Vadose Zone Soil | AVECATITYDQLTAGTMPGGANRVRRPPAAVAEPALAG* |
| Ga0137381_101631685 | 3300012207 | Vadose Zone Soil | AVECATITYDQLKTGTLPGGANRVRRLPVAVAQPALAR* |
| Ga0137379_104607322 | 3300012209 | Vadose Zone Soil | AVECATITYDQLTAGTMPGGANRVRRPPAAVAEPALAA* |
| Ga0150985_1230348472 | 3300012212 | Avena Fatua Rhizosphere | VECATITYDQLKAGTMPSGANRIRRLPAEVAQPALA* |
| Ga0137360_110388722 | 3300012361 | Vadose Zone Soil | CATITYDQLTAGVMPAGAARVRRLPATVGLPALAG* |
| Ga0137361_102582883 | 3300012362 | Vadose Zone Soil | AVECATITYDQLKKGTLPGGANRVRRLPAAVAQPALAG* |
| Ga0137361_106587611 | 3300012362 | Vadose Zone Soil | ECATITYDQLKKGTLPGGANRVRRLPAAVAQPALAG* |
| Ga0137390_117829481 | 3300012363 | Vadose Zone Soil | VECATITYDQLKTGTLPGGANRVRRLPAAVAQPALAR* |
| Ga0137358_104643961 | 3300012582 | Vadose Zone Soil | ECATITYDQLKAGAIPTGASRVRRLPVMVGQPALA* |
| Ga0126375_102245711 | 3300012948 | Tropical Forest Soil | RRAVECTTITYDQLTVGDTPAGAARVRRLPATVGEPALAG* |
| Ga0181519_100004031 | 3300014658 | Bog | AVECATITYDQLTAGTMAAGATRQRRPFSKVVEPALAG* |
| Ga0181519_104034531 | 3300014658 | Bog | VECATITYDQLTAGTMAAGATRQRRPFSKVVEPALAG* |
| Ga0182041_108069652 | 3300016294 | Soil | YLIRRAVECATITYDQLKAGVIPAGANRVRRLPVMVGQGKPVLA |
| Ga0182035_110586831 | 3300016341 | Soil | GLDRYLIRRAVECATITHDQLTAGLLLAGAARVRRLPATVG |
| Ga0182035_111680151 | 3300016341 | Soil | GLDRYLIRRAVECATITHDQLTAGLLLAGAARVRRLPATVGQPASAG |
| Ga0182035_114174921 | 3300016341 | Soil | LDRYLIRRAVECATITYDQLTASLMPAGATRIRRLPATVGRPALA |
| Ga0182035_115361771 | 3300016341 | Soil | LDRYLIRRAVECATITYDQLTAGAMRVRRLLAAVGEPALAG |
| Ga0182032_108196021 | 3300016357 | Soil | AVECATITYDQLKAGTMPAGAGRVRRLPATVGQPASAG |
| Ga0182032_115177621 | 3300016357 | Soil | VECATITYDQLTAGAMPAGAARVHRPPATVGRPALAG |
| Ga0182032_117584602 | 3300016357 | Soil | AVECATITYDQLKAGAMPVGAARVRRLPAIVGQPALAG |
| Ga0182034_101308881 | 3300016371 | Soil | GYLIRRAVECATITYNQLKAGIMPDGANRGRRVATEVVQPALAR |
| Ga0182034_117893091 | 3300016371 | Soil | EYATITYDQLTAGAMPAGAARVHRPPATVGQPALAG |
| Ga0182040_102497002 | 3300016387 | Soil | GYLIRRAVECATITYDQLKTATMPSGANRIRRPRAAVAEPALAG |
| Ga0182040_106601811 | 3300016387 | Soil | LDRYLIRRAVECATITYDQLTAGAMPAGAARVHRPPATVGRPALAG |
| Ga0182037_104376812 | 3300016404 | Soil | AVECATITYDQLKAGAIPSGASRVRRLPVMVGQPALA |
| Ga0182037_118331532 | 3300016404 | Soil | AVECATITYDQLKTATMPGGANRIRRPRAAVAEPALAG |
| Ga0182038_104740022 | 3300016445 | Soil | VECATITYDQLKAGAIPSGASRVRRLPVMVGQPALA |
| Ga0066667_103653491 | 3300018433 | Grasslands Soil | RRAVECATVTYDQLKAGNLPDGAERIRRRPAAVAEPALAG |
| Ga0181502_15192611 | 3300019242 | Peatland | CATITYDQLTAGTMAAGATRQRRPFSKVVEPALAG |
| Ga0210407_100402824 | 3300020579 | Soil | LIRRAVECATITYDQLKTGTLLGGANRVRRLPATVAQPALAG |
| Ga0210407_100962321 | 3300020579 | Soil | RAVECATITYDQLKTGTLPGGAHRVRRLPAAVAQPALAG |
| Ga0210407_105855504 | 3300020579 | Soil | CATITSDQLKTGTLPGGAHRVRRLPAAVAQPALAG |
| Ga0210403_103093272 | 3300020580 | Soil | ECATITYDQLKTGTLPGGAHRVRRLPAAVAQPALAG |
| Ga0210403_106565402 | 3300020580 | Soil | AVECATITYDQLKTGTLLGGANRVRRLPAAVAQPALAG |
| Ga0210399_108376312 | 3300020581 | Soil | RAVECTTITYDQLKTGTMPGGAHRIRRPPAAVAQPALAG |
| Ga0210401_103979571 | 3300020583 | Soil | PDRYLIRRAVECATITYDQLTAGVMPAGAARVRHLPATVVQPALAR |
| Ga0210406_104465323 | 3300021168 | Soil | AVECATITYDQLKTGTLLGGANRVRRLPAAIAQPALAG |
| Ga0210405_100300911 | 3300021171 | Soil | YLIRRAVECATITYDQLKTGTLLGGANRVRRLPATVAQPALAG |
| Ga0210405_100748261 | 3300021171 | Soil | LIRRAVECATITYDQLTAGVMPAGAARVRRLPATVAQPALAG |
| Ga0210405_108022031 | 3300021171 | Soil | VECATITYDQLKTGTLLGGANRVRRLPAAIAQPALAG |
| Ga0210405_109087031 | 3300021171 | Soil | ECATITYDQLKTGTLLGGANRVRRLPAAVAQPALAR |
| Ga0210408_100944031 | 3300021178 | Soil | LIRRSVECTTITYDQLTAGDTPAGAARVRRLPATVGEPALAG |
| Ga0210408_100965004 | 3300021178 | Soil | CATITYDQLKTGTLPGGAHRVRRLPAAVAQPALAG |
| Ga0210408_105838721 | 3300021178 | Soil | ECATITYDQLKTGTLLGGANRVRRLPAAVAQPALAG |
| Ga0210408_107294092 | 3300021178 | Soil | RAVECATITYDQLKTGTLLGGANRVRRLPAAIAQPALAG |
| Ga0210396_102304315 | 3300021180 | Soil | CATITYDQLTAGAMPAGAARVRRLPATVGLPALAG |
| Ga0210393_112226551 | 3300021401 | Soil | RAVECTTITYDQLKTGTLLGGANRVRRLPAAVAQPALAR |
| Ga0210387_115716102 | 3300021405 | Soil | GYLIRRAVGCATITYDQLKAGTLTGGANRVRRLPATVA |
| Ga0210387_116857651 | 3300021405 | Soil | AVECATITYDQLKTGTLPGSAHRVRRLPAAVAQPALAG |
| Ga0210394_112388861 | 3300021420 | Soil | RAVECATITYAQLTAGIMPSGANRIRRLPATVAQSALAG |
| Ga0210384_103275531 | 3300021432 | Soil | AVECATITYDQLKTGTLPGGAHRVRRLPAAVAQPALAG |
| Ga0213878_102374071 | 3300021444 | Bulk Soil | RAVECATITYDQLKAGAMPAGAARVRRLPAIVGQPALAG |
| Ga0210402_110367963 | 3300021478 | Soil | RAVECATITYDQLTAGVMPVGAARVRRLPATVGQPALAG |
| Ga0210402_114038412 | 3300021478 | Soil | VECATITYDQLKTGTLPGGAHRVRRLPAAVAQPALAG |
| Ga0210410_116575662 | 3300021479 | Soil | APLKCATITYDQLKTGTLPGGANRVRRLPAAVAQPALAG |
| Ga0210409_106785311 | 3300021559 | Soil | YLIRRAVECATITYDQLTAGVMPAGAARVRRLPATVVQPALAGYG |
| Ga0126371_101877975 | 3300021560 | Tropical Forest Soil | AVQCATITFDQLKAGAMPAGAARVRRLPATVGQPALAG |
| Ga0126371_104086661 | 3300021560 | Tropical Forest Soil | ECATITYDQLKAGAMPAGAARVRRLPAIVGQPALAG |
| Ga0126371_129686422 | 3300021560 | Tropical Forest Soil | VECATITYNQLKAGAMPTGASRFRRLPVMVGQPALA |
| Ga0126371_134778882 | 3300021560 | Tropical Forest Soil | AVECATITYDQLKTGAMLAGAARVRRLPATVGQPASAG |
| Ga0257160_11053271 | 3300026489 | Soil | AVECATITYDQLKTGTLPGGANRVRRLPAAVAQPALAG |
| Ga0209474_101903441 | 3300026550 | Soil | AVECATVTYDQLKAGNLPDGAERIRRLPAAVAEPALAG |
| Ga0209648_103985553 | 3300026551 | Grasslands Soil | AVECATITYDQLKTGTLPGGANRVRRLPAEVVQPALAR |
| Ga0209648_107672002 | 3300026551 | Grasslands Soil | AVECATITYDQLKTGTLPGGANRVRRLPAAVAQPALAR |
| Ga0207949_10020735 | 3300026999 | Forest Soil | IRRAVECATITYDQLTAGVMPAGAARVRDLPAIVVQPALAG |
| Ga0208097_10105892 | 3300027173 | Forest Soil | IRRAVECATITYDQLTAGVMPAGAARVRRLPAMVVQPALAG |
| Ga0209419_11294651 | 3300027537 | Forest Soil | AVECATITYDQLKTGAMPGGANRVRRPPAAVAQPALAR |
| Ga0209656_102419303 | 3300027812 | Bog Forest Soil | AVECATITYDQLKAGAIPTGASRVHRLPVMVGKPALA |
| Ga0209275_102479621 | 3300027884 | Soil | CATITYDQLTAGVMPAGAARVRRLPATVVQPALAG |
| Ga0209380_101724453 | 3300027889 | Soil | IRRAVECATITYDQLTAGVMPAGAARVRRLPATVVQPALAG |
| Ga0170834_1112701961 | 3300031057 | Forest Soil | VECTTITYDQLKTGTLPGGANRVRRLPAAVAQPALAG |
| Ga0170820_162987542 | 3300031446 | Forest Soil | YLIRRAVECATITYDQLKTGTLLGGANRVRRLPAAVAQPALAG |
| Ga0318541_102790573 | 3300031545 | Soil | LIRRAVECATITYDQLTAGTMPTGAARVRRLPLQSGNLL |
| Ga0318541_103728232 | 3300031545 | Soil | IAILIRPAVECATITYDQLKAGTMPAGAGRVRRLPATVGQPASAG |
| Ga0318541_106992031 | 3300031545 | Soil | RAVECATITYDQLKTATMPGGANRIRRPRAAVAEPALAG |
| Ga0318528_106409021 | 3300031561 | Soil | VECATITYDQLKAGVIPAGATRVRRLPVMVGQGNLF |
| Ga0310915_102087931 | 3300031573 | Soil | AVECATITYDQLTAGAMPAGAARVHRPPATVGQPALAG |
| Ga0318561_102594741 | 3300031679 | Soil | RAVECASITYDQLTAGDMLAGGARVRRLPAKVGEPALAR |
| Ga0318574_105885621 | 3300031680 | Soil | RAVECATITYDQLTAGAMPAGAARVHRPPATVGQPALAG |
| Ga0318572_105707111 | 3300031681 | Soil | IRRAVECASITYDQLTAGDMLAGGARVRRLPAKVGEPALAR |
| Ga0318572_106072431 | 3300031681 | Soil | YLIRRAVECATITYDQLKAGAISTGASRVRRLPVMVGQPALAR |
| Ga0306917_103290013 | 3300031719 | Soil | RAVECATITYDQLKAGAMPVGAARVRRLPAIVGQPALAG |
| Ga0306917_112009121 | 3300031719 | Soil | ECATITYDQLTASLMPAGATRIRRLPVTVWRPALA |
| Ga0307475_101924063 | 3300031754 | Hardwood Forest Soil | AVECATITYDQLTAGVMPAGAARVRRLPAIVVQPALAG |
| Ga0318509_107178071 | 3300031768 | Soil | ECATITYDQLTAGAMPAGAARVHRPPATVGQPALAG |
| Ga0318521_101609631 | 3300031770 | Soil | AVECATITYNQLKAGIMPDGANRVRRVATEVVQPALAR |
| Ga0318546_107504321 | 3300031771 | Soil | VECATITYDQLTAGAMPAGAARVHRPPATVGQPALAG |
| Ga0318546_108255193 | 3300031771 | Soil | RAVECATITYDQLKAGAIPSGAPRVRRLPVMVGQPALA |
| Ga0318543_103233751 | 3300031777 | Soil | RRAVECATITYDQLTAGAMPAGAARVHRPPATVGQPALAG |
| Ga0318576_105250001 | 3300031796 | Soil | RAVECATITYDQLKTGTMPGGANRIRRPRAAVAEPALAG |
| Ga0318550_106632121 | 3300031797 | Soil | VECATITYDQLTAGLLLAGAARVRRLPATVGQPASAG |
| Ga0318497_100429496 | 3300031805 | Soil | GLDRYLIRRAVECATITYDQLTAGAMPAGARVHRPPATVGQPALAG |
| Ga0306925_104021812 | 3300031890 | Soil | VECATITYNQLKAGIMPDGANRIRRVATEVVQPALAR |
| Ga0306925_113017421 | 3300031890 | Soil | RAVECATITYDQLKASAMPTGAARIPRLPATVGQPALAG |
| Ga0318536_104154071 | 3300031893 | Soil | AVECATITYDQLKAGAIPSGAPRVRRLPVMVGQPALA |
| Ga0306923_109586131 | 3300031910 | Soil | RAVECATITYDQLKAGIMPDGANRVRRAAAEVARPALAR |
| Ga0306921_108217781 | 3300031912 | Soil | AVECATITYDQLTAGAMPAGAARVHRPPATVGRPALAG |
| Ga0306921_119882083 | 3300031912 | Soil | VECATITYDQLKAGAIPSGAPRVRRLPVMVGQPALA |
| Ga0310912_104923381 | 3300031941 | Soil | RYLIRRAVECATITYDQLTAGLLLAGAARVRRLPATVG |
| Ga0310916_105210523 | 3300031942 | Soil | VGLDRYLIRRAVECATITYDQLTASLMPAGATRIRRLPATVGRPALA |
| Ga0310916_114779641 | 3300031942 | Soil | DRYLIRRAVECATITYDQLTAGAMPAGAARVRRLPAAVGEPALAR |
| Ga0310913_103384801 | 3300031945 | Soil | LIRRAVECATITYDQLTASLMPAGATRIRRLPATVGRPALA |
| Ga0310909_113778922 | 3300031947 | Soil | GYLIRRAVECATITYDQLKTGTMPGGANRIRRPRAAVAEPALAG |
| Ga0310909_114204901 | 3300031947 | Soil | ECATITYDQLKTATMPGGANRIRRPRAAVAEPALAG |
| Ga0306926_111243771 | 3300031954 | Soil | ELDRYLIRRAVECATITYDQLKAGAIPAGAARIPRSPATVGQPALAG |
| Ga0306926_120008592 | 3300031954 | Soil | RAVECATITYNQLKAGIMPDGANRVRRVATEVVQPALAR |
| Ga0307479_103263893 | 3300031962 | Hardwood Forest Soil | DRYLIRRAVECATITYDQLTAGVMPAGAARVRRLPATVVQPALAG |
| Ga0306922_106850911 | 3300032001 | Soil | VECASITYDQLTAGDMLAGGARVRRLPAKVGEPALAR |
| Ga0306922_120348652 | 3300032001 | Soil | CATITYDQLKTATMPGGANRIRRPRAAVAEPALAG |
| Ga0310911_101981551 | 3300032035 | Soil | GLDRYLIRRAVECATITYDQLTTGLSLAGAARVRRLPATVGQPASAG |
| Ga0318556_103894391 | 3300032043 | Soil | RAVECATITYDQLTTGLLLAGAARVRRLPATVGQPASAG |
| Ga0318513_101999921 | 3300032065 | Soil | AVECATITYDQLTAGAMPAGAARVHRPPATVRQPALAG |
| Ga0306924_102454074 | 3300032076 | Soil | AVECATITYDQLKTATMPSGANRIRRPRAAVAEPALAG |
| Ga0306924_111467512 | 3300032076 | Soil | DGLDRYLIRRAVECATITHDQLTAGLLLAGAARVRRLPATVGQPASAG |
| Ga0306924_117957291 | 3300032076 | Soil | AVECATITYDQLTASLMPAGATRIRRLPVTVWRPALA |
| Ga0306924_118505101 | 3300032076 | Soil | AVECATITYDQLKTGTMPGGANRIRRPRAAVAEPALAG |
| Ga0306924_125909982 | 3300032076 | Soil | CATITYDQLKAGAMPVGAARVRRLPAIVGQPALAG |
| Ga0306920_1009008681 | 3300032261 | Soil | VECATITYDQLTASLMPAGATRIRRLPVTVWRPALA |
| Ga0306920_1014953261 | 3300032261 | Soil | RAVECATITYDQLTASLMPAGATRIRRLPVTVWRPALA |
| Ga0306920_1022710642 | 3300032261 | Soil | VECATITYDQLTASLMPAGATRIRRLPATVGRPALA |
| Ga0318519_108072811 | 3300033290 | Soil | LIRRAVECATITYDQLKASAMPTGAARIPRLPATVGQPALAG |
| ⦗Top⦘ |