


| Basic Information | |
|---|---|
| Family ID | F051974 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 143 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MFINNQGNYLNKSDTDVELEILFIASPIRPEIGKTSIFLT |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 82.73 % |
| % of genes near scaffold ends (potentially truncated) | 94.41 % |
| % of genes from short scaffolds (< 2000 bps) | 90.91 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.028 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (47.552 % of family members) |
| Environment Ontology (ENVO) | Unclassified (79.720 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.713 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.88% β-sheet: 0.00% Coil/Unstructured: 69.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF14693 | Ribosomal_TL5_C | 70.63 |
| PF01386 | Ribosomal_L25p | 11.89 |
| PF01195 | Pept_tRNA_hydro | 6.99 |
| PF01926 | MMR_HSR1 | 2.80 |
| PF06071 | YchF-GTPase_C | 2.10 |
| PF00032 | Cytochrom_B_C | 0.70 |
| PF01336 | tRNA_anti-codon | 0.70 |
| PF14572 | Pribosyl_synth | 0.70 |
| PF10399 | UCR_Fe-S_N | 0.70 |
| PF01218 | Coprogen_oxidas | 0.70 |
| PF02636 | Methyltransf_28 | 0.70 |
| PF00216 | Bac_DNA_binding | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG1825 | Ribosomal protein L25 (general stress protein Ctc) | Translation, ribosomal structure and biogenesis [J] | 11.89 |
| COG0193 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 6.99 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 2.10 |
| COG1565 | SAM-dependent methyltransferase, MidA family | General function prediction only [R] | 0.70 |
| COG0408 | Coproporphyrinogen-III oxidase HemH, oxygen-dependent | Coenzyme transport and metabolism [H] | 0.70 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.70 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.03 % |
| All Organisms | root | All Organisms | 27.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001346|JGI20151J14362_10155687 | Not Available | 678 | Open in IMG/M |
| 3300001354|JGI20155J14468_10001517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 18090 | Open in IMG/M |
| 3300001354|JGI20155J14468_10051648 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300001945|GOS2241_1002003 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
| 3300001973|GOS2217_10154928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3766 | Open in IMG/M |
| 3300002033|GOS24894_10047785 | Not Available | 1013 | Open in IMG/M |
| 3300003476|NAP2_1029110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1099 | Open in IMG/M |
| 3300003476|NAP2_1062853 | Not Available | 783 | Open in IMG/M |
| 3300003477|nap3_10181232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 517 | Open in IMG/M |
| 3300005522|Ga0066861_10037331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1739 | Open in IMG/M |
| 3300005523|Ga0066865_10249212 | Not Available | 669 | Open in IMG/M |
| 3300005605|Ga0066850_10327793 | Not Available | 537 | Open in IMG/M |
| 3300005606|Ga0066835_10271224 | Not Available | 584 | Open in IMG/M |
| 3300006309|Ga0068479_1100739 | Not Available | 600 | Open in IMG/M |
| 3300006316|Ga0068473_1263924 | Not Available | 762 | Open in IMG/M |
| 3300006331|Ga0068488_1363172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 772 | Open in IMG/M |
| 3300006334|Ga0099675_1464522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 517 | Open in IMG/M |
| 3300006337|Ga0068495_1483266 | Not Available | 689 | Open in IMG/M |
| 3300006350|Ga0099954_1039906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1106 | Open in IMG/M |
| 3300006351|Ga0099953_1189328 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300006921|Ga0098060_1032891 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1573 | Open in IMG/M |
| 3300008097|Ga0111541_10220238 | Not Available | 799 | Open in IMG/M |
| 3300009071|Ga0115566_10287885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 973 | Open in IMG/M |
| 3300009481|Ga0114932_10556911 | Not Available | 672 | Open in IMG/M |
| 3300011326|Ga0138403_1014354 | Not Available | 533 | Open in IMG/M |
| 3300011330|Ga0138383_1174537 | Not Available | 862 | Open in IMG/M |
| 3300012919|Ga0160422_10670008 | Not Available | 661 | Open in IMG/M |
| 3300012919|Ga0160422_10799976 | Not Available | 605 | Open in IMG/M |
| 3300012928|Ga0163110_11377318 | Not Available | 570 | Open in IMG/M |
| 3300012936|Ga0163109_11297359 | Not Available | 531 | Open in IMG/M |
| 3300012954|Ga0163111_10187383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1778 | Open in IMG/M |
| 3300012954|Ga0163111_10927653 | Not Available | 837 | Open in IMG/M |
| 3300012954|Ga0163111_11465987 | Not Available | 674 | Open in IMG/M |
| 3300012954|Ga0163111_11556603 | Not Available | 656 | Open in IMG/M |
| 3300017762|Ga0181422_1251627 | Not Available | 523 | Open in IMG/M |
| 3300017770|Ga0187217_1205546 | Not Available | 650 | Open in IMG/M |
| 3300017781|Ga0181423_1042744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1821 | Open in IMG/M |
| 3300017783|Ga0181379_1099155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1068 | Open in IMG/M |
| 3300017950|Ga0181607_10487739 | Not Available | 660 | Open in IMG/M |
| 3300017969|Ga0181585_10693405 | Not Available | 666 | Open in IMG/M |
| 3300017985|Ga0181576_10855687 | Not Available | 535 | Open in IMG/M |
| 3300018417|Ga0181558_10665442 | Not Available | 532 | Open in IMG/M |
| 3300018423|Ga0181593_10587708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
| 3300018428|Ga0181568_11119795 | Not Available | 594 | Open in IMG/M |
| 3300018428|Ga0181568_11482045 | Not Available | 500 | Open in IMG/M |
| 3300020055|Ga0181575_10271591 | Not Available | 971 | Open in IMG/M |
| 3300020194|Ga0181597_10019780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5047 | Open in IMG/M |
| 3300020239|Ga0211501_1112041 | Not Available | 544 | Open in IMG/M |
| 3300020240|Ga0211494_1078718 | Not Available | 643 | Open in IMG/M |
| 3300020250|Ga0211627_1064866 | Not Available | 578 | Open in IMG/M |
| 3300020264|Ga0211526_1096966 | Not Available | 502 | Open in IMG/M |
| 3300020282|Ga0211667_1155934 | Not Available | 543 | Open in IMG/M |
| 3300020319|Ga0211517_1068865 | Not Available | 690 | Open in IMG/M |
| 3300020320|Ga0211597_1004309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3814 | Open in IMG/M |
| 3300020347|Ga0211504_1147721 | Not Available | 512 | Open in IMG/M |
| 3300020368|Ga0211674_10140680 | Not Available | 624 | Open in IMG/M |
| 3300020368|Ga0211674_10164333 | Not Available | 571 | Open in IMG/M |
| 3300020378|Ga0211527_10128078 | Not Available | 732 | Open in IMG/M |
| 3300020379|Ga0211652_10126803 | Not Available | 774 | Open in IMG/M |
| 3300020385|Ga0211677_10245909 | Not Available | 728 | Open in IMG/M |
| 3300020388|Ga0211678_10039428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2284 | Open in IMG/M |
| 3300020388|Ga0211678_10343602 | Not Available | 601 | Open in IMG/M |
| 3300020391|Ga0211675_10030572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2705 | Open in IMG/M |
| 3300020391|Ga0211675_10277184 | Not Available | 714 | Open in IMG/M |
| 3300020395|Ga0211705_10179192 | Not Available | 777 | Open in IMG/M |
| 3300020400|Ga0211636_10082553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1317 | Open in IMG/M |
| 3300020400|Ga0211636_10096330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1201 | Open in IMG/M |
| 3300020400|Ga0211636_10202233 | Not Available | 772 | Open in IMG/M |
| 3300020401|Ga0211617_10150889 | Not Available | 969 | Open in IMG/M |
| 3300020404|Ga0211659_10201758 | Not Available | 892 | Open in IMG/M |
| 3300020404|Ga0211659_10509314 | Not Available | 513 | Open in IMG/M |
| 3300020405|Ga0211496_10380306 | Not Available | 526 | Open in IMG/M |
| 3300020409|Ga0211472_10164476 | Not Available | 887 | Open in IMG/M |
| 3300020413|Ga0211516_10365821 | Not Available | 642 | Open in IMG/M |
| 3300020414|Ga0211523_10251600 | Not Available | 728 | Open in IMG/M |
| 3300020414|Ga0211523_10358477 | Not Available | 593 | Open in IMG/M |
| 3300020414|Ga0211523_10402455 | Not Available | 553 | Open in IMG/M |
| 3300020417|Ga0211528_10248536 | Not Available | 673 | Open in IMG/M |
| 3300020417|Ga0211528_10352962 | Not Available | 546 | Open in IMG/M |
| 3300020418|Ga0211557_10405631 | Not Available | 605 | Open in IMG/M |
| 3300020420|Ga0211580_10049371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1795 | Open in IMG/M |
| 3300020424|Ga0211620_10362410 | Not Available | 616 | Open in IMG/M |
| 3300020429|Ga0211581_10138387 | Not Available | 984 | Open in IMG/M |
| 3300020429|Ga0211581_10455548 | Not Available | 522 | Open in IMG/M |
| 3300020431|Ga0211554_10321349 | Not Available | 725 | Open in IMG/M |
| 3300020432|Ga0211556_10425697 | Not Available | 589 | Open in IMG/M |
| 3300020432|Ga0211556_10444695 | Not Available | 574 | Open in IMG/M |
| 3300020433|Ga0211565_10239413 | Not Available | 790 | Open in IMG/M |
| 3300020437|Ga0211539_10288507 | Not Available | 679 | Open in IMG/M |
| 3300020440|Ga0211518_10063769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2055 | Open in IMG/M |
| 3300020440|Ga0211518_10101117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1525 | Open in IMG/M |
| 3300020441|Ga0211695_10321616 | Not Available | 573 | Open in IMG/M |
| 3300020441|Ga0211695_10423724 | Not Available | 507 | Open in IMG/M |
| 3300020442|Ga0211559_10553613 | Not Available | 522 | Open in IMG/M |
| 3300020446|Ga0211574_10091804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1338 | Open in IMG/M |
| 3300020446|Ga0211574_10140806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1054 | Open in IMG/M |
| 3300020447|Ga0211691_10191029 | Not Available | 787 | Open in IMG/M |
| 3300020448|Ga0211638_10068841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1558 | Open in IMG/M |
| 3300020450|Ga0211641_10400201 | Not Available | 662 | Open in IMG/M |
| 3300020450|Ga0211641_10437334 | Not Available | 628 | Open in IMG/M |
| 3300020454|Ga0211548_10402520 | Not Available | 670 | Open in IMG/M |
| 3300020459|Ga0211514_10612372 | Not Available | 532 | Open in IMG/M |
| 3300020460|Ga0211486_10198307 | Not Available | 877 | Open in IMG/M |
| 3300020463|Ga0211676_10095929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1964 | Open in IMG/M |
| 3300020463|Ga0211676_10259189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1014 | Open in IMG/M |
| 3300020463|Ga0211676_10368329 | Not Available | 796 | Open in IMG/M |
| 3300020463|Ga0211676_10411095 | Not Available | 737 | Open in IMG/M |
| 3300020466|Ga0211714_10115425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1320 | Open in IMG/M |
| 3300020467|Ga0211713_10515447 | Not Available | 582 | Open in IMG/M |
| 3300020469|Ga0211577_10536423 | Not Available | 704 | Open in IMG/M |
| 3300020472|Ga0211579_10695123 | Not Available | 567 | Open in IMG/M |
| 3300020474|Ga0211547_10179448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1091 | Open in IMG/M |
| 3300020810|Ga0181598_1306515 | Not Available | 562 | Open in IMG/M |
| 3300021364|Ga0213859_10299477 | Not Available | 727 | Open in IMG/M |
| (restricted) 3300024324|Ga0233443_1316260 | Not Available | 514 | Open in IMG/M |
| 3300026083|Ga0208878_1063300 | Not Available | 939 | Open in IMG/M |
| 3300026256|Ga0208639_1030731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1651 | Open in IMG/M |
| 3300026266|Ga0208410_1002546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 8485 | Open in IMG/M |
| 3300026266|Ga0208410_1067722 | Not Available | 949 | Open in IMG/M |
| 3300026269|Ga0208766_1019217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2560 | Open in IMG/M |
| 3300026270|Ga0207993_1189054 | Not Available | 523 | Open in IMG/M |
| 3300027830|Ga0209359_10304414 | Not Available | 729 | Open in IMG/M |
| 3300027859|Ga0209503_10467382 | Not Available | 625 | Open in IMG/M |
| 3300031774|Ga0315331_10788243 | Not Available | 664 | Open in IMG/M |
| 3300031775|Ga0315326_10800543 | Not Available | 587 | Open in IMG/M |
| 3300031785|Ga0310343_10228175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1288 | Open in IMG/M |
| 3300031785|Ga0310343_10381576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1017 | Open in IMG/M |
| 3300031886|Ga0315318_10773446 | Not Available | 536 | Open in IMG/M |
| 3300032006|Ga0310344_10487810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1057 | Open in IMG/M |
| 3300032006|Ga0310344_11391967 | Not Available | 576 | Open in IMG/M |
| 3300032011|Ga0315316_10729302 | Not Available | 821 | Open in IMG/M |
| 3300032011|Ga0315316_10799170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 778 | Open in IMG/M |
| 3300032011|Ga0315316_11265232 | Not Available | 590 | Open in IMG/M |
| 3300032047|Ga0315330_10483935 | Not Available | 750 | Open in IMG/M |
| 3300032047|Ga0315330_10591930 | Not Available | 659 | Open in IMG/M |
| 3300032073|Ga0315315_10877842 | Not Available | 812 | Open in IMG/M |
| 3300032073|Ga0315315_11119417 | Not Available | 700 | Open in IMG/M |
| 3300032073|Ga0315315_11527667 | Not Available | 578 | Open in IMG/M |
| 3300032278|Ga0310345_11842470 | Not Available | 589 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 47.55% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 12.59% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 7.69% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.99% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 4.20% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.50% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 3.50% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.80% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 2.10% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.10% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 2.10% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 1.40% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.70% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.70% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.70% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.70% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001945 | Marine microbial communities from Galapagos, Equador - GS026 | Environmental | Open in IMG/M |
| 3300001973 | Marine microbial communities from Bermuda, Atlantic Ocean - GS001 | Environmental | Open in IMG/M |
| 3300002033 | Marine microbial communities from the Sargasso Sea - GS000a &b | Environmental | Open in IMG/M |
| 3300003476 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 2 | Environmental | Open in IMG/M |
| 3300003477 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300006309 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0500m | Environmental | Open in IMG/M |
| 3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
| 3300006316 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_1000m | Environmental | Open in IMG/M |
| 3300006331 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_1000m | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006337 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025m | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006351 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045m | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300011326 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S21 Surf_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011330 | Marine microbial communities from the Southern Atlantic ocean - KN S17 Surf_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020239 | Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555909-ERR598959) | Environmental | Open in IMG/M |
| 3300020240 | Marine microbial communities from Tara Oceans - TARA_B000000477 (ERX556046-ERR598982) | Environmental | Open in IMG/M |
| 3300020250 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555986-ERR599129) | Environmental | Open in IMG/M |
| 3300020264 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556116-ERR599158) | Environmental | Open in IMG/M |
| 3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
| 3300020319 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX556039-ERR599073) | Environmental | Open in IMG/M |
| 3300020320 | Marine microbial communities from Tara Oceans - TARA_B000000441 (ERX556072-ERR598990) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020368 | Marine microbial communities from Tara Oceans - TARA_B100001027 (ERX556049-ERR599093) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020391 | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020405 | Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012) | Environmental | Open in IMG/M |
| 3300020409 | Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020424 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138) | Environmental | Open in IMG/M |
| 3300020429 | Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020432 | Marine microbial communities from Tara Oceans - TARA_B100002052 (ERX556103-ERR599100) | Environmental | Open in IMG/M |
| 3300020433 | Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020466 | Marine microbial communities from Tara Oceans - TARA_B100001540 (ERX556059-ERR598968) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300024324 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MG | Environmental | Open in IMG/M |
| 3300026083 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026256 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV76 (SPAdes) | Environmental | Open in IMG/M |
| 3300026266 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 (SPAdes) | Environmental | Open in IMG/M |
| 3300026269 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes) | Environmental | Open in IMG/M |
| 3300026270 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20151J14362_101556871 | 3300001346 | Pelagic Marine | MITNNQGNYLNKSDTEVEFEILFIASPIRPEIGKTSMFLTFLILF |
| JGI20155J14468_1000151717 | 3300001354 | Pelagic Marine | MSFSSSYIITQDNYLNKSDTDVELEILFIASPIRPEIGKTSIFLALLILS* |
| JGI20155J14468_100516485 | 3300001354 | Pelagic Marine | MFVNNQGNYLNKSDTEVELDILLIASPIKAEIGKTS |
| GOS2241_10020031 | 3300001945 | Marine | MFINNQGNYLNKSETDVELEILLIASPIRAEIGKTSMFLTFFVFSLL |
| GOS2217_101549281 | 3300001973 | Marine | MFINNQEIYLNKSDTDVEFEILFIASPIRPDMGKTSIFLTFLV |
| GOS24894_100477853 | 3300002033 | Marine | MFINNQGNYLNKSETEVEFDILFIASPIRPEIGKTSIFLTFFVFSTIIRLCQ |
| NAP2_10291103 | 3300003476 | Estuarine | MFINNQGNYLNKSDTDVELDILLIASPISPEIGKTSIFLTF |
| NAP2_10628532 | 3300003476 | Estuarine | MIINNQGIYLNKSDTDVEFEILFIASPIRPDIGKTSIFLTFLV |
| nap3_101812322 | 3300003477 | Estuarine | MLINNQGNYLNKSDTDVEFDILFIASPIRPDIGKTSIFLTFFVF* |
| Ga0066861_100373311 | 3300005522 | Marine | MLINNQGIYLNKSETEVELEILFIASPIRPEIGKTSIFL |
| Ga0066865_102492122 | 3300005523 | Marine | MQINNQGNYLNKSDTDVEFEILLIASPIRPEIGKTSIFLTFLVL |
| Ga0066850_103277931 | 3300005605 | Marine | MLFITQENYLNKSDTDVELEILFIASPIKLETVKTSIFLALLTLI |
| Ga0066835_102712241 | 3300005606 | Marine | MLINNQGIYLNKSDTDVEFEILFIASPIRPDIGKTSIFLTFLVL |
| Ga0068479_11007391 | 3300006309 | Marine | MLFITQENYLNKSDTDVELEILFIASPIKLEIVKTSI |
| Ga0068472_1015528215 | 3300006313 | Marine | LITQENYLNKSETDVEFEILLIASPIKFDTVRTSIF* |
| Ga0068473_12639241 | 3300006316 | Marine | MLFITQENYLNKSDTDVELEILFIASPIKLEIVKISIFLALLTLI*LS |
| Ga0068488_13631722 | 3300006331 | Marine | MLFITQENYLNKSDTDVELEILFIASPIKLEIVKISIFLAL |
| Ga0099675_14645222 | 3300006334 | Marine | MFINNQGNYLNKSDTEVELDILLIASPMRLEIGKTSIFLTFLAYCGNIF* |
| Ga0068495_14832662 | 3300006337 | Marine | MLTNNQGIYLNKSDTDVEFEILFIASPIRPDIGKTSMFL |
| Ga0099954_10399061 | 3300006350 | Marine | MFTNNQEIYLNKSDTDVEFEILFIASPIRPDIGKT |
| Ga0099953_11893281 | 3300006351 | Marine | MCLVYLNKSETDVELEILFIASPIRVEIGKTSMFLTFLVFSLLS |
| Ga0098060_10328911 | 3300006921 | Marine | MFTNNQGNYLNKSDTEVELDILLIASPIRPEIGKTSMFLTF |
| Ga0111541_102202381 | 3300008097 | Marine | MFINNQGNYLNKSDTDVELDILFIASPIRPEIGKTS |
| Ga0115566_102878851 | 3300009071 | Pelagic Marine | MIVNNQGNYLNKSDTDVEFDILLIASPIRPEIGNTSMF |
| Ga0114932_105569111 | 3300009481 | Deep Subsurface | MLINNQGNYLNKSETEVELEILLIASPIRPDIGKTSI |
| Ga0138403_10143541 | 3300011326 | Marine | MFTNNQGIYLNKSDTDVEFEILFIASPIRPDMGKTSIFLTFLVL |
| Ga0138383_11745371 | 3300011330 | Marine | MFINNQGNYLNKSETDVELEILFIASPIRAEIGKTSMF |
| Ga0160422_106700082 | 3300012919 | Seawater | MFTNNQGNYLNKSETDVELDILLIASAIRPEIGKTSIFL |
| Ga0160422_107999761 | 3300012919 | Seawater | MLINNQGNYLNKSDTDVELEILLIASPIKLEIDKTSIFLAL |
| Ga0163110_113773181 | 3300012928 | Surface Seawater | MLINNQGNYLNKSDTDVELDILFIASPIRLDMGKT |
| Ga0163109_112973591 | 3300012936 | Surface Seawater | MFINNQGIYLNKSDTDVEFEILFIASPIRPDIGKT |
| Ga0163111_101873834 | 3300012954 | Surface Seawater | MLANNQGIYLNKSETDVELEILFIASPIRPEIGKTSI |
| Ga0163111_109276531 | 3300012954 | Surface Seawater | MLINNQGIYLNKSDTDVEFDILFIASPIRLEIGKT |
| Ga0163111_114659871 | 3300012954 | Surface Seawater | MFINNQEIYLNKSDTEVEFDILLIASPIRPEIGKT |
| Ga0163111_115566031 | 3300012954 | Surface Seawater | MLINNQGNYLNKSDTDVELDILLIASPIRLEIGKTSIFLTL |
| Ga0181422_12516271 | 3300017762 | Seawater | MIVNNQGNYLNKSDTDVELDILFIASPMSAEIGKTSIFFTFLVFSLL |
| Ga0187217_12055461 | 3300017770 | Seawater | MFINNQGNYLNKSDTDVELEILFIASPIRPEIGKTSIFLT |
| Ga0181423_10427444 | 3300017781 | Seawater | MFINNQGNYLNKSDTDVELDILLIASPISPEIGKTSIFLTFL |
| Ga0181379_10991553 | 3300017783 | Seawater | MFINNQGIYLNKSETDVEFDILLIASPISPEIGKTSIFFT |
| Ga0181607_104877391 | 3300017950 | Salt Marsh | MFTNNQGNYLNKSDTDVEFEILLMASPIRPEIGKT |
| Ga0181585_106934052 | 3300017969 | Salt Marsh | MFTNNQEIYLNKSDTDVEFEILLIASPIRPDMGKTSIFL |
| Ga0181576_108556871 | 3300017985 | Salt Marsh | MLINNQGNYLNKSDTEVEFEILFIASPIRPEIGKTSIFLTFF |
| Ga0181558_106654421 | 3300018417 | Salt Marsh | MFINNQGIYLNKSDTEVELDILFIASPIRPEIGKTSMFFTFL |
| Ga0181593_105877082 | 3300018423 | Salt Marsh | MLINNQGNYLNKSETEVELEILFIASPIRPEIGKTSIFFTFLVFSNLEAFKNFX |
| Ga0181568_111197951 | 3300018428 | Salt Marsh | MLINNQGNYLNKSETEVELEILFIASPIRPEIGKTSIF |
| Ga0181568_114820451 | 3300018428 | Salt Marsh | MFINNQGIYLNKSDTEVEFEILFIASPIKVDMGKTSIFFMFLV |
| Ga0181575_102715911 | 3300020055 | Salt Marsh | MLANNQGNYLNKSETDVELEILFIASPMRPEIGKTSIFLTFLVLS |
| Ga0181597_100197807 | 3300020194 | Salt Marsh | MFINNQGNYLNKSDTEVELDILLMASPINPEIDKTSIFLAFLTFSK |
| Ga0211501_11120412 | 3300020239 | Marine | MLINNQGNYLNKSETEVELEIRLIASPIRPEIGKTSIFLTFFVLAIL |
| Ga0211494_10787181 | 3300020240 | Marine | MFINNQGNYLNKSDTDVELDILLIASPISPEIGKTSIFLTFLIFSI |
| Ga0211627_10648661 | 3300020250 | Marine | MFINNQGNYLNKSDTDVELDILLIASPISPEIGKTSIFLTFLIFS |
| Ga0211526_10969661 | 3300020264 | Marine | MLVNNQGFYLNKSDTEVELEILFIASPISPEIGKTSIFLTFLILXW |
| Ga0211667_11559341 | 3300020282 | Marine | MFINNQENYLNKSETEVEFDILLIASPINVEIGKTSMFLT |
| Ga0211517_10688652 | 3300020319 | Marine | MFINNQDIYLNKSDTDVEFEILFIASPIRLEIGKTSIFLTF |
| Ga0211597_10043091 | 3300020320 | Marine | MFINNQGNYLNKSETDVELEILFIASPIRAEIGKTSMFLTF |
| Ga0211504_11477212 | 3300020347 | Marine | MFTNNQGNYLNKSDTDVELDILLIASPIRPEIGKTSMFLTFFVF |
| Ga0211674_101406801 | 3300020368 | Marine | MFINNQGNYLNKSDTEVELEILLIASPIRPEIGKTSIFFACLVFS |
| Ga0211674_101643332 | 3300020368 | Marine | MFVNNQEIYLNKSDTDVEFEILLIASPIRPDMGKTSIFLTF |
| Ga0211527_101280781 | 3300020378 | Marine | MLINNQGNYLNKSDTDVEFDILFIASPIRPDIGKTSIFLTFFV |
| Ga0211652_101268031 | 3300020379 | Marine | MLINNQGNYLNKSDTDVELEILFIASPIRPEIGKTSMFF |
| Ga0211677_102459091 | 3300020385 | Marine | MLINNQGNYLNKSDTEVELEILFIASPIRPEIGKTS |
| Ga0211678_100394281 | 3300020388 | Marine | MLINNQGNYLNKSETDVELEILFIASPIRPEIGKTSIFLTF |
| Ga0211678_103436021 | 3300020388 | Marine | MFTNNQGNYLNKSETEVELDILFIASPIRPEIGKTSIFLTF |
| Ga0211675_100305725 | 3300020391 | Marine | MFTNNQAVYLNKSDTDVEFEILFIASPMRPDIGKTSIFLTFL |
| Ga0211675_102771841 | 3300020391 | Marine | MFINNQDIYLNKSDTEVEFEILFIASPIRLEIGKTSIFLTF |
| Ga0211705_101791922 | 3300020395 | Marine | MLINNQDIYLNKSETEVELEILFIASPIRPEIGKTSIFLALL |
| Ga0211636_100825531 | 3300020400 | Marine | MFINNQGNYLNKSDTDVELDILLIASPMRLEIGKTSIFLTFLV |
| Ga0211636_100963301 | 3300020400 | Marine | MFVNNQDIYLNKSDTEVEFEILFIASPIRAEIGKTSIFL |
| Ga0211636_102022331 | 3300020400 | Marine | MIINNQGNYLNKSETDVELDILLIASPIRPEIGKTSMFFTLLVFW |
| Ga0211617_101508891 | 3300020401 | Marine | MSINNQGNYLNKSETEVELEILLIASPIRPEIGKTSI |
| Ga0211659_102017581 | 3300020404 | Marine | MFTNNQEIYLNKSDTDVEFEILFIASPIRPDMGKTSIFLTFLVLXT |
| Ga0211659_105093142 | 3300020404 | Marine | MFTNNQEIYLNKSETDVEFEILFIASPIRPDIGKT |
| Ga0211496_103803062 | 3300020405 | Marine | MFINNQGNYLNKSETDVELDILLIASPIKAEIGKT |
| Ga0211472_101644761 | 3300020409 | Marine | MIINNQGNYLNKSDTEVELDILFIASPIRPEIGKTSIFLTFLVLFV |
| Ga0211516_103658212 | 3300020413 | Marine | MFINNQGNYLNKSETEVEFDILFIASPIRPEIGKTSIFLTFLVFST |
| Ga0211523_102516001 | 3300020414 | Marine | MLINNQGNYLNKSDTDVEFDILFIASPIRPDIGKTSIF |
| Ga0211523_103584771 | 3300020414 | Marine | MLINNQGNYLNKSDTEVELEILFIASPIRLEIGKTS |
| Ga0211523_104024551 | 3300020414 | Marine | MLINNQGIYLNKSDTEVEFDILFIASPIKGEIVKTSI |
| Ga0211528_102485362 | 3300020417 | Marine | MIVNNQDIYLNKSETEVELEILFIASPIKAEIGKTSIFFIFL |
| Ga0211528_103529622 | 3300020417 | Marine | MLINNQGNYLNKSDTDVELEILFIASPIRPEIGKTSIFLT |
| Ga0211557_102578842 | 3300020418 | Marine | MFLITQVNYLNKSETEVELEILLIASPIRLEIDKTSIFLTFLIF |
| Ga0211557_104056311 | 3300020418 | Marine | MFINNQGNYLNKSDTDVELEILFIASPIRFETGKTSIFLTFLVFW |
| Ga0211580_100493711 | 3300020420 | Marine | MFINNQGNYLNKSETDVELEILFIASPIRAEIGKTSMFLTFLVFS |
| Ga0211620_103624101 | 3300020424 | Marine | MSTNNQGNYLNKSDTDVEFEILLMASPIRLEIDKTSMFFTFLVFST |
| Ga0211581_101383872 | 3300020429 | Marine | MLTNNQGNYLNKSETEVEFEILFIASPIRPEIGKTSMFFTFFVLTLLSIVS |
| Ga0211581_104555482 | 3300020429 | Marine | MFINNQDIYLNKSDTEVELEILLIASPINADIGKTSIFFIFLVFSPLFI |
| Ga0211554_103213492 | 3300020431 | Marine | MFINNQGNYLNKSETDVELEILFIASPIRAEIGKTSMFLTFFVFSLLSI |
| Ga0211556_104256971 | 3300020432 | Marine | MLINNQGNYLNKSETEVELEILFIASPISAEIGKTSIFLTL |
| Ga0211556_104446951 | 3300020432 | Marine | MLINNQGNYLNKSDTEVELEILFIASAIRLDICKISIF |
| Ga0211565_102394131 | 3300020433 | Marine | MLINNQGIYLNKSDTDVEFEILFIASPIRPDIGKTSIFLTFL |
| Ga0211539_102885071 | 3300020437 | Marine | MLTNNQGIYLNKSETDVEFEILFIASPIRPDIGKTS |
| Ga0211518_100637694 | 3300020440 | Marine | MFINNQGIYLNKSDTDVEFEILFIASPIRPDIGKTSIFLT |
| Ga0211518_101011173 | 3300020440 | Marine | MFTNNQGNYLNKSDTDVELDILFIASPIRAEIGKTSIFFTFLV |
| Ga0211695_103216161 | 3300020441 | Marine | MLINNQGNYLNKSETEVELEILFIASPIRAEIGKTSMFLTFFVFSLLS |
| Ga0211695_104237241 | 3300020441 | Marine | MIINNQGIYLNKSDTEVELDILLIASPIRPEIGKTSIFLTFL |
| Ga0211559_105536132 | 3300020442 | Marine | MFLNNQGNYLNKSETEVEFEILLIASPIRLEIGKTSMFLT |
| Ga0211574_100918043 | 3300020446 | Marine | MFINNQGIYLNKSETDVELEILFIASPIRPEIGKTSIFLTFLVF |
| Ga0211574_101408061 | 3300020446 | Marine | MLINNQGNYLNKSETDVELEILFIASPIRPEIGKTSIF |
| Ga0211574_103567611 | 3300020446 | Marine | MFINNQEIYLNKSETDVEFEILFIASPMRPDIGKTSIFLTFLVLCTLSIVSVI |
| Ga0211691_101910292 | 3300020447 | Marine | MFINNQGNYLNKSETDVELEILFIASPIRAEIGKTSIFLTFLVFSLLSIVS |
| Ga0211638_100688413 | 3300020448 | Marine | MFINNQGNYLNKSDTDVELEILFIASPIRFEIGKTSIFLTFLVFWL |
| Ga0211641_104002012 | 3300020450 | Marine | MFINNQGNYLNKSETDVELEILFIASPIRAEIGKTSMFLTFF |
| Ga0211641_104373342 | 3300020450 | Marine | MFSNNQGNYLNKSETDVELDILFIASPISPEIGKTS |
| Ga0211548_104025202 | 3300020454 | Marine | MFINNQGNYLNKSETDVELEILFIASPIRAEIGKTSMFLTFLVF |
| Ga0211514_106123722 | 3300020459 | Marine | MFTNNQGNYLNKSETDVELDILLIASPISAEIGKTSIFLTFFVFSPL |
| Ga0211486_101983071 | 3300020460 | Marine | MFKNNQDIYLNKSDTDVEFEILLIASPIRPDIGKTSIFLTFLVL |
| Ga0211676_100959294 | 3300020463 | Marine | MFINNQDIYLNKSDTEVEFEILFIASPIRPEIGKTSIF |
| Ga0211676_102591893 | 3300020463 | Marine | MLTNNQGIYLNKSDTDVEFEILFIASPIRPDMGKT |
| Ga0211676_103683291 | 3300020463 | Marine | MFINNQGNYLNKSDTEVELDILLIASPIRPEIGKTSIF |
| Ga0211676_104110951 | 3300020463 | Marine | MFANNQGIYLNKSETDVEFEILFIASPIRPEIGKTSIFLTFLVFA |
| Ga0211714_101154253 | 3300020466 | Marine | MLINNQGNYLNKSETEVELEILFIASPIRAEIGKTSIFLT |
| Ga0211713_105154471 | 3300020467 | Marine | MFKNNQGNYLNKSETDVELEILFIASPIRVEIVKTSIFLT |
| Ga0211577_105364231 | 3300020469 | Marine | MLINNQGNYLNKSDTDVEFDILLIASPIRPEIGKTSIFLTFLVFSP |
| Ga0211579_106951232 | 3300020472 | Marine | MLINNQGNYLNKSETEFEFEILFIASPIRPEIGKTSI |
| Ga0211547_101794483 | 3300020474 | Marine | MFINNQGIYLNKSDTDVEFEILFIASPIRPDIGKTSIFLTFLVLXT |
| Ga0181598_13065152 | 3300020810 | Salt Marsh | MFINNQGNYLNKSDTEVELDILLIASPIRPEIGKTSI |
| Ga0213859_102994772 | 3300021364 | Seawater | MLINNQGNYLNKSDTDVELDILLIASPIRLEIGKTSIFL |
| (restricted) Ga0233443_13162602 | 3300024324 | Seawater | MILITQDNYLNKSDTDVELEILLIASPMRLEIGKTSIFF |
| Ga0208878_10633002 | 3300026083 | Marine | MFINNQGIYLNKSDTDVEFEILFIASPMRPEIGKTSIFLTFL |
| Ga0208639_10307311 | 3300026256 | Marine | MLFITQEDYLNKSDTDVELEILFIASPIKLETVKTSIFLAL |
| Ga0208410_10025461 | 3300026266 | Marine | MLINNQGIYLNKSETEVELEILFIASPIRPEIGKTSIFLTLLVFSPLL |
| Ga0208410_10677222 | 3300026266 | Marine | MFTNNQGNYLNKSDTDVELEILLIASPIRPEIGKTSMFL |
| Ga0208766_10192171 | 3300026269 | Marine | MLFITQEDYLNKSDTDVELEILFIASPIKLETVKTSIFLALLTLIXLS |
| Ga0207993_11890541 | 3300026270 | Marine | MLINNQGNYLNKSDTEVEFEILLIASPIRPEIGKTSIFFT |
| Ga0209359_103044141 | 3300027830 | Marine | MFTNNQGNYLNKSDTDVEFEILLMASPIRPEIGKTSIFLTFFVLSP |
| Ga0209503_104673821 | 3300027859 | Marine | MFANNQVFYLNKSDTEVELDILFIASPISAEIGKTSIFL |
| Ga0308001_103099671 | 3300031644 | Marine | MACSPSFLITQDNYLNKSDTDVELEILLIASPIRAEIGKSSIFLTFLILS |
| Ga0315331_107882431 | 3300031774 | Seawater | MFINNQGNYLNKSDTDVELDILLIASPISPEIGKTSIF |
| Ga0315326_108005432 | 3300031775 | Seawater | MLFITQENYLNKSDTDVELEILFIASPIKLETVKT |
| Ga0310343_102281753 | 3300031785 | Seawater | MLTNNQGNYLNKSETDVELEILLIASPIRPEIGKTSIFLTF |
| Ga0310343_103815763 | 3300031785 | Seawater | MFTNNQGNYLNKSETDVELDILLIASAIRPEIGKTSI |
| Ga0315318_107734462 | 3300031886 | Seawater | MLFITQENYLNRSDTDVELEILFIASPIKFDIVKTSIFLVFLTFSWLLI |
| Ga0310344_104878103 | 3300032006 | Seawater | MLINNQDIYLNKSETEVELEILFIASPIRPEIGKTSI |
| Ga0310344_113919672 | 3300032006 | Seawater | MLINNQGNYLNRSETEVELEILFIASPMRLETGKTSIFLTFFVFSPLSI |
| Ga0315316_107293022 | 3300032011 | Seawater | MFANNQGNYLNKSDTDVEFDILFIASPIRPEIGKTSIFLT |
| Ga0315316_107991701 | 3300032011 | Seawater | MLIITQENYLNRSDTDVELEILFIASPIKLETVKTSIFLALL |
| Ga0315316_112652322 | 3300032011 | Seawater | MLINNQGNYLNKSETEVELEILFIASPIRPEIGKTSIFLTFLVF |
| Ga0315330_104839352 | 3300032047 | Seawater | MFINNQGNYLNKSDTDVELDILLIASPISPEIGKTS |
| Ga0315330_105919302 | 3300032047 | Seawater | MFINNQGNYLNKSDTEVEFDILLIASPIRPEIGKTSIFLTFLVF |
| Ga0315315_108778421 | 3300032073 | Seawater | MLINNQGIYLNKSDTEVEFDILFIASPIRGEIVKTSIFLTFLVFS |
| Ga0315315_111194171 | 3300032073 | Seawater | MFINNQGNYLNKSDTDVELDILLIASPISPEIGKTSIFLTFLIFSELSIVS |
| Ga0315315_115276672 | 3300032073 | Seawater | MLINNQDIYLNKSETEVELEILFIASPIRPEIGKTSIFLALLVFSPLLI |
| Ga0310345_118424702 | 3300032278 | Seawater | MLIITQENYLNKSDTDVELEILFIASPIKLEIVKTSIFLALL |
| ⦗Top⦘ |